>cd04128 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase. Spg1p is an essential gene that localizes to the spindle pole bodies. When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p. Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p. The existence of a SIN-related pathway in plants has been proposed. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are

Probab=97.78 E-value=0.00041 Score=47.49 Aligned_cols=84 Identities=18% Similarity=0.247 Sum_probs=53.4 Q ss_pred CEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCC Q ss_conf 24867528887888999987404898736668674488337997685558777642186502335799985122354322 Q gi|254780226|r 3 FKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGAS 82 (367) Q Consensus 3 ~kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~d~~~~~l~~~~~~~~~~p~~i~~iDvaGLv~gA~ 82 (367) T Consensus 1 iKivlvGd~~VGKTsLi~rf~~~--~F~~~y~-~Tig~d~~~k~i~----------v~~---~~v~l~iwDtaGqe---- 60 (182) T cd04128 1 LKIGLLGDAQIGKTSLMVKYVEG--EFDEDYI-QTLGVNFMEKTIS----------IRG---TEITFSIWDLGGQR---- 60 (182) T ss_pred CEEEEECCCCCCHHHHHHHHHCC--CCCCCCC-CCCEEEEEEEEEE----------ECC---EEEEEEEEECCCCH---- T ss_conf 98999999998989999999539--9999988-8733898999999----------999---99999998677648---- Q ss_pred CCCCCHHHHHHHHHCCCEEEEEECCCC Q ss_conf 246632899998730374788501234 Q gi|254780226|r 83 KGEGLGNQFLAHIREVDAIIHVLRCFK 109 (367) Q Consensus 83 ~G~GlGN~FL~~ir~aDalihVVdaf~ 109 (367) T Consensus 61 ~f~~~---~~~y~~~a~~~ilvfDit~ 84 (182) T cd04128 61 EFINM---LPLVCNDAVAILFMFDLTR 84 (182) T ss_pred HHHHH---HHHHHCCCCEEEEEEECCC T ss_conf 78999---9998647878999997899

HHsearch alignment for GI: 254780226 and conserved domain: cd04128