BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780221|ref|YP_003064634.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done >gi|254780221|ref|YP_003064634.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter asiaticus str. psy62] gi|254039898|gb|ACT56694.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter asiaticus str. psy62] Length = 97 Score = 179 bits (455), Expect = 8e-44, Method: Composition-based stats. Identities = 97/97 (100%), Positives = 97/97 (100%) Query: 1 MRFKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRM 60 MRFKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRM Sbjct: 1 MRFKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRM 60 Query: 61 DKLHFESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 DKLHFESDALDPILRRMDGPVKHVERRINSKTTTLEQ Sbjct: 61 DKLHFESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 >gi|290960318|ref|YP_003491500.1| integral membrane protein [Streptomyces scabiei 87.22] gi|260649844|emb|CBG72960.1| putative integral membrane protein [Streptomyces scabiei 87.22] Length = 490 Score = 37.7 bits (86), Expect = 0.48, Method: Composition-based stats. Identities = 22/51 (43%), Positives = 29/51 (56%) Query: 1 MRFKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELYP 51 MR KQL LA + GS +++RI +LNTLL EYK + R + YP Sbjct: 146 MREAAKQLALAATASESGSDSEERIAKLNTLLPEYKGLVERARANNRLGYP 196 >gi|161727419|dbj|BAF94334.1| centriole protein [Chlamydomonas reinhardtii] Length = 728 Score = 37.7 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 25/38 (65%) Query: 23 DRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRM 60 D+I LNT L E EN K+RE++ EL +S L+H++ Sbjct: 259 DQIAALNTRLGELDTENRKLREVKYELDTKVSELSHKL 296 >gi|221115273|ref|XP_002157814.1| PREDICTED: similar to predicted protein [Hydra magnipapillata] Length = 802 Score = 37.3 bits (85), Expect = 0.68, Method: Composition-based stats. Identities = 23/68 (33%), Positives = 37/68 (54%) Query: 3 FKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDK 62 FKT + +L + V +LG A + T L YK ++KI+++ +E + T+A R DK Sbjct: 378 FKTTRGLLPLRVCILGPPAVGKTTVAKQLCEHYKIHHIKIQDVIEEAIKNLKTIAARADK 437 Query: 63 LHFESDAL 70 E+D L Sbjct: 438 NEDETDDL 445 >gi|159477979|ref|XP_001697086.1| hypothetical protein CHLREDRAFT_176336 [Chlamydomonas reinhardtii] gi|158274998|gb|EDP00778.1| predicted protein [Chlamydomonas reinhardtii] Length = 614 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 25/38 (65%) Query: 23 DRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRM 60 D+I LNT L E EN K+RE++ EL +S L+H++ Sbjct: 259 DQIAALNTRLGELDTENRKLREVKYELDTKVSELSHKL 296 >gi|194398259|ref|YP_002038812.1| CHAP domain-containing protein [Streptococcus pneumoniae G54] gi|194357926|gb|ACF56374.1| CHAP domain protein [Streptococcus pneumoniae G54] Length = 392 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 21/92 (22%), Positives = 47/92 (51%), Gaps = 8/92 (8%) Query: 10 LAVLVTLLGSCADDRI----TELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHF 65 +AVL T DD+I +++ L A+ +E ++ ++Q++ +S + L Sbjct: 19 VAVLTTAHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQIQEQ----VSAIQAEQSNLQA 74 Query: 66 ESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 E+D L ++++G + + + I S+ +LE+ Sbjct: 75 ENDRLQAESKKLEGEITELSKNIVSRNQSLEK 106 >gi|168491748|ref|ZP_02715891.1| general stress protein GSP-781 [Streptococcus pneumoniae CDC0288-04] gi|183573992|gb|EDT94520.1| general stress protein GSP-781 [Streptococcus pneumoniae CDC0288-04] Length = 392 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 21/92 (22%), Positives = 47/92 (51%), Gaps = 8/92 (8%) Query: 10 LAVLVTLLGSCADDRI----TELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHF 65 +AVL