>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.

Probab=95.38 E-value=0.018 Score=36.38 Aligned_cols=36 Identities=39% Similarity=0.494 Sum_probs=28.9 Q ss_pred CEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCH Q ss_conf 248675288878889999874048987366686744883379976855 Q gi|254780226|r 3 FKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDP 50 (367) Q Consensus 3 ~kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~d~ 50 (367) T Consensus 31 ~~v~ivG~sGsGKSTLl~ll~gl------------~~p~~G~I~i~g~ 66 (220) T cd03245 31 EKVAIIGRVGSGKSTLLKLLAGL------------YKPTSGSVLLDGT 66 (220) T ss_pred CEEEEECCCCCHHHHHHHHHHCC------------CCCCCCEEEECCE T ss_conf 99999999998599999999672------------5478658999999

HHsearch alignment for GI: 254780226 and conserved domain: cd03245