HHsearch alignment for GI: 254780226 and conserved domain: PTZ00133

>PTZ00133 ADP-ribosylation factor; Provisional.
Probab=98.78  E-value=2.5e-07  Score=69.12  Aligned_cols=80  Identities=21%  Similarity=0.299  Sum_probs=53.4

Q ss_pred             CCEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCC
Q ss_conf             82486752888788899998740489873666867448833799768555877764218650233579998512235432
Q gi|254780226|r    2 GFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGA   81 (367)
Q Consensus         2 ~~kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~d~~~~~l~~~~~~~~~~p~~i~~iDvaGLv~gA   81 (367)
T Consensus        17 ~~kililGl~~sGKTsil~~l~~-~~~-~~~--~pTvg~~~~~~~~-----------------~~~~l~iwD~~G----q   71 (182)
T PTZ00133         17 EVRILMVGLDAAGKTTILYKLKL-GEV-VTT--IPTIGFNVETVEY-----------------KNLKFTMWDVGG----Q   71 (182)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHC-CCC-CCC--CCCCCCCEEEEEE-----------------CCEEEEEEECCC----C
T ss_conf             47999996799889999999962-997-773--7868845699997-----------------888999998999----8


Q ss_pred             CCCCCCHHHHHHHHHCCCEEEEEECCCC
Q ss_conf             2246632899998730374788501234
Q gi|254780226|r   82 SKGEGLGNQFLAHIREVDAIIHVLRCFK  109 (367)
Q Consensus        82 ~~G~GlGN~FL~~ir~aDalihVVdaf~  109 (367)
T Consensus        72 e~~r~lw~~y---y~~~~giI~VvD~sd   96 (182)
T PTZ00133         72 DKLRPLWRHY---YQNTNGIIFVVDSND   96 (182)
T ss_pred             CCCCHHHHHC---CCCCCEEEEEEECCC
T ss_conf             4547478760---567644999996678