RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780219|ref|YP_003064632.1| hypothetical protein CLIBASIA_00520 [Candidatus Liberibacter asiaticus str. psy62] (117 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 37.6 bits (87), Expect = 6e-04 Identities = 21/113 (18%), Positives = 38/113 (33%), Gaps = 34/113 (30%) Query: 14 ALLGSCDDNPKDPIVQFKQ-MK--YESQE------SKKSLSDALFKTYPDTMDKINTV-- 62 AL +V+ K+ +K ++ KKS S ALF+ + ++ + Sbjct: 103 ALAAKLLQENDTTLVKTKELIKNYITARIMAKRPFDKKSNS-ALFRAVGEGNAQLVAIFG 161 Query: 63 -Q-------TALRNLHNA--------ISKMESELKELLSDILLKRHPDEIDKI 99 Q LR+L+ I L EL+ + +K+ Sbjct: 162 GQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRT------TLDAEKV 208 Score = 26.4 bits (58), Expect = 1.6 Identities = 11/106 (10%), Positives = 25/106 (23%), Gaps = 26/106 (24%) Query: 20 DDNPKDPI---VQFKQ--MKYESQESKKSLSDAL------FK-TY--------------P 53 DD P P +F L F+ Y Sbjct: 51 DDEPTTPAELVGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQ 110 Query: 54 DTMDKINTVQTALRNLHNAISKMESELKELLSDILLKRHPDEIDKI 99 + + + ++N A + + + L + + ++ Sbjct: 111 ENDTTLVKTKELIKNYITARIMAKRPFDKKSNSALFRAVGEGNAQL 156 >1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 1g0u_F Length = 244 Score = 28.0 bits (62), Expect = 0.51 Identities = 14/126 (11%), Positives = 38/126 (30%), Gaps = 10/126 (7%) Query: 1 MHFKIKRFLFPLLALLGSCDDNPK----DPIVQFKQMKYESQESK----KSLSDALFKTY 52 + R G + +P + K + K+ + L + Sbjct: 120 TLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHH 179 Query: 53 PDTMDKINTVQTALRNLHNAISKMESELKELLSDILLKRHPDEIDKINPIKNSANEISKL 112 P+ + V+ A + ++ A + + EL + + K + E Sbjct: 180 PEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVK-GDLLQEAIDF 238 Query: 113 -KEDLS 117 +++++ Sbjct: 239 AQKEIN 244 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 27.7 bits (60), Expect = 0.72 Identities = 6/15 (40%), Positives = 11/15 (73%), Gaps = 1/15 (6%) Query: 72 AISKMESELKELLSD 86 A+ K+++ LK L +D Sbjct: 21 ALKKLQASLK-LYAD 34 >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structural genomics; 2.00A {Ralstonia solanacearum MOLK2} Length = 335 Score = 27.1 bits (58), Expect = 1.1 Identities = 7/17 (41%), Positives = 8/17 (47%) Query: 84 LSDILLKRHPDEIDKIN 100 L D R P EID + Sbjct: 277 LQDAEAGRGPLEIDALV 293 >2qih_A Protein USPA1; trimeric, parallel alpha-helical coiled-coil, cell adhesion; 1.90A {Moraxella catarrhalis} Length = 157 Score = 26.1 bits (57), Expect = 2.0 Identities = 10/61 (16%), Positives = 18/61 (29%), Gaps = 1/61 (1%) Query: 57 DKINTVQTALRNLHNAISKMESELKELLSDILLKRHPDEIDKINPIKNSANEISKLKEDL 116 D+I T + + +++ E I K D I N S + + Sbjct: 19 DRIATAELGIAENKKDAQIAKAQANENKDGI-AKNQADIQLHDKKITNLGILHSMVARAV 77 Query: 117 S 117 Sbjct: 78 G 78 >1deq_A Fibrinogen (alpha chain); coiled-coil, blood clotting; 3.50A {Bos taurus} SCOP: i.9.1.1 Length = 390 Score = 26.0 bits (56), Expect = 2.1 Identities = 15/81 (18%), Positives = 27/81 (33%), Gaps = 8/81 (9%) Query: 36 ESQESKKSLSDALFKTYPDTMDKINTVQTALRNLHNAISKMESELKELLSDILLKRHPDE 95 + + K +++ L K+ + L + ++K L DI Sbjct: 106 NNDNTFKQINEDLRSRIEILRRKVIEQVQRINLLQKNVRDQLVDMKRLEVDI-------- 157 Query: 96 IDKINPIKNSANEISKLKEDL 116 KI K S + + K DL Sbjct: 158 DIKIRSCKGSCSRALEHKVDL 178 >1u3d_A Cryptochrome 1 apoprotein; photolyase, AMPPNP, signaling protein; HET: FAD ANP NDS; 2.45A {Arabidopsis thaliana} SCOP: a.99.1.1 c.28.1.1 PDB: 1u3c_A* Length = 509 Score = 25.8 bits (55), Expect = 2.4 Identities = 12/53 (22%), Positives = 28/53 (52%) Query: 47 ALFKTYPDTMDKINTVQTALRNLHNAISKMESELKELLSDILLKRHPDEIDKI 99 ALF P+ + + + L N++++++S L+ L + ++ KR D + + Sbjct: 41 ALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSLRSLGTCLITKRSTDSVASL 93 >1t3j_A Mitofusin 1; coiled coil antiparallel, dimer, membrane protein; 2.50A {Mus musculus} SCOP: h.4.16.1 Length = 96 Score = 24.8 bits (54), Expect = 4.9 Identities = 11/51 (21%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Query: 30 FKQMKYESQESKKSLSDALFKTYPDTMDKINTVQTALRNLHNAISKMESEL 80 F ++ + ++K L + + +D++ +Q + L N ++ESEL Sbjct: 38 FARLCQQVDMTQKHLEEEI-ARLSKEIDQLEKMQNNSKLLRNKAVQLESEL 87 >3f3f_C Nucleoporin NUP85; structural protein, protein complex, nucleoporin complex, nuclear pore complex, macromolecular assembly; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_C 3f3p_C 3ewe_B Length = 570 Score = 24.9 bits (54), Expect = 5.0 Identities = 11/83 (13%), Positives = 22/83 (26%), Gaps = 3/83 (3%) Query: 12 LLALLGSCDDNPKDPIVQFKQMKYESQESKKSLSDALFKTYPDTMDKINTVQTALRNLHN 71 + LL + F++ K + ++ + + D I + Sbjct: 288 SIELLKQYPKDSSS---TFREWKNLVLKLSQAFGSSATDISGELRDYIEDFLLVIGGNQR 344 Query: 72 AISKMESELKELLSDILLKRHPD 94 I + E LL P Sbjct: 345 KILQYSRTWYESFCGFLLYYIPS 367 >1oao_C CODH, carbon monoxide dehydrogenase alpha subunit; electron transfer, oxidoreductase, acetyl-COA formation, WOOD/ljungdahl pathway; 1.90A {Moorella thermoacetica} SCOP: e.26.1.3 PDB: 2z8y_M 3i01_M 3i04_M 1mjg_M 1ru3_A 3git_A Length = 729 Score = 24.7 bits (54), Expect = 5.6 Identities = 10/30 (33%), Positives = 15/30 (50%), Gaps = 6/30 (20%) Query: 76 MESELKELLSDILLKR-----HPDE-IDKI 99 M LK+ L D ++R ++ IDKI Sbjct: 670 MPKSLKDFLHDEFVRRSVEEGLGEDFIDKI 699 >3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Length = 267 Score = 24.2 bits (52), Expect = 6.3 Identities = 8/28 (28%), Positives = 15/28 (53%) Query: 72 AISKMESELKELLSDILLKRHPDEIDKI 99 A ++ ++EL +L+ L DE+ I Sbjct: 219 ATTRGQTELMSILNKALYSISNDELASI 246 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.315 0.132 0.361 Gapped Lambda K H 0.267 0.0484 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 956,401 Number of extensions: 38579 Number of successful extensions: 139 Number of sequences better than 10.0: 1 Number of HSP's gapped: 139 Number of HSP's successfully gapped: 45 Length of query: 117 Length of database: 5,693,230 Length adjustment: 80 Effective length of query: 37 Effective length of database: 3,753,710 Effective search space: 138887270 Effective search space used: 138887270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.6 bits)