>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=92.82 E-value=0.11 Score=31.14 Aligned_cols=34 Identities=32% Similarity=0.553 Sum_probs=26.3 Q ss_pred EEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCC Q ss_conf 4867528887888999987404898736668674488337997685 Q gi|254780226|r 4 KCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPD 49 (367) Q Consensus 4 kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~d 49 (367) T Consensus 27 ~~~i~G~nGaGKSTLl~~l~gl~------------~~~~G~i~~~g 60 (157) T cd00267 27 IVALVGPNGSGKSTLLRAIAGLL------------KPTSGEILIDG 60 (157) T ss_pred EEEEECCCCCCHHHHHHHHHCCC------------CCCCCEEEECC T ss_conf 99998788999899999995884------------79962899999

HHsearch alignment for GI: 254780226 and conserved domain: cd00267