>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group

Probab=97.38 E-value=0.0032 Score=41.46 Aligned_cols=97 Identities=18% Similarity=0.197 Sum_probs=51.6 Q ss_pred EEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHH--HHCCCCEEEEEEEEEEECCCCCCCC Q ss_conf 48675288878889999874048987366686744883379976855587776--4218650233579998512235432 Q gi|254780226|r 4 KCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLA--EIAESKDLVPTRMSFVDIAGLVRGA 81 (367) Q Consensus 4 kiGlvG~pn~GKST~f~alT~~~~~~~~~ypFtTi~pn~g~~~v~d~~~~~l~--~~~~~~~~~p~~i~~iDvaGLv~gA 81 (367) T Consensus 1 Ni~iigH~~aGKTtL~E~lL~~~--g~i~~~G~V~~g~t~~D~~~~E~~RgiSi~s~~~~~~w~~~~inliDTPG~~DF~ 78 (268) T cd04170 1 NIALVGHSGSGKTTLAEALLYAT--GAIDRLGSVEDGTTVSDYDPEEIKRKMSISTSVAPLEWKGHKINLIDTPGYADFV 78 (268) T ss_pred CEEEEECCCCCHHHHHHHHHHHC--CCCCCCCCCCCCCCCCCCCHHHHHCCCCEECCEEEEEECCEEEEEEECCCCHHHH T ss_conf 98999089999899999999966--9966576545897357787889867967513557888899799998698975799 Q ss_pred CCCCCCHHHHHHHHHCCCEEEEEECCCC Q ss_conf 2246632899998730374788501234 Q gi|254780226|r 82 SKGEGLGNQFLAHIREVDAIIHVLRCFK 109 (367) Q Consensus 82 ~~G~GlGN~FL~~ir~aDalihVVdaf~ 109 (367) T Consensus 79 ~-------e~~~aL~v~D~Av~Vida~~ 99 (268) T cd04170 79 G-------ETRAALRAADAALVVVSAQS 99 (268) T ss_pred H-------HHHHHHCCCCEEEEEECCCC T ss_conf 9-------99998404783999941875

HHsearch alignment for GI: 254780226 and conserved domain: cd04170