>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily. EF1 is responsible for the GTP-dependent binding of aminoacyl-tRNAs to the ribosomes. EF1 is composed of four subunits: the alpha chain which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains. This subfamily is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF1-alpha) and eukaryotes (eEF1-alpha). eEF1-alpha interacts with the actin of the eukaryotic cytoskeleton and may thereby play a role in cellular transformation and apoptosis. EF-Tu can have no such role in bacteria. In humans, the isoform eEF1A2 is overexpressed in 2/3 of breast cancers and has been identified as a putative oncogene. This subfamily also includes Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation in

Probab=95.43 E-value=0.11 Score=31.06 Aligned_cols=94 Identities=18% Similarity=0.147 Sum_probs=46.6 Q ss_pred EEEEECCCCCHHHHHHHHH---CCCCC--------CCCCCCCCCCCCCEEEEECCCHHHHHHH---HH---CCCCEEEEE Q ss_conf 8675288878889999874---04898--------7366686744883379976855587776---42---186502335 Q gi|254780226|r 5 CGIIGLPNVGKSTLFNALT---RTASA--------QAANYPFCTIEPNSGEVAVPDPRMHKLA---EI---AESKDLVPT 67 (367) Q Consensus 5 iGlvG~pn~GKST~f~alT---~~~~~--------~~~~ypFtTi~pn~g~~~v~d~~~~~l~---~~---~~~~~~~p~ 67 (367) T Consensus 2 i~iiGHvD~GKSTL~g~lL~~~g~i~~~~~~k~~~~~~~~g----k~s~~~a~~lD~~~~ErerGiTI~~~~~~f~~~~~ 77 (219) T cd01883 2 LVVIGHVDAGKSTTTGHLLYLLGGVDKRTIEKYEKEAKEMG----KGSFKYAWVLDTLKEERERGVTIDVGLAKFETEKY 77 (219) T ss_pred EEEEECCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCC----CCCCEEEEEECCCHHHHHCCCCEEEEEEEEEECCE T ss_conf 89996689989999999999859976889999999998549----98750556613898798589258858999984993 Q ss_pred EEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCEEEEEECCCC Q ss_conf 799985122354322246632899998730374788501234 Q gi|254780226|r 68 RMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFK 109 (367) Q Consensus 68 ~i~~iDvaGLv~gA~~G~GlGN~FL~~ir~aDalihVVdaf~ 109 (367) T Consensus 78 ~~~iiDtPGH~d-------f~~~mi~g~~~ad~ailvvda~~ 112 (219) T cd01883 78 RFTILDAPGHRD-------FVPNMITGASQADVAVLVVDARK 112 (219) T ss_pred EEEEEECCCCHH-------HHHHHHHHHHHCCEEEEEEECCC T ss_conf 699987897266-------78899987753166899998576

HHsearch alignment for GI: 254780226 and conserved domain: cd01883