RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780226|ref|YP_003064639.1| translation-associated GTPase [Candidatus Liberibacter asiaticus str. psy62] (367 letters) >gnl|CDD|181981 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed. Length = 364 Score = 631 bits (1630), Expect = 0.0 Identities = 235/372 (63%), Positives = 288/372 (77%), Gaps = 13/372 (3%) Query: 1 MGFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAE 60 MG KCGI+GLPNVGKSTLFNALT+ A A+AANYPFCTIEPN G V VPDPR+ KLAEI + Sbjct: 1 MGLKCGIVGLPNVGKSTLFNALTK-AGAEAANYPFCTIEPNVGVVPVPDPRLDKLAEIVK 59 Query: 61 SKDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRI 120 K +VP + FVDIAGLV+GASKGEGLGNQFLA+IREVDAI+HV+RCF+D+NI HVEG++ Sbjct: 60 PKKIVPATIEFVDIAGLVKGASKGEGLGNQFLANIREVDAIVHVVRCFEDDNITHVEGKV 119 Query: 121 DPINDIETIETELMLSDLE----RLERLFEKNKKYRNHKS-EEIVLLQSIISSSLRLIEE 175 DPI DIETI TEL+L+DLE RLERL EK K + ++ E+ LL+ + L +EE Sbjct: 120 DPIRDIETINTELILADLETVEKRLERL-EKKAKGGDKEAKAELELLEKL----LEHLEE 174 Query: 176 GKPVRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIYTEAVQRLASQQNA 235 GKP R+L L + + KSL LLTAKP+LY+ NV E D GN Y + V+ +A+++ A Sbjct: 175 GKPARTL--ELTDEEEKLLKSLQLLTAKPVLYVANVDEDDLADGNPYVKKVREIAAKEGA 232 Query: 236 EMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLLDLITYFTVGPKETR 295 E+++I A IEAEI++L +EE+A F+EEL + SGL+ LIR+GY LL LITYFT GPKE R Sbjct: 233 EVVVICAKIEAEIAELDDEEKAEFLEELGLEESGLDRLIRAGYELLGLITYFTAGPKEVR 292 Query: 296 AWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKEAGKARDEGKEYIV 355 AWTI +GT A +AAGVIHTDFEKGFIRA ISY D + G E AKEAGK R EGK+YIV Sbjct: 293 AWTIKKGTTAPQAAGVIHTDFEKGFIRAEVISYDDLIEYGSEAGAKEAGKVRLEGKDYIV 352 Query: 356 KDGDILHFRFNV 367 +DGD++HFRFNV Sbjct: 353 QDGDVMHFRFNV 364 >gnl|CDD|185530 PTZ00258, PTZ00258, GTP-binding protein; Provisional. Length = 390 Score = 482 bits (1244), Expect = e-137 Identities = 178/373 (47%), Positives = 244/373 (65%), Gaps = 16/373 (4%) Query: 4 KCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKD 63 K GI+GLPNVGKST FNAL + A N+PFCTI+PN+ V VPD R L + + K Sbjct: 23 KMGIVGLPNVGKSTTFNALCKQ-QVPAENFPFCTIDPNTARVNVPDERFDWLCKHFKPKS 81 Query: 64 LVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPI 123 +VP ++ DIAGLV+GAS+GEGLGN FL+HIR VD I HV+R F+DE+I HVEG IDP+ Sbjct: 82 IVPAQLDITDIAGLVKGASEGEGLGNAFLSHIRAVDGIYHVVRAFEDEDITHVEGEIDPV 141 Query: 124 NDIETIETELMLSDLERLERLFEKNKKYRNHK------SEEIVLLQSIISSSLRLIEEGK 177 D+E I +EL+L DLE +E+ ++ K R K E+ +L+ + L +EEGK Sbjct: 142 RDLEIISSELILKDLEFVEKRLDELTKKRKKKKKKKEEKVELDVLKKV----LEWLEEGK 197 Query: 178 PVRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHD-CKKGNIYTEAVQR-LASQQNA 235 PVR I I LLTAKP++Y+ N+SE D ++ N + ++ + + Sbjct: 198 PVRD--GDWTDKEIEILNEYQLLTAKPMIYLVNMSEKDFIRQKNKWLAKIKEWVGEKGGG 