>TIGR01663 PNK-3'Pase polynucleotide kinase 3'-phosphatase; InterPro: IPR006550 These sequences represent the metazoan 5'-polynucleotide-kinase-3'-phosphatase, PNKP, which is believed to be involved in repair of oxidative DNA damage. Removal of 3'-phosphates is essential for the further processing of the break by DNA polymerases , . The central phosphatase domain is a member of the IIIA subfamily (IPR006549 from INTERPRO) of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. As is common in this superfamily, the enzyme is magnesium dependent. A difference between this enzyme and other HAD-superfamily phosphatases is in the third conserved catalytic motif which usually contains two conserved aspartate residues believed to be involved in binding the magnesium ion. Here, the second aspartate is replaced by a conserved arginine residue which may indicate an interaction with the phosphate backbone of the substrate. Very close relatives of this domain are also found separate from the N- and C-terminal domains seen here, as in the 3'-phosphatase found in plants. The larger family of these domains is described by IPR006551 from INTERPRO. Outside of the phosphatase domain is a P-loop ATP-binding motif associated with the kinase activity. The entry for the mouse homolog appears to be missing a large piece of sequence corresponding to the first conserved catalytic motif of the phosphatase domain as well as the conserved threonine of the second motif. Either this is a sequencing artifact or this may represent a pseudo- or non-functional gene. .

Probab=95.87 E-value=0.083 Score=31.05 Aligned_cols=99 Identities=22% Similarity=0.337 Sum_probs=62.5 Q ss_pred EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 89986788879799999999999977981999877889844100110012444541013456777889999977635655 Q gi|254780218|r 6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRP 85 (225) Q Consensus 6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~p 85 (225) T Consensus 371 ~V~~VGlPG~GKS~F---~~~~l~~~GY~~VN~-------------DTL--------GS~Q-~C~T~C~~---------- 415 (526) T TIGR01663 371 VVVAVGLPGAGKSTF---LKKFLVSAGYKIVNA-------------DTL--------GSTQ-RCLTACKR---------- 415 (526) T ss_pred EEEEECCCCCCHHHH---HHHHHCCCCCEEECC-------------CCC--------CCHH-HHHHHHHH---------- T ss_conf 899843899857788---885403578558715-------------456--------7224-58999999---------- Q ss_pred HHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHH Q ss_conf 423452587235424310001003444245776544420388984115665203487764432111 Q gi|254780218|r 86 ALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRY 151 (225) Q Consensus 86 ~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~ 151 (225) T Consensus 416 ~L~~G~~~~~DNT------------N~DAASR~~y~Q~A~~~~~PCRCl~~~~~~~Q~~HN~~FRE 469 (526) T TIGR01663 416 ALDSGKRVVVDNT------------NVDAASRKKYLQLAREKGVPCRCLLFTVTLEQVKHNIAFRE 469 (526) T ss_pred HHHCCCEEEEECC------------CCCHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHCC T ss_conf 9856988998568------------85776778999878646896177655061678542012202

HHsearch alignment for GI: 254780218 and conserved domain: TIGR01663