>TIGR02857 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydD; InterPro: IPR014216 The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain and a C-terminal ATP-binding domain. In Escherichia coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in the export of redox-active thiol compounds such as cysteine and glutathione , . The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this entry are all either found in the gammaproteobacterial context, or the CydABCD context. All members of this entry scoring above the trusted cut off at the time of its creation were from genomes which encode a cytochrome bd complex. Unfortunately, the gene symbol nomenclature, based on this operon in Bacillus subtilis, assigns cydC to the third gene in the operon, where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologues in this family in accordance with the precedence of publication of the E. coli name, CydD..

Probab=93.94  E-value=0.079  Score=32.11  Aligned_cols=32  Identities=38%  Similarity=0.647  Sum_probs=27.5

Q ss_pred             EEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             48675288878889999874048987366686744883379976
Q gi|254780226|r    4 KCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAV   47 (367)
Q Consensus         4 kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v   47 (367)
T Consensus       380 ~vAl~G~SGaGKSTLL~lLLGf~------------~P~~G~i~v  411 (570)
T TIGR02857       380 RVALVGPSGAGKSTLLNLLLGFV------------EPTEGAIVV  411 (570)
T ss_pred             EEEEEECCCCCHHHHHHHHHCCC------------CCCCCEEEE
T ss_conf             48886279997889999997157------------644646887