>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.

Probab=95.56  E-value=0.012  Score=36.01  Aligned_cols=30  Identities=40%  Similarity=0.653  Sum_probs=26.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             888689986788879799999999999977
Q gi|254780218|r    2 NSGLFISFEGIEGAGKTTHISLLKRFLQRK   31 (225)
Q Consensus         2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~   31 (225)
T Consensus        45 ~~Gei~gLlGpNGaGKSTllk~l~Gl~~p~   74 (236)
T cd03267          45 EKGEIVGFIGPNGAGKTTTLKILSGLLQPT   74 (236)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCC
T ss_conf             489599999999830999999996494887