>pfam07693 KAP_NTPase KAP family P-loop domain. The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side.

Probab=97.14 E-value=0.013 Score=35.87 Aligned_cols=37 Identities=30% Similarity=0.496 Sum_probs=29.9 Q ss_pred CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE Q ss_conf 8886899867888797999999999999779819998 Q gi|254780218|r 2 NSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT 38 (225) Q Consensus 2 ~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~ 38 (225) T Consensus 18 ~~~~vIgl~G~WGsGKTs~l~~~~~~L~~~~~~~~~v 54 (301) T pfam07693 18 APGFVIGLYGAWGSGKTSFLNLLEDELKEFPEEFHIV 54 (301) T ss_pred CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEE T ss_conf 9997999989899999999999999986136882699

HHsearch alignment for GI: 254780218 and conserved domain: pfam07693