BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780219|ref|YP_003064632.1| hypothetical protein CLIBASIA_00520 [Candidatus Liberibacter asiaticus str. psy62] (117 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780219|ref|YP_003064632.1| hypothetical protein CLIBASIA_00520 [Candidatus Liberibacter asiaticus str. psy62] Length = 117 Score = 234 bits (598), Expect = 3e-64, Method: Compositional matrix adjust. Identities = 117/117 (100%), Positives = 117/117 (100%) Query: 1 MHFKIKRFLFPLLALLGSCDDNPKDPIVQFKQMKYESQESKKSLSDALFKTYPDTMDKIN 60 MHFKIKRFLFPLLALLGSCDDNPKDPIVQFKQMKYESQESKKSLSDALFKTYPDTMDKIN Sbjct: 1 MHFKIKRFLFPLLALLGSCDDNPKDPIVQFKQMKYESQESKKSLSDALFKTYPDTMDKIN 60 Query: 61 TVQTALRNLHNAISKMESELKELLSDILLKRHPDEIDKINPIKNSANEISKLKEDLS 117 TVQTALRNLHNAISKMESELKELLSDILLKRHPDEIDKINPIKNSANEISKLKEDLS Sbjct: 61 TVQTALRNLHNAISKMESELKELLSDILLKRHPDEIDKINPIKNSANEISKLKEDLS 117 >gi|254781055|ref|YP_003065468.1| glutathione reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 23.9 bits (50), Expect = 0.92, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 30/53 (56%), Gaps = 5/53 (9%) Query: 52 YPDTMDKINTVQTALRNLHNAISKMESELKELLSDILLKR-----HPDEIDKI 99 + ++ + + T + ++ +SK +S++++ L+D+++ R H D I+ + Sbjct: 183 FAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESV 235 >gi|254780858|ref|YP_003065271.1| NADH dehydrogenase I subunit F [Candidatus Liberibacter asiaticus str. psy62] Length = 425 Score = 22.3 bits (46), Expect = 2.8, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 14/18 (77%) Query: 42 KSLSDALFKTYPDTMDKI 59 KSLSD++ + + D +DKI Sbjct: 18 KSLSDSMSRGHWDNVDKI 35 >gi|254781141|ref|YP_003065554.1| hypothetical protein CLIBASIA_05225 [Candidatus Liberibacter asiaticus str. psy62] Length = 196 Score = 21.6 bits (44), Expect = 4.7, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Query: 45 SDALFKTYPDTMDKINTVQTALRNLHNAISKM----ESELKELLSDILLKR 91 S L KTYP+T +I ++ N+ N + ++ KEL S+IL K+ Sbjct: 28 SPTLEKTYPETYHRIRYLRQKALNIINHFVETGRNPDNIAKELDSEILEKK 78 >gi|254780317|ref|YP_003064730.1| phenylalanyl-tRNA synthetase, alpha subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 366 Score = 20.8 bits (42), Expect = 6.8, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 56 MDKINTVQTALRNLHNAISKMESELKELLS 85 MD +N ++ A +IS + +LK L S Sbjct: 28 MDSLNAIRVATLGRKGSISSLLKDLKNLDS 57 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.132 0.361 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,786 Number of Sequences: 1233 Number of extensions: 2356 Number of successful extensions: 21 Number of sequences better than 100.0: 17 Number of HSP's better than 100.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of query: 117 length of database: 328,796 effective HSP length: 63 effective length of query: 54 effective length of database: 251,117 effective search space: 13560318 effective search space used: 13560318 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 33 (17.3 bits)