>cd00822 TopoII_Trans_DNA_gyrase TopoIIA_Trans_DNA_gyrase: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to the B subunits of E. coli DNA gyrase and E. coli Topoisomerase IV which are heterodimers composed of two subunits. The type IIA enzymes are the predominant form of topoisomerase and are found in some bacteriophages, viruses and archaea, and in all bacteria and eukaryotes. All type IIA topoisomerases are related to each other at amino acid sequence level, though their oligomeric organization sometimes differs. TopoIIA enzymes cut both strands of the duplex DNA to remove (relax) both positive and negative supercoils in DNA. These enzymes covalently attach to the 5' ends of the cut DNA, separate the free ends of the cleaved strands, pass another region of the duplex through this gap, then rejoin the ends. TopoIIA enzymes also catenate/ decatenate duplex rings. E.coli DNA gyrase is a

Probab=100.00 E-value=1.4e-42 Score=311.57 Aligned_cols=169 Identities=38% Similarity=0.599 Sum_probs=157.6 Q ss_pred CCCHHHHHCCCCCCCCCCCCCEEEEEEECCCEEEEEEEEEEECCCCCC-EEEEEEECCCCCCCEEECCHHHHHHHHHHHH Q ss_conf 861222100246776667752033332148015589998541467774-2788830006557524130467899999987 Q gi|254780222|r 267 GGLKTYLQTKLENRSLISSEIFTGKTEKKGTHRGTVEWAIAWCEENPE-ITSYCNTILTDEGGTHESGLRVALTRGIKKY 345 (686) Q Consensus 267 ~Gi~dyv~~~~~~~~~~~~~~~~~~~~~~~~~~~~veval~~~~~~~~-~~SFVN~I~T~~GGTHv~g~~~ai~k~i~~~ 345 (686) T Consensus 1 gGi~dfv~~l~~~k~~l~~~~i~~~~~~~~---~~vEvA~qw~~~~~e~i~sf~N~I~T~~GGTH~~Gfk~altr~i~~y 77 (172) T cd00822 1 GGLKDFVEELNKDKEPLHEEPIYIEGEKDG---VEVEVALQWTDSYSENILSFVNNIPTPEGGTHETGFRAALTRAINDY 77 (172) T ss_pred CCHHHHHHHHHCCCCCCCCCCEEEEEEECC---EEEEEEEEECCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHH T ss_conf 988999999846998588999799987489---89999998358888607860668467999852789999999999999 Q ss_pred HHHCCC--CCCCCCCCCCCCCCEEEEEEEEEEHHHCCCCCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 630188--332223322223642699997763456076446620252320000121015889997740135688999999 Q gi|254780222|r 346 AELTQN--KRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENALRDPFDHYLVQNPIEATKLLEWVI 423 (686) Q Consensus 346 ~~~~~~--kk~~~i~~~dIk~~L~~~Isv~I~nP~FesQTKekL~s~~~~~~v~~~i~~~l~~~l~~n~~~a~~I~~~~~ 423 (686) T Consensus 78 ~~~~~l~k~~~~~~~~dDi~egl~~iiSvki~~PqFegQTK~KL~s~ev~~~v~~~v~~~l~~~l~~np~~a~~Ii~k~i 157 (172) T cd00822 78 AKKNNLLKKKDVKLTGDDIREGLTAVISVKVPEPQFEGQTKDKLGNSEVRSIVESAVREALEEWLEENPEEAKKILEKAI 157 (172) T ss_pred HHHHCCCCCCCCCCCHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHH T ss_conf 99825023354789999996436488552536882266220521788899999999999999999989999999999999 Q ss_pred HHHHHHHHHHHHHHH Q ss_conf 999965454433444 Q gi|254780222|r 424 ERSEERLRRRKQREV 438 (686) Q Consensus 424 ~~a~~r~~~~k~k~~ 438 (686) T Consensus 158 ~~a~aR~~akkare~ 172 (172) T cd00822 158 LAAKAREAARKAREL 172 (172) T ss_pred HHHHHHHHHHHHCCC T ss_conf 999999999973479

HHsearch alignment for GI: 254780222 and conserved domain: cd00822