HHsearch alignment for GI: 254780226 and conserved domain: cd03237

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=93.50  E-value=0.069  Score=32.48  Aligned_cols=32  Identities=28%  Similarity=0.674  Sum_probs=25.2

Q ss_pred             EEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECC
Q ss_conf             86752888788899998740489873666867448833799768
Q gi|254780226|r    5 CGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVP   48 (367)
Q Consensus         5 iGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~   48 (367)
T Consensus        28 v~liGpNGaGKSTLlk~l~Gll------------~p~~G~I~~~   59 (246)
T cd03237          28 IGILGPNGIGKTTFIKMLAGVL------------KPDEGDIEIE   59 (246)
T ss_pred             EEEECCCCCHHHHHHHHHHCCC------------CCCCCEEEEC
T ss_conf             9999799976999999997787------------8886079989