T DD+I +++ L A+ +E ++ ++Q++ +S + L Sbjct: 19 VAVLTTAHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQIQEQ----VSAIQAEQSNLQA 74 Query: 66 ESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 E+D L ++++G + + + I S+ +LE+ Sbjct: 75 ENDRLQAESKKLEGEITELSKNIVSRNQSLEK 106 >gi|168487194|ref|ZP_02711702.1| general stress protein GSP-781 [Streptococcus pneumoniae CDC1087-00] gi|183569899|gb|EDT90427.1| general stress protein GSP-781 [Streptococcus pneumoniae CDC1087-00] Length = 392 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 21/92 (22%), Positives = 47/92 (51%), Gaps = 8/92 (8%) Query: 10 LAVLVTLLGSCADDRI----TELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHF 65 +AVL T DD+I +++ L A+ +E ++ ++Q++ +S + L Sbjct: 19 VAVLTTAHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQIQEQ----VSAIQAEQSNLQA 74 Query: 66 ESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 E+D L ++++G + + + I S+ +LE+ Sbjct: 75 ENDRLQAESKKLEGEITELSKNIVSRNQSLEK 106 >gi|148984519|ref|ZP_01817807.1| secreted 45 kDa protein precursor [Streptococcus pneumoniae SP3-BS71] gi|147923296|gb|EDK74410.1| secreted 45 kDa protein precursor [Streptococcus pneumoniae SP3-BS71] gi|301800948|emb|CBW33610.1| putative amidase [Streptococcus pneumoniae OXC141] Length = 392 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 21/92 (22%), Positives = 47/92 (51%), Gaps = 8/92 (8%) Query: 10 LAVLVTLLGSCADDRI----TELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHF 65 +AVL T DD+I +++ L A+ +E ++ ++Q++ +S + L Sbjct: 19 VAVLTTAHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQIQEQ----VSAIQAEQSNLQA 74 Query: 66 ESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 E+D L ++++G + + + I S+ +LE+ Sbjct: 75 ENDRLQAESKKLEGEITELSKNIVSRNQSLEK 106 >gi|148997982|ref|ZP_01825495.1| recombination protein F [Streptococcus pneumoniae SP11-BS70] gi|307068826|ref|YP_003877792.1| hypothetical protein SPAP_2259 [Streptococcus pneumoniae AP200] gi|147755992|gb|EDK63035.1| recombination protein F [Streptococcus pneumoniae SP11-BS70] gi|306410363|gb|ADM85790.1| Uncharacterized protein conserved in bacteria [Streptococcus pneumoniae AP200] Length = 392 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 21/92 (22%), Positives = 47/92 (51%), Gaps = 8/92 (8%) Query: 10 LAVLVTLLGSCADDRI----TELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHF 65 +AVL T DD+I +++ L A+ +E ++ ++Q++ +S + L Sbjct: 19 VAVLTTAHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQIQEQ----VSAIQAEQSNLQA 74 Query: 66 ESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 E+D L ++++G + + + I S+ +LE+ Sbjct: 75 ENDRLQAESKKLEGEITELSKNIVSRNQSLEK 106 >gi|111658652|ref|ZP_01409302.1| hypothetical protein SpneT_02000242 [Streptococcus pneumoniae TIGR4] gi|332071485|gb|EGI81979.1| CHAP domain protein [Streptococcus pneumoniae GA41301] Length = 378 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 21/92 (22%), Positives = 47/92 (51%), Gaps = 8/92 (8%) Query: 10 LAVLVTLLGSCADDRI----TELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHF 65 +AVL T DD+I +++ L A+ +E ++ ++Q++ +S + L Sbjct: 5 VAVLTTAHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQIQEQ----VSAIQAEQSNLQA 60 Query: 66 ESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 E+D L ++++G + + + I S+ +LE+ Sbjct: 61 ENDRLQAESKKLEGEITELSKNIVSRNQSLEK 92 >gi|15902020|ref|NP_346624.1| secreted 45 kd protein [Streptococcus pneumoniae TIGR4] gi|15904062|ref|NP_359612.1| general stress protein GSP-781 [Streptococcus pneumoniae R6] gi|116516590|ref|YP_817426.1| secreted 45 kDa protein precursor [Streptococcus pneumoniae D39] gi|148993632|ref|ZP_01823103.1| recombination protein F [Streptococcus pneumoniae SP9-BS68] gi|149003082|ref|ZP_01827991.1| secreted 