RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780225|ref|YP_003064638.1| peptidyl-tRNA hydrolase [Candidatus Liberibacter asiaticus str. psy62] (189 letters) >gnl|CDD|144695 pfam01195, Pept_tRNA_hydro, Peptidyl-tRNA hydrolase. Length = 184 Score = 227 bits (581), Expect = 1e-60 Identities = 86/184 (46%), Positives = 115/184 (62%), Gaps = 3/184 (1%) Query: 3 IVAGLGNPGHEYCENRHNIGFMCIDRIHS-FHFFPAWKKKFHAEISEGQLDGLRTILIKP 61 ++ GLGNPG +Y RHN+GFM IDR+ KKKF I++G+++G + +L+KP Sbjct: 1 LIVGLGNPGPKYENTRHNVGFMVIDRLAERLGVSLKKKKKFKGLIAKGRINGEKVLLLKP 60 Query: 62 QTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEK 121 QT+MNLSG+++ + FYK+P E+ LV+HDDLDL G LRLK GGG GHNGLKSI Sbjct: 61 QTYMNLSGEAVRAIARFYKIP-PEDILVVHDDLDLPLGKLRLKKGGGAGGHNGLKSIISH 119 Query: 122 CG-KNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSF 180 G ++KRLRIGIGRPPD + +VL FS E L I+ A +L L + Sbjct: 120 LGTNDFKRLRIGIGRPPDKNDVADYVLSKFSPEELELLDKAIEKAADALEDLIEGGFDKA 179 Query: 181 LNHI 184 +N Sbjct: 180 MNRF 183 >gnl|CDD|30542 COG0193, Pth, Peptidyl-tRNA hydrolase [Translation, ribosomal structure and biogenesis]. Length = 190 Score = 218 bits (558), Expect = 6e-58 Identities = 82/186 (44%), Positives = 119/186 (63%), Gaps = 3/186 (1%) Query: 1 MFIVAGLGNPGHEYCENRHNIGFMCIDRI-HSFHFFPAWKKKFHAEISEGQLDGLRTILI 59 M ++ GLGNPG +Y + RHN+GFM +D + + +KKF+ +++G ++G + IL+ Sbjct: 2 MKLIVGLGNPGKKYAKTRHNVGFMVVDLLARRLNLSFKEEKKFNGLVAKGTIEGEKVILL 61 Query: 60 KPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSIS 119 KP T+MNLSG+++ + +FYK+ E+ LV+HD+LDL G +RLK GGG GHNGLKSI Sbjct: 62 KPTTYMNLSGKAVGALASFYKI-KPEDILVVHDELDLPLGKVRLKLGGGAGGHNGLKSII 120 Query: 120 EKCG-KNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDV 178 G N+ RLRIGIGRP + + +VLG FS ER L ID A +L LL + + Sbjct: 121 AHLGTNNFYRLRIGIGRPGNGEDVADYVLGKFSKEERELLDKAIDKAADALELLLEGDFE 180 Query: 179 SFLNHI 184 +N + Sbjct: 181 KAMNKL 186 >gnl|CDD|73208 cd00462, PTH, Peptidyl-tRNA hydrolase (PTH) is a monomeric protein that cleaves the ester bond linking the nascent peptide and tRNA when peptidyl-tRNA is released prematurely from the ribosome. This ensures the recycling of peptidyl-tRNAs into tRNAs produced through abortion of translation and is essential for cell viability.This group also contains chloroplast RNA splicing 2 (CRS2), which is closely related nuclear-encoded protein required for the splicing of nine group II introns in chloroplasts.. Length = 171 Score = 208 bits (531), Expect = 8e-55 Identities = 81/171 (47%), Positives = 111/171 (64%), Gaps = 2/171 (1%) Query: 3 IVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIKPQ 62 ++ GLGNPG +Y RHN+GFM +D + + KKK + EG++ G + +L+KPQ Sbjct: 1 LIVGLGNPGPKYENTRHNVGFMVLDALAERYGVSFKKKKKKGLVGEGRIGGEKVLLLKPQ 60 Query: 63 TFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKC 122 T+MNLSG+++ + NFYK+P E+ LVIHDDLDL G +RLK GGG GHNGLKSI Sbjct: 61 TYMNLSGEAVAALANFYKIP-PEDILVIHDDLDLPLGKIRLKKGGGSGGHNGLKSIIAHL 119 Query: 123 G-KNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLL 172 G +++ RLRIGIGRPP+ + +VL FS ER L I+ A +L + Sbjct: 120 GTEDFPRLRIGIGRPPNKMDVADYVLSKFSKEERELLEEAIEKAADALEDI 170 >gnl|CDD|48347 cd02406, CRS2, Chloroplast RNA splicing 2 (CRS2) is a nuclear-encoded protein required for the splicing of group II introns