>TIGR00436 era GTP-binding protein Era; InterPro: IPR005662 Era is an essential G-protein in Escherichia coli identified originally as a homologue protein to Ras (E. coli Ras-like protein). It binds to GTP/GDP and contains a low intrinsic GTPase activity. Its function remains elusive, although it may be associated with cell division, energy metabolism, and cell-cycle check point. The protein has recently been shown to specifically bind to 16S rRNA and the 30S ribosomal subunit . Involvement of Era in protein synthesis is suggested by the fact that Era depletion results in the translation defect both in vitro and in vivo. A Type 2 KH domain is found near the C-terminus. ; GO: 0003723 RNA binding, 0005525 GTP binding, 0005622 intracellular.

Probab=97.42 E-value=0.00028 Score=48.60 Aligned_cols=90 Identities=28% Similarity=0.343 Sum_probs=67.3 Q ss_pred EEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCEEEEEE-EEEEECCCCCCC-C Q ss_conf 48675288878889999874048987366686744883379976855587776421865023357-999851223543-2 Q gi|254780226|r 4 KCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTR-MSFVDIAGLVRG-A 81 (367) Q Consensus 4 kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~d~~~~~l~~~~~~~~~~p~~-i~~iDvaGLv~g-A 81 (367) T Consensus 2 ~~~~~g~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----------------~~~~~~~d~pg~~~~~~ 64 (278) T TIGR00436 2 FVAILGRPNVGKSTLLNKLLGQKISITSPKPQTTRNRISGILTTGA-----------------SQNIIFIDTPGFHEPEK 64 (278) T ss_pred CEEECCCCCCCHHHHHHHHHCCCHHCCCCCCHHHHHHHHEEEECCC-----------------CCCEEEEECCCCCCHHH T ss_conf 1121157765336677766324101002310123433200122366-----------------55157862587651245 Q ss_pred C-CCCCCHHHHHHHHHCCCEEEEEECCCCC Q ss_conf 2-2466328999987303747885012345 Q gi|254780226|r 82 S-KGEGLGNQFLAHIREVDAIIHVLRCFKD 110 (367) Q Consensus 82 ~-~G~GlGN~FL~~ir~aDalihVVdaf~~ 110 (367) T Consensus 65 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 94 (278) T TIGR00436 65 HKLGELLNKEARSALGGVDLLLFVVDSDEW 94 (278) T ss_pred HHHHHHHHHHHHHHHCCCEEEEEEEECCCC T ss_conf 677888888887531232268898633445

HHsearch alignment for GI: 254780226 and conserved domain: TIGR00436