255 Query: 236 EMIIISAAIEAEISQLP-EEERALFMEELDISISGLELLIRSGYRLLDLITYFTVGPKET 294 +I SA E E+++L EEER ++EE I S L+ +I++GY+LL+LI +FT GP E Sbjct: 256 PIIPYSAEFEEELAELGSEEERKEYLEEYGIKQSMLDKIIKTGYKLLNLIHFFTAGPDEV 315 Query: 295 RAWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKEAGKARDEGKEYI 354 R WTI +GT A +AAGVIH+DFEKGFI A + Y+D++ +G E A K GK R EGK+Y+ Sbjct: 316 RCWTIQKGTKAPQAAGVIHSDFEKGFICAEVMKYEDFLELGSEAAVKAEGKYRQEGKDYV 375 Query: 355 VKDGDILHFRFNV 367 V+DGDI+ F+FNV Sbjct: 376 VQDGDIIFFKFNV 388 >gnl|CDD|129200 TIGR00092, TIGR00092, GTP-binding protein YchF. This predicted GTP-binding protein is found in a single copy in every complete bacterial genome, and is found in Eukaryotes. A more distantly related protein, separated from this model, is found in the archaea. It is known to bind GTP and double-stranded nucleic acid. It is suggested to belong to a nucleoprotein complex and act as a translation factor. Length = 368 Score = 359 bits (922), Expect = e-100 Identities = 175/373 (46%), Positives = 232/373 (62%), Gaps = 11/373 (2%) Query: 1 MGFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAE 60 MG GI+GLPNVGKSTLF A T +AAN PF TIEPN+G V DPR+ LA + Sbjct: 1 MGLSGGIVGLPNVGKSTLFAATTNLLGNEAANPPFTTIEPNAGVVNPSDPRLDLLAIYIK 60 Query: 61 SKDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRI 120 + + PT FVDIAGLV GASKGEGLGNQFLA+IREVD I HV+RCF+D+ I HV Sbjct: 61 PEKVPPTTTEFVDIAGLVGGASKGEGLGNQFLANIREVDIIQHVVRCFEDDIIHHVGNVD 120 Query: 121 DPINDIETIETELMLSDLERLERLFEKNKKYRNHK--SEEIVLLQSIISSSLRLIEEGKP 178 DP +D E I+ EL+ +D +E+ ++KK +E +LL II L L+ G+ Sbjct: 121 DPRDDFEIIDEELLKADEFLVEKRIGRSKKSAEGGKDKKEELLLLEII---LPLLNGGQM 177 Query: 179 VRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDC-KKGNIYTEAVQRLASQQNAEM 237 R + L + + + KSLNLLT KPI+ I NVSE N Y V+ +A+ + Sbjct: 178 ARHV--DLSKEELILIKSLNLLTKKPIILIANVSEDYLRNLNNNYLLIVEWIAAYSKGDP 235 Query: 238 III--SAAIEAEISQLPEEERALFMEELDISIS-GLELLIRSGYRLLDLITYFTVGPKET 294 ++ A E+E+S+L +EER F+++L ++ S GL ++IR+ Y+LL L +FT G +E Sbjct: 236 KVVFVCALEESELSELDDEERQEFLQKLGLTESAGLNIIIRARYKLLLLSFFFTGGKEEV 295 Query: 295 RAWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKEAGKARDEGKEYI 354 RAWT G A +AAG+IHTDFE GFI A IS+ D++ AK+ G R EGK Y+ Sbjct: 296 RAWTRKGGWAAPQAAGIIHTDFETGFIAAEVISWDDFIYKKSSQGAKKGGLMRLEGKYYV 355 Query: 355 VKDGDILHFRFNV 367 V DGD+L F FNV Sbjct: 356 VDDGDVLFFAFNV 368 >gnl|CDD|114773 pfam06071, YchF-GTPase_C, Protein of unknown function (DUF933). This domain is found at the C terminus of the YchF GTP-binding protein and is possibly related to the ubiquitin-like and MoaD/ThiS superfamilies. Length = 84 Score = 172 bits (438), Expect = 2e-43 Identities = 60/84 (71%), Positives = 68/84 (80%) Query: 283 LITYFTVGPKETRAWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKE 342 LIT+FT GPKE RAWTI +GT A +AAGVIH+DFEKGFIRA ISY D + G E AKE Sbjct: 1 LITFFTAGPKEVRAWTIRKGTTAPQAAGVIHSDFEKGFIRAEVISYDDLIEYGSEAKAKE 60 Query: 343 AGKARDEGKEYIVKDGDILHFRFN 366 AGK R EGK+YIV+DGDI+HFRFN Sbjct: 61 AGKLRLEGKDYIVQDGDIIHFRFN 84 >gnl|CDD|181982 PRK09602, PRK09602, translation-associated GTPase; Reviewed. Length = 396 Score = 141 bits (359), Expect = 2e-34 Identities = 115/427 (26%), Positives = 182/427 (42%), Gaps = 114/427 (26%) Query: 6 GIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGE--VAVPDPRMHKLAEIAES-- 61 G++G PNVGKST FNA T A + ANYPF TI+PN G V V P K E+ Sbjct: 5 GLVGKPNVGKSTFFNAATL-ADVEIANYPFTTIDPNVGVAYVRVECP--CK--ELGVKCN 59 Query: 62 ---------KDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDEN 112 +P + +D+AGLV GA +G GLGNQFL +R+ DA+IHV+ + Sbjct: 60 PRNGKCIDGTRFIPVEL--IDVAGLVPGAHEGRGLGNQFLDDLRQADALIHVVDASGSTD 117 Query: 113 IIHVEGRI------DPINDIETIETEL---MLSDLERLERLFEKNKKYRNHKSEEIVLLQ 163 EG DP+ DI+ +E EL + LE+ K R ++E+ + + Sbjct: 118 E---EGNPVEPGSHDPVEDIKFLEEELDMWIYGILEK-----NWEKFSRKAQAEKFDIEE 169 Query: 164 SIIS--SSLRLIEEGKPVRSLLESLDSDAIPI---------FKSLNLLTAKPILYICNVS 212 ++ S L + EE V+ L L P +KP++ N + Sbjct: 170 ALAEQLSGLGINEE--HVKEALRELGLPEDPSKWTDEDLLELARELRKISKPMVIAANKA 227 Query: 213 EHDCKKGNIYTEAVQRLASQQNAEMIIISAAIE------AE---ISQLP----------- 252 + + NI +RL ++ ++ SA E A+ I +P Sbjct: 228 DLPPAEENI-----ERLKEEKYYIVVPTSAEAELALRRAAKAGLIDYIPGDSDFEILGEL 282 Query: 253 --EEERAL-----FMEELDISISGLELLIRSGYRLLDLITYFTVGPKETRAWT------- 298 ++++AL +++ E + + + LLD+I + V E + T Sbjct: 283 SEKQKKALEYIREVLKKYG-GTGVQEAINTAVFDLLDMIVVYPVE-DENK-LTDKKGNVL 339 Query: 299 -----IPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAAKEAGKARDEGKEY 353 +P+G+ A+ A IHTD +GF+ A+ +A R G++Y Sbjct: 340 PDAFLLPKGSTARDLAYKIHTDIGEGFLYAI-----------------DARTKRRIGEDY 382 Query: 354 IVKDGDI 360 +KDGD+ Sbjct: 383 ELKDGDV 389 >gnl|CDD|183415 PRK12297, obgE, GTPase CgtA; Reviewed. Length = 424 Score = 108 bits (273), Expect = 2e-24 Identities = 59/140 (42%), Positives = 74/140 (52%), Gaps = 28/140 (20%) Query: 6 GIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLV 65 G++G PNVGKSTL + ++ A + ANY F T+ PN G V D R Sbjct: 162 GLVGFPNVGKSTLLSVVSN-AKPKIANYHFTTLVPNLGVVETDDGR-------------- 206 Query: 66 PTRMSFV--DIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPI 123 SFV DI GL+ GAS+G GLG+QFL HI I+HV+ ++ EGR DPI Sbjct: 207 ----SFVMADIPGLIEGASEGVGLGHQFLRHIERTRVIVHVI------DMSGSEGR-DPI 255 Query: 124 NDIETIETELMLSDLERLER 143 D E I EL L + LER Sbjct: 256 EDYEKINKELKLYNPRLLER 275 >gnl|CDD|162989 TIGR02729, Obg_CgtA, Obg family GTPase CgtA. This model describes a univeral, mostly