45 kDa protein precursor [Streptococcus pneumoniae SP14-BS69] gi|149007743|ref|ZP_01831352.1| recombination protein F [Streptococcus pneumoniae SP18-BS74] gi|149012809|ref|ZP_01833754.1| recombination protein F [Streptococcus pneumoniae SP19-BS75] gi|149020135|ref|ZP_01835109.1| secreted 45 kDa protein precursor [Streptococcus pneumoniae SP23-BS72] gi|168484330|ref|ZP_02709282.1| general stress protein GSP-781 [Streptococcus pneumoniae CDC1873-00] gi|168489290|ref|ZP_02713489.1| general stress protein GSP-781 [Streptococcus pneumoniae SP195] gi|168494023|ref|ZP_02718166.1| general stress protein GSP-781 [Streptococcus pneumoniae CDC3059-06] gi|168576088|ref|ZP_02721993.1| general stress protein GSP-781 [Streptococcus pneumoniae MLV-016] gi|169834284|ref|YP_001695569.1| general stress protein GSP-781 [Streptococcus pneumoniae Hungary19A-6] gi|182685152|ref|YP_001836899.1| secreted 45 kd protein [Streptococcus pneumoniae CGSP14] gi|221232914|ref|YP_002512068.1| putative amidase [Streptococcus pneumoniae ATCC 700669] gi|225855709|ref|YP_002737221.1| general stress protein GSP-781 [Streptococcus pneumoniae JJA] gi|225857784|ref|YP_002739295.1| general stress protein GSP-781 [Streptococcus pneumoniae P1031] gi|225859987|ref|YP_002741497.1| general stress protein GSP-781 [Streptococcus pneumoniae 70585] gi|225862032|ref|YP_002743541.1| general stress protein GSP-781 [Streptococcus pneumoniae Taiwan19F-14] gi|237651029|ref|ZP_04525281.1| general stress protein GSP-781 [Streptococcus pneumoniae CCRI 1974] gi|237821142|ref|ZP_04596987.1| general stress protein GSP-781 [Streptococcus pneumoniae CCRI 1974M2] gi|298229440|ref|ZP_06963121.1| general stress protein GSP-781 [Streptococcus pneumoniae str. Canada MDR_19F] gi|298255964|ref|ZP_06979550.1| general stress protein GSP-781 [Streptococcus pneumoniae str. Canada MDR_19A] gi|298501732|ref|YP_003723672.1| secreted protein precursor [Streptococcus pneumoniae TCH8431/19A] gi|303254877|ref|ZP_07340962.1| putative amidase [Streptococcus pneumoniae BS455] gi|303259704|ref|ZP_07345680.1| secreted 45 kd protein [Streptococcus pneumoniae SP-BS293] gi|303262171|ref|ZP_07348116.1| secreted 45 kd protein [Streptococcus pneumoniae SP14-BS292] gi|303264606|ref|ZP_07350525.1| secreted 45 kd protein [Streptococcus pneumoniae BS397] gi|303266085|ref|ZP_07351979.1| secreted 45 kd protein [Streptococcus pneumoniae BS457] gi|303268493|ref|ZP_07354287.1| secreted 45 kd protein [Streptococcus pneumoniae BS458] gi|307128479|ref|YP_003880510.1| CHAP domain-containing protein [Streptococcus pneumoniae 670-6B] gi|14973726|gb|AAK76264.1| secreted 45 kd protein [Streptococcus pneumoniae TIGR4] gi|15459727|gb|AAL00823.1| General stress protein GSP-781 [Streptococcus pneumoniae R6] gi|116077166|gb|ABJ54886.1| secreted 45 kDa protein precursor [Streptococcus pneumoniae D39] gi|147758823|gb|EDK65819.1| secreted 45 kDa protein precursor [Streptococcus pneumoniae SP14-BS69] gi|147760738|gb|EDK67710.1| recombination protein F [Streptococcus pneumoniae SP18-BS74] gi|147763240|gb|EDK70179.1| recombination protein F [Streptococcus pneumoniae SP19-BS75] gi|147927853|gb|EDK78875.1| recombination protein F [Streptococcus pneumoniae SP9-BS68] gi|147930813|gb|EDK81794.1| secreted 45 kDa protein precursor [Streptococcus pneumoniae SP23-BS72] gi|168996786|gb|ACA37398.1| general stress protein GSP-781 [Streptococcus pneumoniae Hungary19A-6] gi|172042395|gb|EDT50441.1| general stress protein GSP-781 [Streptococcus pneumoniae CDC1873-00] gi|182630486|gb|ACB91434.1| secreted 45 kd protein [Streptococcus pneumoniae CGSP14] gi|183572335|gb|EDT92863.1| general stress protein GSP-781 [Streptococcus