RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780221|ref|YP_003064634.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) >3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin- like fold; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} (A:) Length = 156 Score = 25.8 bits (56), Expect = 2.2 Identities = 7/25 (28%), Positives = 10/25 (40%) Query: 21 ADDRITELNTLLAEYKEENLKIREL 45 A I E+ A + E + EL Sbjct: 113 ASGLIREIRAFYASPQAEGIARLEL 137 >3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} (A:483-570) Length = 88 Score = 23.9 bits (52), Expect = 8.6 Identities = 10/48 (20%), Positives = 20/48 (41%) Query: 3 FKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELY 50 ++K L+VL++ LGS L ++ I + ++Y Sbjct: 28 IESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIY 75 >1zbs_A Hypothetical protein PG1100; alpha-beta protein., structural genomics, PSI, protein structure initiative; 2.30A {Porphyromonas gingivalis W83} (A:1-107,A:270-291) Length = 129 Score = 23.6 bits (51), Expect = 8.6 Identities = 7/24 (29%), Positives = 12/24 (50%) Query: 42 IRELQKELYPAISTLAHRMDKLHF 65 L+ E+ PAI A + ++F Sbjct: 42 DTALRSEVLPAIGQKASSIRAVYF 65 >3bg1_B Nucleoporin NUP145; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Saccharomyces cerevisiae} PDB: 3bg0_B (B:166-261) Length = 96 Score = 23.5 bits (51), Expect = 9.3 Identities = 10/48 (20%), Positives = 20/48 (41%) Query: 3 FKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELY 50 ++K L+VL++ LGS L ++ I + ++Y Sbjct: 36 IESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIY 83 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.320 0.135 0.367 Gapped Lambda K H 0.267 0.0686 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 666,170 Number of extensions: 25876 Number of successful extensions: 141 Number of sequences better than 10.0: 1 Number of HSP's gapped: 141 Number of HSP's successfully gapped: 16 Length of query: 97 Length of database: 4,956,049 Length adjustment: 57 Effective length of query: 40 Effective length of database: 3,029,164 Effective search space: 121166560 Effective search space used: 121166560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.1 bits)