BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780220|ref|YP_003064633.1| hypothetical protein CLIBASIA_00525 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780220|ref|YP_003064633.1| hypothetical protein CLIBASIA_00525 [Candidatus Liberibacter asiaticus str. psy62] Length = 97 Score = 195 bits (495), Expect = 1e-52, Method: Compositional matrix adjust. Identities = 97/97 (100%), Positives = 97/97 (100%) Query: 1 MKKTQLLLPLLTLLSSCSDYVYEDAIRSQFENEIRYYKSMHPSTQDDIEYNLSEIKSFEN 60 MKKTQLLLPLLTLLSSCSDYVYEDAIRSQFENEIRYYKSMHPSTQDDIEYNLSEIKSFEN Sbjct: 1 MKKTQLLLPLLTLLSSCSDYVYEDAIRSQFENEIRYYKSMHPSTQDDIEYNLSEIKSFEN 60 Query: 61 QILAISNKLEKGQKPKYLHLKEAIQKIVKTIEQNEKE 97 QILAISNKLEKGQKPKYLHLKEAIQKIVKTIEQNEKE Sbjct: 61 QILAISNKLEKGQKPKYLHLKEAIQKIVKTIEQNEKE 97 >gi|254780195|ref|YP_003064608.1| CTP synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 544 Score = 26.2 bits (56), Expect = 0.12, Method: Composition-based stats. Identities = 9/39 (23%), Positives = 26/39 (66%) Query: 56 KSFENQILAISNKLEKGQKPKYLHLKEAIQKIVKTIEQN 94 ++F ++ L++ N+++ KY+HLK+A + +++ + + Sbjct: 279 QTFCDRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHS 317 >gi|254780219|ref|YP_003064632.1| hypothetical protein CLIBASIA_00520 [Candidatus Liberibacter asiaticus str. psy62] Length = 117 Score = 24.6 bits (52), Expect = 0.38, Method: Compositional matrix adjust. Identities = 9/15 (60%), Positives = 10/15 (66%) Query: 5 QLLLPLLTLLSSCSD 19 + L PLL LL SC D Sbjct: 7 RFLFPLLALLGSCDD 21 >gi|254781086|ref|YP_003065499.1| F0F1 ATP synthase subunit B' [Candidatus Liberibacter asiaticus str. psy62] Length = 176 Score = 21.9 bits (45), Expect = 2.0, Method: Compositional matrix adjust. Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 79 HLKEAIQKIVKTIEQN 94 H KE I K+V EQN Sbjct: 89 HAKEIIDKVVAAAEQN 104 >gi|254780221|ref|YP_003064634.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter asiaticus str. psy62] Length = 97 Score = 21.9 bits (45), Expect = 2.4, Method: Compositional matrix adjust. Identities = 11/19 (57%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Query: 2 KKTQLLLPLL-TLLSSCSD 19 K QL+L +L TLL SC+D Sbjct: 4 KTKQLILAVLVTLLGSCAD 22 >gi|254781206|ref|YP_003065619.1| hypothetical protein CLIBASIA_05565 [Candidatus Liberibacter asiaticus str. psy62] Length = 1246 Score = 21.2 bits (43), Expect = 4.0, Method: Compositional matrix adjust. Identities = 9/15 (60%), Positives = 12/15 (80%) Query: 26 IRSQFENEIRYYKSM 40 IRS+FE EI+ KS+ Sbjct: 918 IRSEFEREIKELKSV 932 >gi|254780810|ref|YP_003065223.1| transcription termination factor Rho [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Score = 20.4 bits (41), Expect = 6.3, Method: Compositional matrix adjust. Identities = 14/63 (22%), Positives = 30/63 (47%), Gaps = 5/63 (7%) Query: 40 MHPSTQDDIEYNLSEIKSFENQILAISNKLEKGQK-----PKYLHLKEAIQKIVKTIEQN 94 ++P + ++E N E K ++++ + + KGQ+ P +Q I +I++N Sbjct: 142 LYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKN 201 Query: 95 EKE 97 E Sbjct: 202 HPE 204 >gi|254780625|ref|YP_003065038.1| formamidopyrimidine-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] Length = 289 Score = 20.4 bits (41), Expect = 6.9, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 11/23 (47%) Query: 15 SSCSDYVYEDAIRSQFENEIRYY 37 SS DYV+ D F+N Y Sbjct: 234 SSLRDYVHIDGSIGYFQNAFSVY 256 >gi|254781176|ref|YP_003065589.1| cell division protein FtsZ [Candidatus Liberibacter asiaticus str. psy62] Length = 502 Score = 20.0 bits (40), Expect = 9.7, Method: Composition-based stats. Identities = 6/25 (24%), Positives = 15/25 (60%) Query: 23 EDAIRSQFENEIRYYKSMHPSTQDD 47 ED++ + E+ + Y + +PS ++ Sbjct: 447 EDSVHMKSESTVSYLRERNPSISEE 471 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.312 0.129 0.343 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,038 Number of Sequences: 1233 Number of extensions: 2109 Number of successful extensions: 17 Number of sequences better than 100.0: 17 Number of HSP's better than 100.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of query: 97 length of database: 328,796 effective HSP length: 61 effective length of query: 36 effective length of database: 253,583 effective search space: 9128988 effective search space used: 9128988 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (20.9 bits) S2: 31 (16.5 bits)