pneumoniae SP195] gi|183575970|gb|EDT96498.1| general stress protein GSP-781 [Streptococcus pneumoniae CDC3059-06] gi|183578052|gb|EDT98580.1| general stress protein GSP-781 [Streptococcus pneumoniae MLV-016] gi|220675376|emb|CAR69978.1| putative amidase [Streptococcus pneumoniae ATCC 700669] gi|225720283|gb|ACO16137.1| general stress protein GSP-781 [Streptococcus pneumoniae 70585] gi|225724039|gb|ACO19892.1| general stress protein GSP-781 [Streptococcus pneumoniae JJA] gi|225726162|gb|ACO22014.1| general stress protein GSP-781 [Streptococcus pneumoniae P1031] gi|225727418|gb|ACO23269.1| general stress protein GSP-781 [Streptococcus pneumoniae Taiwan19F-14] gi|298237327|gb|ADI68458.1| secreted protein precursor [Streptococcus pneumoniae TCH8431/19A] gi|301795125|emb|CBW37598.1| putative amidase [Streptococcus pneumoniae INV104] gi|301802877|emb|CBW35658.1| putative amidase [Streptococcus pneumoniae INV200] gi|302598148|gb|EFL65209.1| putative amidase [Streptococcus pneumoniae BS455] gi|302636811|gb|EFL67301.1| secreted 45 kd protein [Streptococcus pneumoniae SP14-BS292] gi|302639256|gb|EFL69715.1| secreted 45 kd protein [Streptococcus pneumoniae SP-BS293] gi|302641994|gb|EFL72347.1| secreted 45 kd protein [Streptococcus pneumoniae BS458] gi|302644389|gb|EFL74642.1| secreted 45 kd protein [Streptococcus pneumoniae BS457] gi|302645976|gb|EFL76204.1| secreted 45 kd protein [Streptococcus pneumoniae BS397] gi|306485541|gb|ADM92410.1| CHAP domain protein [Streptococcus pneumoniae 670-6B] gi|327388960|gb|EGE87308.1| CHAP domain protein [Streptococcus pneumoniae GA04375] gi|332071294|gb|EGI81789.1| CHAP domain protein [Streptococcus pneumoniae GA17545] gi|332071658|gb|EGI82151.1| CHAP domain protein [Streptococcus pneumoniae GA17570] Length = 392 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 21/92 (22%), Positives = 47/92 (51%), Gaps = 8/92 (8%) Query: 10 LAVLVTLLGSCADDRI----TELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHF 65 +AVL T DD+I +++ L A+ +E ++ ++Q++ +S + L Sbjct: 19 VAVLTTAHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQIQEQ----VSAIQAEQSNLQA 74 Query: 66 ESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 E+D L ++++G + + + I S+ +LE+ Sbjct: 75 ENDRLQAESKKLEGEITELSKNIVSRNQSLEK 106 >gi|148988860|ref|ZP_01820275.1| secreted 45 kDa protein precursor [Streptococcus pneumoniae SP6-BS73] gi|147925671|gb|EDK76747.1| secreted 45 kDa protein precursor [Streptococcus pneumoniae SP6-BS73] Length = 332 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 21/92 (22%), Positives = 47/92 (51%), Gaps = 8/92 (8%) Query: 10 LAVLVTLLGSCADDRI----TELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHF 65 +AVL T DD+I +++ L A+ +E ++ ++Q++ +S + L Sbjct: 19 VAVLTTAHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQIQEQ----VSAIQAEQSNLQA 74 Query: 66 ESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 E+D L ++++G + + + I S+ +LE+ Sbjct: 75 ENDRLQAESKKLEGEITELSKNIVSRNQSLEK 106 >gi|225570775|ref|ZP_03779798.1| hypothetical protein CLOHYLEM_06878 [Clostridium hylemonae DSM 15053] gi|225160237|gb|EEG72856.1| hypothetical protein CLOHYLEM_06878 [Clostridium hylemonae DSM 15053] Length = 362 Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Query: 18 GSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHFESDALD 71 G DD E T + ++ E NL + E ++LY +TL +R+DKL +S LD Sbjct: 282 GKSPDDFDEETLTTINKFFENNLNVSETSRQLYIHRNTLVYRLDKLQ-KSTGLD 334 >gi|167761638|ref|ZP_02433765.1| hypothetical protein CLOSCI_04050 [Clostridium scindens ATCC 35704] gi|167660781|gb|EDS04911.1| hypothetical protein CLOSCI_04050 [Clostridium scindens ATCC 35704] Length = 362 Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Query: 18 GSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHFESDALD 71 G DD E T + ++ E NL + E ++LY +TL +R+DKL +S LD Sbjct: 282 GKSPDDFDEETLTTINKFFENNLNVSETSRQLYIHRNTLVYRLDKLQ-KSTGLD 334 >gi|153855919|ref|ZP_01996881.1| hypothetical protein DORLON_02906 [Dorea longicatena DSM 13814] gi|149751822|gb|EDM61753.1| hypothetical protein DORLON_02906 [Dorea longicatena DSM 13814] Length = 362 Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Query: 18 GSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHFESDALD 71 G DD E T + ++ E NL + E ++LY +TL +R+DKL +S LD Sbjct: 282 GKSPDDFDEETLTTINKFFENNLNVSETSRQLYIHRNTLVYRLDKLQ-KSTGLD 334 >gi|37651524|ref|NP_932398.1| gp46 [Aeromonas phage 44RR2.8t] gi|66391846|ref|YP_238771.1| gp46 [Aeromonas phage 31] gi|34732824|gb|AAQ81362.1| recombination endonuclease subunit [Aeromonas phage 44RR2.8t] gi|62114683|gb|AAX63531.1| gp46 [Aeromonas phage 31] Length = 570 Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 20/29 (68%) Query: 21 ADDRITELNTLLAEYKEENLKIRELQKEL 49 ADDRI ELN + EY E ++ R++Q +L Sbjct: 323 ADDRIEELNQQMVEYNEATVRFRDVQTQL 351 >gi|322377928|ref|ZP_08052416.1| secreted 45 kd protein [Streptococcus sp. M334] gi|321281104|gb|EFX58116.1| secreted 45 kd protein [Streptococcus sp. M334] Length = 394 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 20/92 (21%), Positives = 48/92 (52%), Gaps = 8/92 (8%) Query: 10 LAVLVTLLGSCADDRI----TELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHF 65 +AVL T DD+I +++ L A+ +E ++ ++Q++ +S++ L Sbjct: 19 VAVLTTAHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQIQEQ----VSSIQTEQSNLQS 74 Query: 66 ESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 E+D L ++++G + + + I S+ +L++ Sbjct: 75 ENDRLQAESKKLEGEITELSKNIVSRNDSLQK 106 >gi|145296307|ref|YP_001139128.1| hypothetical protein cgR_2222 [Corynebacterium glutamicum R] gi|140846227|dbj|BAF55226.1| hypothetical protein [Corynebacterium glutamicum R] Length = 348 Score = 35.0 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 31/61 (50%) Query: 9 ILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHFESD 68 I+A L L SCAD +L T+ AE K +K+ Q E +P+ L H ++ E+D Sbjct: 11 IIATLSLTLASCADLGGLDLETVGAEDKTTYIKLALNQSESHPSFIALEHLSERFEEETD 70 Query: 69 A 69 Sbjct: 71 G 71 >gi|326670097|ref|XP_003199138.1| PREDICTED: TRAF3-interacting JNK-activating modulator-like [Danio rerio] Length = 549 Score = 34.6 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 3/68 (4%) Query: 27 ELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHFESDALDPILRRMDGPVKHV-- 84 EL++ ++E +EENL +RE +EL + + H E LD +LR + P +H+ Sbjct: 373 ELHSCISELQEENLTLREYLQELTGNNHEGWNSSTETHEEVSVLDQLLRTDNSPARHLRD 432 Query: 85 -ERRINSK 91 E R+ +K Sbjct: 433 AEHRLRAK 440 >gi|307711197|ref|ZP_07647619.1| pcsB protein [Streptococcus mitis SK321] gi|307617159|gb|EFN96337.1| pcsB protein [Streptococcus mitis SK321] Length = 394 Score = 34.6 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 20/92 (21%), Positives = 47/92 (51%), Gaps = 8/92 (8%) Query: 10 LAVLVTLLGSCADDRI----TELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHF 65 +AVL T DD+I +++ L A+ +E ++ ++Q++ +S + L Sbjct: 19 VAVLTTAHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQIQEQ----VSAIQTEQSNLQS 74 Query: 66 ESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 E+D L ++++G + + + I S+ +L++ Sbjct: 75 ENDRLQAESKKLEGEITELSKNIVSRNDSLQK 106 >gi|307707876|ref|ZP_07644353.1| CHAP domain protein [Streptococcus mitis NCTC 12261] gi|307616136|gb|EFN95332.1| CHAP domain protein [Streptococcus mitis NCTC 12261] Length = 415 Score = 34.3 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 20/92 (21%), Positives = 47/92 (51%), Gaps = 8/92 (8%) Query: 10 