RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780221|ref|YP_003064634.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) >1xr4_A Putative citrate lyase alpha chain/citrate-ACP transferase; the midwest center for structural genomics, MCSG, structural genomics; 2.37A {Salmonella typhimurium LT2} SCOP: c.124.1.2 c.124.1.2 Length = 509 Score = 29.5 bits (66), Expect = 0.17 Identities = 17/77 (22%), Positives = 27/77 (35%), Gaps = 5/77 (6%) Query: 12 VLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHFESDALD 71 VLVT G + +L L + I +LQ+ + F + Sbjct: 436 VLVTDHGIAVNPARQDLLDNLRAAGVALMTIEQLQQRAEQLTGK-PQ---PIEFTDRVVA 491 Query: 72 PILRRMDGPVKHVERRI 88 + R DG V V R++ Sbjct: 492 VVRYR-DGSVIDVIRQV 507 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 28.8 bits (64), Expect = 0.29 Identities = 18/72 (25%), Positives = 29/72 (40%), Gaps = 19/72 (26%) Query: 9 ILAVLVT------LLGSCADDRITELNTLLAEYKEEN----LKIRELQKELYPAISTLAH 58 +L + +T L G+ +++ L A+ +EN +K +EL K A Sbjct: 83 VLNLCLTEFENCYLEGN-------DIHALAAKLLQENDTTLVKTKELIKNYITARIMAKR 135 Query: 59 RMDKLHFESDAL 70 DK S AL Sbjct: 136 PFDKKS-NS-AL 145 >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.00A {Shigella flexneri 2a str} Length = 144 Score = 25.3 bits (54), Expect = 3.4 Identities = 13/47 (27%), Positives = 22/47 (46%) Query: 38 ENLKIRELQKELYPAISTLAHRMDKLHFESDALDPILRRMDGPVKHV 84 ++IR ++E + + TL R D L +D I R+M+ V Sbjct: 2 NAMEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKMNHDVSLF 48 >3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin- like fold; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} Length = 156 Score = 25.1 bits (54), Expect = 3.6 Identities = 7/25 (28%), Positives = 10/25 (40%) Query: 21 ADDRITELNTLLAEYKEENLKIREL 45 A I E+ A + E + EL Sbjct: 113 ASGLIREIRAFYASPQAEGIARLEL 137 >1uap_A Procollagen C-proteinase enhancer protein; beta barrel, protein binding; NMR {Homo sapiens} SCOP: b.40.3.3 Length = 154 Score = 24.6 bits (53), Expect = 5.1 Identities = 7/49 (14%), Positives = 15/49 (30%) Query: 2 RFKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIRELQKELY 50 F L++ V + + + +L+ YK L + Sbjct: 43 NFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPPTGAS 91 >1de4_C Transferrin receptor, hemochromatosis protein; HFE, hereditary hemochromatosis, MHC class I; HET: NAG; 2.80A {Homo sapiens} SCOP: a.48.2.1 c.8.4.1 c.56.5.5 PDB: 1cx8_A* 1suv_A 2nsu_A Length = 640 Score = 24.4 bits (52), Expect = 6.7 Identities = 12/73 (16%), Positives = 26/73 (35%), Gaps = 11/73 (15%) Query: 25 ITELNTLLAEYKEENLKIRELQKELYPAISTLAHRMDKLHFESDALDPILRRMDGPVKHV 84 + +LN A+ KE L ++ L A +L + + R + Sbjct: 502 VRDLNQYRADIKEMGLSLQWLYS----ARGDFFRATSRLTTDFGNAEKTDRFVM------ 551 Query: 85 ERRINSKTTTLEQ 97 +++N + +E Sbjct: 552 -KKLNDRVMRVEY 563 >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Score = 23.7 bits (50), Expect = 8.9 Identities = 8/24 (33%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Query: 23 DRITELNTLLAEYKEENLK-IREL 45 DR+T+ + +++EE K ++EL Sbjct: 78 DRLTQEPESIRKWREEQRKRLQEL 101 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.320 0.135 0.367 Gapped Lambda K H 0.267 0.0554 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 757,230 Number of extensions: 30185 Number of successful extensions: 166 Number of sequences better than 10.0: 1 Number of HSP's gapped: 166 Number of HSP's successfully gapped: 31 Length of query: 97 Length of database: 5,693,230 Length adjustment: 63 Effective length of query: 34 Effective length of database: 4,165,858 Effective search space: 141639172 Effective search space used: 141639172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.4 bits)