in the chloroplast. CRS2 forms stable complexes with two CRS2-associated factors, CAF1 and CAF2, which are required for the splicing of distinct subsets of CRS2-dependent introns. CRS2 is closely related to bacterial peptidyl-tRNA hydrolases (PTH).. Length = 191 Score = 135 bits (342), Expect = 5e-33 Identities = 64/156 (41%), Positives = 92/156 (58%), Gaps = 3/156 (1%) Query: 2 FIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIKP 61 +++AGLGNPG++Y RHN+GF +DRI +F + + G + + +L KP Sbjct: 3 WLIAGLGNPGNKYKGTRHNVGFEMVDRIAEAEGITMNTIQFKSLLGIGSIGDVPVLLAKP 62 Query: 62 QTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISE- 120 QT+MN SG+S+ + +YK+P L + LVI+DD+ L G LRL+ GG HNGL+S+ E Sbjct: 63 QTYMNYSGESVGPLAAYYKVP-LRHILVIYDDMSLPNGVLRLQPKGGHGRHNGLQSVIEH 121 Query: 121 -KCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPER 155 + + RL IGIG PP +L FSS ER Sbjct: 122 LDGSREFPRLSIGIGSPPGKMDPRAFLLQKFSSEER 157 >gnl|CDD|37466 KOG2255, KOG2255, KOG2255, Peptidyl-tRNA hydrolase [Translation, ribosomal structure and biogenesis]. Length = 224 Score = 120 bits (302), Expect = 2e-28 Identities = 66/183 (36%), Positives = 102/183 (55%), Gaps = 3/183 (1%) Query: 2 FIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIKP 61 +++ GLGNPG +Y RHN+GF +D + P A G + + +L++P Sbjct: 40 WLIVGLGNPGSKYVGTRHNVGFEMLDMLARRLGVPMNTISSKALEGLGLVGDVPILLLRP 99 Query: 62 QTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEK 121 Q +MN SG+S+ +V YK+P L + +VIHD+L+L G LRL+ GG GHNG++S+ Sbjct: 100 QQYMNFSGESVGKVAALYKIP-LRHIVVIHDELELPLGKLRLRPGGSHRGHNGVRSVFNC 158 Query: 122 CG--KNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVS 179 +++ RL IGIGRPP + VL FS E+ LL + ++L L ++ +S Sbjct: 159 LNGRRSFPRLSIGIGRPPGNEDVKAFVLSKFSPAEQKELLETLLEHVKTLILQGLQQSIS 218 Query: 180 FLN 182 N Sbjct: 219 RFN 221 >gnl|CDD|31282 COG1085, GalT, Galactose-1-phosphate uridylyltransferase [Energy production and conversion]. Length = 338 Score = 29.2 bits (65), Expect = 0.75 Identities = 25/93 (26%), Positives = 37/93 (39%), Gaps = 3/93 (3%) Query: 16 ENRHNIGFMCIDRIHSFHF--FPAWKKKFHAEISEGQLDGLRTILIK-PQTFMNLSGQSL 72 EN H + F+ F +P F ++S+ +L L IL K + NL G S Sbjct: 206 ENDHFLAFVPFWARWPFEVLIYPKEHVSFLTDLSDEELKDLAEILKKLLARYDNLFGNSF 265 Query: 73 LEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKT 105 M F++ P E H ++ LR T Sbjct: 266 PYSMGFHQAPFNEVNEHYHLHAEIYPPLLRSAT 298 >gnl|CDD|37585 KOG2374, KOG2374, KOG2374, Uncharacterized conserved protein [Function unknown]. Length = 661 Score = 29.0 bits (64), Expect = 0.82 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 115 LKSISEKCGKNYKRLRIGI 133 L+ +EK G +YK LR+G Sbjct: 120 LEKWNEKFGFHYKELRLGF 138 >gnl|CDD|176561 cd08624, PI-PLCc_beta2, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta2. This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-beta isozyme 2. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which goes on to phosphorylate other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PLC-beta represents a class of mammalian PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and a unique C-terminal coiled-coil (CT) domain necessary for homodimerization. