RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780220|ref|YP_003064633.1| hypothetical protein CLIBASIA_00525 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 32.2 bits (73), Expect = 0.027 Identities = 11/53 (20%), Positives = 23/53 (43%), Gaps = 9/53 (16%) Query: 9 PLL-TLLSSCSDYVYEDAIRSQFENEIRYYKSM-------HPSTQDDIEYNLS 53 L+ L+ ++ + E R+ + E + + + +PS D +Y LS Sbjct: 182 VLVGDLIKFSAETLSELI-RTTLDAEKVFTQGLNILEWLENPSNTPDKDYLLS 233 Score = 24.5 bits (53), Expect = 5.7 Identities = 15/72 (20%), Positives = 32/72 (44%), Gaps = 15/72 (20%) Query: 1 MKKTQLLLPLLTLLSSCSDYVYEDAIRSQFENEIRYYKSMHPSTQDDIEYNLSEIKSFEN 60 + TQ P LTL+ + +ED ++S K + P+ ++L E + + Sbjct: 1726 LSATQFTQPALTLMEKAA---FED-LKS---------KGLIPADATFAGHSLGEYAALAS 1772 Query: 61 --QILAISNKLE 70 +++I + +E Sbjct: 1773 LADVMSIESLVE 1784 >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 Score = 26.4 bits (56), Expect = 1.6 Identities = 5/31 (16%), Positives = 11/31 (35%), Gaps = 2/31 (6%) Query: 65 ISNK--LEKGQKPKYLHLKEAIQKIVKTIEQ 93 +SN L G + Y ++ + + Sbjct: 249 LSNARLLASGYQLIYPDYVSGYGALLAAMRE 279 >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Length = 286 Score = 26.4 bits (56), Expect = 1.7 Identities = 8/41 (19%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Query: 55 IKSFENQILAISNKL---EKGQKPKYLHLKEAIQKIVKTIE 92 +SF ++ + N E G + KY + + ++ + E Sbjct: 245 ARSFYSENKRVRNDRIKEELGVRLKYPNYRVGLEALQADAE 285 >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Length = 330 Score = 24.5 bits (52), Expect = 6.0 Identities = 9/53 (16%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 47 DIEYNLSEIKSFENQILAISN-KLEK--GQKPKYLHLKEAIQKIVKTIEQNEK 96 +I ++ ++ + L S+ K ++ G P+Y+++K I+ ++ Sbjct: 274 EIPAEVAPRRAGDPARLVASSQKAKEKLGWDPRYVNVKTIIEHAWNWHQKQPN 326 >2zxr_A Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A Length = 666 Score = 24.3 bits (52), Expect = 7.2 Identities = 7/54 (12%), Positives = 15/54 (27%), Gaps = 9/54 (16%) Query: 49 EYNLSEIKSFENQILA---ISNKLEKGQKPKYLHLK---EAIQKIVKTIEQNEK 96 + + K + L LK EA + + + Q ++ Sbjct: 24 ALEVGPEAA---LAYWHRGFRRKEDLDPPLALLPLKGLREAAALLEEALRQGKR 74 >2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Length = 300 Score = 24.0 bits (51), Expect = 9.2 Identities = 10/44 (22%), Positives = 16/44 (36%) Query: 46 DDIEYNLSEIKSFENQILAISNKLEKGQKPKYLHLKEAIQKIVK 89 D L+ + + + L + G PK EA+Q V Sbjct: 224 DKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVT 267 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.312 0.129 0.343 Gapped Lambda K H 0.267 0.0619 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 776,160 Number of extensions: 30975 Number of successful extensions: 128 Number of sequences better than 10.0: 1 Number of HSP's gapped: 128 Number of HSP's successfully gapped: 36 Length of query: 97 Length of database: 5,693,230 Length adjustment: 63 Effective length of query: 34 Effective length of database: 4,165,858 Effective search space: 141639172 Effective search space used: 141639172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.3 bits)