>cd01885 EF2 EF2 (for archaea and eukarya). Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes. The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome. The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins. Two major mechanisms are known to regulate protein elongation and both involve eEF2. First, eEF2 can be modulated by reversible phosphorylation. Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes. Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2. In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation. Seco

Probab=95.89 E-value=0.041 Score=34.04 Aligned_cols=91 Identities=21% Similarity=0.276 Sum_probs=53.4 Q ss_pred EEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHH---H--------C-----CCCEEEEE Q ss_conf 486752888788899998740489873666867448833799768555877764---2--------1-----86502335 Q gi|254780226|r 4 KCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAE---I--------A-----ESKDLVPT 67 (367) Q Consensus 4 kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~d~~~~~l~~---~--------~-----~~~~~~p~ 67 (367) T Consensus 2 Ni~iigHvdhGKTTL~D~Ll~~~g~-i~~-------~~~g~~~~~D~~~~E~eRgiTIks~~isl~~~~~~~~~~~~~~~ 73 (222) T cd01885 2 NICIIAHVDHGKTTLSDSLLASAGI-ISE-------KLAGKARYMDSREDEQERGITMKSSAISLYFEYEEEDKADGNEY 73 (222) T ss_pred EEEEECCCCCCHHHHHHHHHHHCCC-CCH-------HCCCCEEECCCHHHHHHCCCEEEEEEEEEEEEECCCCCCCCCCE T ss_conf 6999866887799999999998598-412-------10663465142433420541586226899986034434568863 Q ss_pred EEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCEEEEEECCCC Q ss_conf 799985122354322246632899998730374788501234 Q gi|254780226|r 68 RMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFK 109 (367) Q Consensus 68 ~i~~iDvaGLv~gA~~G~GlGN~FL~~ir~aDalihVVdaf~ 109 (367) T Consensus 74 ~inlIDTPGH~d-------F~~ev~~al~~~DgailVVDa~e 108 (222) T cd01885 74 LINLIDSPGHVD-------FSSEVTAALRLCDGALVVVDAVE 108 (222) T ss_pred EEEEEECCCHHH-------HHHHHHHHHHHCCEEEEEECCCC T ss_conf 899972885698-------99999999985681799610457

HHsearch alignment for GI: 254780226 and conserved domain: cd01885