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. PI-PLC-beta2 is expressed at highest levels in cells of hematopoietic origin. It is activated by the heterotrimeric G protein alpha q subunits through their C2 domain and long C-terminal extension. It is also activated by the beta-gamma subunits of heterotrimeric G proteins. Length = 261 Score = 28.5 bits (63), Expect = 1.3 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Query: 134 GRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDV-SFLNHIVSVRK 189 G+PPD II H F+ I+ IA S + + SF NH+ S ++ Sbjct: 53 GKPPDEEPIITH---GFTMTTEILFKDAIEAIAESAFKTSPYPVILSFENHVDSPKQ 106 >gnl|CDD|36387 KOG1172, KOG1172, KOG1172, Na+-independent Cl/HCO3 exchanger AE1 and related transporters (SLC4 family) [Inorganic ion transport and metabolism]. Length = 876 Score = 27.2 bits (60), Expect = 2.9 Identities = 14/60 (23%), Positives = 23/60 (38%), Gaps = 5/60 (8%) Query: 38 WKKKFHAEISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLD 97 W K A +S L LR+ L ++L SL E+ + + +V L + Sbjct: 37 WSKPHVATLSLHSLFELRSCLANGTVLLDLDATSLPEIADQ-----VVEKMVESGQLKPE 91 >gnl|CDD|145275 pfam02006, DUF137, Protein of unknown function DUF137. This family of archaeal proteins has no known function. Length = 178 Score = 27.2 bits (61), Expect = 3.3 Identities = 7/16 (43%), Positives = 12/16 (75%) Query: 159 LPIIDNIARSLPLLAK 174 + I+DNI R++P L + Sbjct: 130 ITIVDNITRAIPNLTE 145 >gnl|CDD|37242 KOG2031, KOG2031, KOG2031, Tyrosyl-DNA phosphodiesterase [Replication, recombination and repair]. Length = 519 Score = 25.7 bits (56), Expect = 7.4 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 9/62 (14%) Query: 70 QSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRL---------KTGGGDAGHNGLKSISE 120 Q L+E +N Y+LP L+ ++ +D +R +G GHN LK I + Sbjct: 231 QDLIEYLNSYRLPQLKEWIASLKKVDFSAINVRFIGSTPGKFQGSGLLSWGHNKLKKILK 290 Query: 121 KC 122 + Sbjct: 291 EH 292 >gnl|CDD|176552 cd08610, GDPD_GDE6, Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE6 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE6 (also known as glycerophosphodiester phosphodiesterase domain-containing protein 4 (GDPD4)) and their metazoan homologs. Mammalian GDE6 is a transmembrane protein predominantly expressed in the spermatocytes of testis. Although the specific physiological function of mammalian GDE6 has not been elucidated, its different pattern of tissue distribution suggests it might play a critical role in the completion of meiosis during male germ cell differentiation. Length = 316 Score = 25.6 bits (56), Expect = 9.6 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 11/45 (24%) Query: 59 IKPQTFMNLS-----------GQSLLEVMNFYKLPNLENYLVIHD 92 +KP+ F N+ QS+ ++ NF +L EN LVI D Sbjct: 110 VKPRPFYNMKPLSEADKERARNQSIPKLSNFLRLAEKENKLVIFD 154 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.144 0.445 Gapped Lambda K H 0.267 0.0785 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,486,666 Number of extensions: 131024 Number of successful extensions: 364 Number of sequences better than 10.0: 1 Number of HSP's gapped: 349 Number of HSP's successfully gapped: 15 Length of query: 189 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 101 Effective length of database: 4,362,145 Effective search space: 440576645 Effective search space used: 440576645 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 54 (24.5 bits)