RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780220|ref|YP_003064633.1| hypothetical protein CLIBASIA_00525 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) >d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 152 Score = 23.0 bits (49), Expect = 8.1 Identities = 4/27 (14%), Positives = 8/27 (29%) Query: 20 YVYEDAIRSQFENEIRYYKSMHPSTQD 46 Y + + S+ P T+ Sbjct: 18 YNDGRTTFHDSLALLDNFHSLRPRTRV 44 >d1jnra3 d.168.1.1 (A:257-401) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 145 Score = 22.4 bits (48), Expect = 9.6 Identities = 7/26 (26%), Positives = 15/26 (57%) Query: 72 GQKPKYLHLKEAIQKIVKTIEQNEKE 97 G +P Y+H +EA+ ++ ++ K Sbjct: 72 GNQPIYMHTEEALAELAGGDKKKLKH 97 >d2vgla_ a.118.1.10 (A:) Adaptin alpha C subunit N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Length = 584 Score = 22.4 bits (47), Expect = 9.9 Identities = 9/57 (15%), Positives = 17/57 (29%), Gaps = 1/57 (1%) Query: 10 LLTLLSSCSDYVYEDAIRSQFENEIRYYKSMHPSTQDDIEYNLSEIKSFENQILAIS 66 +L L+ DYV E+ + + + + L EN + Sbjct: 438 ILNLIRIAGDYVSEEVW-YRVIQIVINRDDVQGYAAKTVFEALQAPACHENLVKVGG 493 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.312 0.129 0.343 Gapped Lambda K H 0.267 0.0488 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 338,135 Number of extensions: 13959 Number of successful extensions: 49 Number of sequences better than 10.0: 1 Number of HSP's gapped: 49 Number of HSP's successfully gapped: 20 Length of query: 97 Length of database: 2,407,596 Length adjustment: 59 Effective length of query: 38 Effective length of database: 1,597,526 Effective search space: 60705988 Effective search space used: 60705988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 47 (22.5 bits)