LAVLVTLLGSCADDRI----TELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHF 65 +AVL T DD+I +++ L A+ +E ++ ++Q++ +S + L Sbjct: 19 VAVLTTAHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQVQEQ----VSAIQTEQSNLQS 74 Query: 66 ESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 E+D L ++++G + + + I S+ +L++ Sbjct: 75 ENDRLQAESKKLEGEITELSKNIVSRNDSLQK 106 >gi|289168890|ref|YP_003447159.1| general stress protein GSP-781 amidase [Streptococcus mitis B6] gi|288908457|emb|CBJ23299.1| general stress protein GSP-781 amidase [Streptococcus mitis B6] Length = 415 Score = 34.3 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 20/92 (21%), Positives = 47/92 (51%), Gaps = 8/92 (8%) Query: 10 LAVLVTLLGSCADDRI----TELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHF 65 +AVL T DD+I +++ L A+ +E ++ ++Q++ +S + L Sbjct: 19 VAVLTTAHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQVQEQ----VSAIQTEQSNLQS 74 Query: 66 ESDALDPILRRMDGPVKHVERRINSKTTTLEQ 97 E+D L ++++G + + + I S+ +L++ Sbjct: 75 ENDRLQAESKKLEGEITELSKNIVSRNDSLQK 106 >gi|322703806|gb|EFY95409.1| hypothetical protein MAA_09110 [Metarhizium anisopliae ARSEF 23] Length = 571 Score = 33.9 bits (76), Expect = 6.8, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Query: 33 AEYKEENLKIRELQKELYPAISTLAHRMDKLHFESDALDPILRRMDG--PVKHVERRI 88 A+ K++N +++E+ K++Y A+ + + K F+S D R DG ++H+E R+ Sbjct: 364 AQEKKKNERVKEVVKQVYDAVGSFVNSERKEEFKSKLEDLCNRTCDGWMQIQHLEERV 421 >gi|313904917|ref|ZP_07838288.1| transcriptional regulator, CdaR [Eubacterium cellulosolvens 6] gi|313470174|gb|EFR65505.1| transcriptional regulator, CdaR [Eubacterium cellulosolvens 6] Length = 363 Score = 33.9 bits (76), Expect = 7.1, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Query: 22 DDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHFESDALD 71 DD E T + ++ E NL + E ++LY +TL +R+DKL +S LD Sbjct: 287 DDFDEETLTTINKFFENNLNVSETSRQLYIHRNTLVYRLDKLQ-KSTGLD 335 >gi|218134919|ref|ZP_03463723.1| hypothetical protein BACPEC_02824 [Bacteroides pectinophilus ATCC 43243] gi|217990304|gb|EEC56315.1| hypothetical protein BACPEC_02824 [Bacteroides pectinophilus ATCC 43243] Length = 363 Score = 33.9 bits (76), Expect = 7.2, Method: Composition-based stats. Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 18 GSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHFESDALDPILRRM 77 G DD E + + ++ E +L + E ++LY +TL +R+DKL +S LD LR+ Sbjct: 282 GKSPDDFDEETLSTINKFFENSLNVSETSRQLYIHRNTLVYRLDKLQ-KSTGLD--LRKF 338 Query: 78 DGPV 81 D + Sbjct: 339 DDAI 342 >gi|47211645|emb|CAF92169.1| unnamed protein product [Tetraodon nigroviridis] Length = 2310 Score = 33.5 bits (75), Expect = 9.3, Method: Composition-based stats. Identities = 20/76 (26%), Positives = 39/76 (51%) Query: 22 DDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHFESDALDPILRRMDGPV 81 +DRI E+++LLAE +E+ + +L+ + + L R+ K L+ R++DG Sbjct: 1252 EDRINEMSSLLAEEEEKAKNLGKLKNKQEMMMVDLEERLKKEEKTRQELEKAKRKLDGET 1311 Query: 82 KHVERRINSKTTTLEQ 97 + +I T +E+ Sbjct: 1312 SDFQDQIAEFQTQMEE 1327 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.320 0.135 0.367 Lambda K H 0.267 0.0413 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 764,558,299 Number of Sequences: 13984884 Number of extensions: 25016797 Number of successful extensions: 105202 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 18 Number of HSP's that attempted gapping in prelim test: 105138 Number of HSP's gapped (non-prelim): 81 length of query: 97 length of database: 4,792,584,752 effective HSP length: 66 effective length of query: 31 effective length of database: 3,869,582,408 effective search space: 119957054648 effective search space used: 119957054648 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 75 (33.5 bits)