BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780225|ref|YP_003064638.1| peptidyl-tRNA hydrolase [Candidatus Liberibacter asiaticus str. psy62] (189 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780225|ref|YP_003064638.1| peptidyl-tRNA hydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Score = 388 bits (997), Expect = e-110, Method: Compositional matrix adjust. Identities = 189/189 (100%), Positives = 189/189 (100%) Query: 1 MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIK 60 MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIK Sbjct: 1 MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAEISEGQLDGLRTILIK 60 Query: 61 PQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISE 120 PQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISE Sbjct: 61 PQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLKTGGGDAGHNGLKSISE 120 Query: 121 KCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSF 180 KCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSF Sbjct: 121 KCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIIDNIARSLPLLAKREDVSF 180 Query: 181 LNHIVSVRK 189 LNHIVSVRK Sbjct: 181 LNHIVSVRK 189 >gi|254780952|ref|YP_003065365.1| DNA helicase II [Candidatus Liberibacter asiaticus str. psy62] Length = 685 Score = 26.9 bits (58), Expect = 0.22, Method: Compositional matrix adjust. Identities = 38/146 (26%), Positives = 62/146 (42%), Gaps = 17/146 (11%) Query: 34 FFPAWKKKFHAEISEGQLDGLR---TILIKPQTFMNLSGQSLLE--VMNFYKLPNLENYL 88 + WK +E S+ +LD LR +I+ K +T Q+ L + +F N + Sbjct: 515 YMAMWKNNKSSEKSQERLDNLRELLSIIEKHETLEGFVLQAPLRENLGSFIPDSNCIQIM 574 Query: 89 VIHDDLDLDFGTLRLKTGGGDAGHNGLKSISEKCGKNYKRLR-IGIGRPPDTAHI---IR 144 +H L+F T+ + +G SI+E + +RL +GI R H+ I Sbjct: 575 TLHAAKGLEFDTVFI-SGWEQGLLPHQLSINEGNVEGERRLAYVGITRAKKKCHLFYTIN 633 Query: 145 HVLGNFSSPERY-------FLLPIID 163 +F+ ERY FLL + D Sbjct: 634 RRTHDFTRVERYQPSQVSQFLLELYD 659 >gi|255764506|ref|YP_003065297.2| GTP cyclohydrolase I [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Score = 26.9 bits (58), Expect = 0.26, Method: Compositional matrix adjust. Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Query: 103 LKTGGGDAGHNGLKSISEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPII 162 L+ G D GLK ++ K+YK L G + P T R +F +Y + +I Sbjct: 29 LRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF---HFGEASKYQDMVLI 85 Query: 163 DNIA 166 +I+ Sbjct: 86 KDIS 89 >gi|254780785|ref|YP_003065198.1| 30S ribosomal protein S15 [Candidatus Liberibacter asiaticus str. psy62] Length = 89 Score = 24.6 bits (52), Expect = 1.1, Method: Compositional matrix adjust. Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Query: 24 MCIDRIHSF-HFFPAWKKKFHAEISEGQLDGLRTILIK 60 +C +RI + F + KK +++I G+L LR+ L+K Sbjct: 31 VCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSSLLK 68 >gi|254781219|ref|YP_003065632.1| hypothetical protein CLIBASIA_05630 [Candidatus Liberibacter asiaticus str. psy62] Length = 200 Score = 23.9 bits (50), Expect = 1.9, Method: Compositional matrix adjust. Identities = 13/46 (28%), Positives = 19/46 (41%), Gaps = 11/46 (23%) Query: 110 AGHNGLKSISEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPER 155 A NGLK+++E C K P D + + H + ER Sbjct: 55 AKENGLKTVTEVCPK-----------PKDITYSLSHFIEGLIESER 89 >gi|254780619|ref|YP_003065032.1| primosome assembly protein PriA [Candidatus Liberibacter asiaticus str. psy62] Length = 731 Score = 23.9 bits (50), Expect = 2.1, Method: Compositional matrix adjust. Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 5/38 (13%) Query: 152 SPERYFLLPIIDN-----IARSLPLLAKREDVSFLNHI 184 SP YF LPI+D + + +PL K VS ++ + Sbjct: 189 SPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGV 226 >gi|254780892|ref|YP_003065305.1| probable two-component response regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 133 Score = 22.3 bits (46), Expect = 5.9, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 16/32 (50%) Query: 64 FMNLSGQSLLEVMNFYKLPNLENYLVIHDDLD 95 FM S+ E F + L NYLVI + ++ Sbjct: 26 FMVFEATSVCEAREFCEKELLPNYLVIDESME 57 >gi|254781162|ref|YP_003065575.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 192 Score = 21.9 bits (45), Expect = 6.6, Method: Compositional matrix adjust. Identities = 7/26 (26%), Positives = 16/26 (61%) Query: 153 PERYFLLPIIDNIARSLPLLAKREDV 178 P R LP++ N+A+++ + + +V Sbjct: 167 PNRVLFLPLVQNVAQNIKGIVRCREV 192 >gi|254780823|ref|YP_003065236.1| double-strand break repair protein AddB [Candidatus Liberibacter asiaticus str. psy62] Length = 1040 Score = 21.9 bits (45), Expect = 7.3, Method: Compositional matrix adjust. Identities = 7/18 (38%), Positives = 11/18 (61%) Query: 140 AHIIRHVLGNFSSPERYF 157 A +++H L F PE+Y Sbjct: 447 ATLVKHPLAKFGFPEKYL 464 >gi|254781075|ref|YP_003065488.1| hypothetical protein CLIBASIA_04885 [Candidatus Liberibacter asiaticus str. psy62] Length = 266 Score = 21.6 bits (44), Expect = 8.4, Method: Compositional matrix adjust. Identities = 7/23 (30%), Positives = 16/23 (69%) Query: 162 IDNIARSLPLLAKREDVSFLNHI 184 I++I LP +++ E + ++NH+ Sbjct: 217 IESIPLDLPEMSQDEAIKYINHV 239 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.144 0.445 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 137,037 Number of Sequences: 1233 Number of extensions: 5888 Number of successful extensions: 29 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 19 Number of HSP's gapped (non-prelim): 13 length of query: 189 length of database: 328,796 effective HSP length: 69 effective length of query: 120 effective length of database: 243,719 effective search space: 29246280 effective search space used: 29246280 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 36 (18.5 bits)