BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780218|ref|YP_003064631.1| thymidylate kinase [Candidatus Liberibacter asiaticus str. psy62] (225 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780218|ref|YP_003064631.1| thymidylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 225 Score = 465 bits (1196), Expect = e-133, Method: Compositional matrix adjust. Identities = 225/225 (100%), Positives = 225/225 (100%) Query: 1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD Sbjct: 1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD 60 Query: 61 EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120 EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL Sbjct: 61 EFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSL 120 Query: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI Sbjct: 121 QEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDI 180 Query: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI 225 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI Sbjct: 181 ARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSKKDI 225 >gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Score = 24.6 bits (52), Expect = 1.3, Method: Compositional matrix adjust. Identities = 9/16 (56%), Positives = 11/16 (68%) Query: 4 GLFISFEGIEGAGKTT 19 GLF + GI G GK+T Sbjct: 650 GLFTAITGISGGGKST 665 >gi|254780227|ref|YP_003064640.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 426 Score = 24.3 bits (51), Expect = 1.9, Method: Compositional matrix adjust. Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREP 41 M SG+ I I G T L R+L+ KNY++ V P Sbjct: 135 MQSGVTI-LHTIGGDDTNTTACDLLRYLKEKNYNITVVGLP 174 >gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] Length = 789 Score = 24.3 bits (51), Expect = 2.1, Method: Composition-based stats. Identities = 9/20 (45%), Positives = 15/20 (75%) Query: 6 FISFEGIEGAGKTTHISLLK 25 FI G+ G+GK+T ++L+K Sbjct: 503 FIHIRGVGGSGKSTLMNLIK 522 >gi|254780785|ref|YP_003065198.1| 30S ribosomal protein S15 [Candidatus Liberibacter asiaticus str. psy62] Length = 89 Score = 23.9 bits (50), Expect = 2.3, Method: Compositional matrix adjust. Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 4/31 (12%) Query: 137 DLPVDIGLKRVQNRYSLRESACLDYFERKDV 167 D+ IGL R+ SLR S+ L Y ERKDV Sbjct: 49 DVNSKIGLGRL---ISLR-SSLLKYLERKDV 75 >gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Score = 23.9 bits (50), Expect = 2.7, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 7 ISFEGIEGAGKTTHISLLKRF 27 I+ G GAGKT+ SL+ RF Sbjct: 319 IALVGDSGAGKTSIFSLILRF 339 >gi|254781099|ref|YP_003065512.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 468 Score = 23.5 bits (49), Expect = 3.0, Method: Compositional matrix adjust. Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query: 6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPG 42 FI+ G G K++ ++L+ L++ YDV + G Sbjct: 115 FIAVTGTNG--KSSTVALISHVLRKNGYDVQLGGNIG 149 >gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 23.5 bits (49), Expect = 3.6, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 2 NSGLFISFEGIEGAGKTT 19 N GL + F G G GKT+ Sbjct: 364 NKGLILCFVGPPGVGKTS 381 >gi|254780826|ref|YP_003065239.1| phosphoenolpyruvate carboxykinase [Candidatus Liberibacter asiaticus str. psy62] Length = 509 Score = 23.5 bits (49), Expect = 3.6, Method: Compositional matrix adjust. Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 9 FEGIEGAGKTTHISLLKRFL 28 F G+ G GKTT + + RFL Sbjct: 223 FFGLSGTGKTTLSASVDRFL 242 >gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Score = 23.1 bits (48), Expect = 3.9, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 15/25 (60%) Query: 3 SGLFISFEGIEGAGKTTHISLLKRF 27 SG + G G+GK+T I+LL R Sbjct: 378 SGKMTALVGPSGSGKSTIINLLMRM 402 >gi|254780292|ref|YP_003064705.1| 50S ribosomal protein L13 [Candidatus Liberibacter asiaticus str. psy62] Length = 155 Score = 22.7 bits (47), Expect = 4.8, Method: Compositional matrix adjust. Identities = 7/16 (43%), Positives = 12/16 (75%) Query: 170 HEKRRQIFLDIARNQP 185 HE ++ +F+DIA+ P Sbjct: 134 HEAQKPVFMDIAKMNP 149 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.137 0.397 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 141,152 Number of Sequences: 1233 Number of extensions: 5557 Number of successful extensions: 29 Number of sequences better than 100.0: 14 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 18 Number of HSP's gapped (non-prelim): 14 length of query: 225 length of database: 328,796 effective HSP length: 71 effective length of query: 154 effective length of database: 241,253 effective search space: 37152962 effective search space used: 37152962 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 37 (18.9 bits)