one-gene-per-genome GTP-binding protein that associates with ribosomal subunits and appears to play a role in ribosomal RNA maturation. This GTPase, related to the nucleolar protein Obg, is designated CgtA in bacteria. Mutations in this gene are pleiotropic, but it appears that effects on cellular functions such as chromosome partition may be secondary to the effect on ribosome structure. Recent work done in Vibrio cholerae shows an essential role in the stringent response, in which RelA-dependent ability to synthesize the alarmone ppGpp is required for deletion of this GTPase to be lethal. Length = 329 Score = 102 bits (258), Expect = 1e-22 Identities = 60/175 (34%), Positives = 84/175 (48%), Gaps = 44/175 (25%) Query: 6 GIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLV 65 G++GLPN GKSTL +A++ A + A+YPF T+ PN G V V D R Sbjct: 161 GLVGLPNAGKSTLISAVSA-AKPKIADYPFTTLVPNLGVVRVDDGR-------------- 205 Query: 66 PTRMSFV--DIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPI 123 SFV DI GL+ GAS+G GLG++FL HI ++H++ +I ++GR DPI Sbjct: 206 ----SFVIADIPGLIEGASEGAGLGHRFLKHIERTRVLLHLI------DISPLDGR-DPI 254 Query: 124 NDIETIETELML----------------SDLERLERLFEKNKKYRNHKSEEIVLL 162 D E I EL DL E L E K+ + + + + Sbjct: 255 EDYEIIRNELKKYSPELAEKPRIVVLNKIDLLDEEELAELLKELKKALGKPVFPI 309 >gnl|CDD|183417 PRK12299, obgE, GTPase CgtA; Reviewed. Length = 335 Score = 93.6 bits (234), Expect = 8e-20 Identities = 49/128 (38%), Positives = 68/128 (53%), Gaps = 27/128 (21%) Query: 6 GIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLV 65 G++GLPN GKSTL +A++ A + A+YPF T+ PN G V V D K V Sbjct: 162 GLVGLPNAGKSTLISAVSA-AKPKIADYPFTTLHPNLGVVRVDD-----------YKSFV 209 Query: 66 PTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPIND 125 DI GL+ GAS+G GLG++FL HI ++H++ D +DP+ D Sbjct: 210 -----IADIPGLIEGASEGAGLGHRFLKHIERTRLLLHLV----D------IEAVDPVED 254 Query: 126 IETIETEL 133 +TI EL Sbjct: 255 YKTIRNEL 262 >gnl|CDD|183414 PRK12296, obgE, GTPase CgtA; Reviewed. Length = 500 Score = 91.9 bits (229), Expect = 3e-19 Identities = 49/128 (38%), Positives = 70/128 (54%), Gaps = 24/128 (18%) Query: 6 GIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLV 65 G++G P+ GKS+L +AL+ A + A+YPF T+ PN G V D Sbjct: 163 GLVGFPSAGKSSLISALSA-AKPKIADYPFTTLVPNLGVVQAGD---------------- 205 Query: 66 PTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPIND 125 TR + D+ GL+ GAS+G+GLG FL HI ++HV+ C E GR DP++D Sbjct: 206 -TRFTVADVPGLIPGASEGKGLGLDFLRHIERCAVLVHVVDCATLE-----PGR-DPLSD 258 Query: 126 IETIETEL 133 I+ +E EL Sbjct: 259 IDALEAEL 266 >gnl|CDD|183416 PRK12298, obgE, GTPase CgtA; Reviewed. Length = 390 Score = 81.8 bits (203), Expect = 2e-16 Identities = 47/131 (35%), Positives = 65/131 (49%), Gaps = 30/131 (22%) Query: 6 GIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLV 65 G++GLPN GKST A++ A + A+YPF T+ PN G V V D R Sbjct: 163 GLLGLPNAGKSTFIRAVSA-AKPKVADYPFTTLVPNLGVVRVDDER-------------- 207 Query: 66 PTRMSFV--DIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFK-DENIIHVEGRIDP 122 SFV DI GL+ GAS+G GLG +FL H+ ++H++ D + DP Sbjct: 208 ----SFVVADIPGLIEGASEGAGLGIRFLKHLERCRVLLHLIDIAPIDGS--------DP 255 Query: 123 INDIETIETEL 133 + + I EL Sbjct: 256 VENARIIINEL 266 >gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability. Length = 429 Score = 47.8 bits (115), Expect = 5e-06 Identities = 16/28 (57%), Positives = 19/28 (67%) Query: 7 IIGLPNVGKSTLFNALTRTASAQAANYP 34 I+G PNVGKSTLFN LT A ++ P Sbjct: 4 IVGRPNVGKSTLFNRLTGKRDAIVSDTP 31 Score = 39.7 bits (94), Expect = 0.001 Identities = 15/23 (65%), Positives = 15/23 (65%) Query: 2 GFKCGIIGLPNVGKSTLFNALTR 24 K IIG PNVGKSTL NAL Sbjct: 172 PIKIAIIGRPNVGKSTLVNALLG 194 >gnl|CDD|178858 PRK00093, PRK00093, GTP-binding protein Der; Reviewed. Length = 435 Score = 45.8 bits (110), Expect = 2e-05 Identities = 17/28 (60%), Positives = 19/28 (67%) Query: 7 IIGLPNVGKSTLFNALTRTASAQAANYP 34 I+G PNVGKSTLFN LT A A+ P Sbjct: 6 IVGRPNVGKSTLFNRLTGKRDAIVADTP 33 Score = 38.9 bits (92), Expect = 0.002 Identities = 14/22 (63%), Positives = 15/22 (68%) Query: 2 GFKCGIIGLPNVGKSTLFNALT 23 K IIG PNVGKS+L NAL Sbjct: 173 PIKIAIIGRPNVGKSSLINALL 194 >gnl|CDD|178854 PRK00089, era, GTPase Era; Reviewed. Length = 292 Score = 45.0 bits (108), Expect = 3e-05 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 3/25 (12%) Query: 1 MGFKCG---IIGLPNVGKSTLFNAL 22 MGFK G I+G PNVGKSTL NAL Sbjct: 1 MGFKSGFVAIVGRPNVGKSTLLNAL 25 >gnl|CDD|161778 TIGR00231, small_GTP, small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model. Length = 161 Score = 43.5 bits (103), Expect = 9e-05 Identities = 24/104 (23%), Positives = 34/104 (32%), Gaps = 16/104 (15%) Query: 3 FKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESK 62 K I+G PNVGKSTL N L P T + + Sbjct: 2 IKIVIVGDPNVGKSTLLNRLLGNKFITEY-KPGTTRNYVTTVIEE--------------- 45 Query: 63 DLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLR 106 D + + +D AG + + +R D +I VL Sbjct: 46 DGKTYKFNLLDTAGQEDYRAIRRLYYRAVESSLRVFDIVILVLD 89 >gnl|CDD|163345 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF. Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members. Length = 276 Score = 42.1 bits (100), Expect = 2e-04 Identities = 15/32 (46%), Positives = 19/32 (59%) Query: 3 FKCGIIGLPNVGKSTLFNALTRTASAQAANYP 34 + I+G+PNVGKSTL N L A+ N P Sbjct: 119 IRAMIVGIPNVGKSTLINRLAGKKVAKVGNRP 150 >gnl|CDD|179996 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed. Length = 449 Score = 41.6 bits (99), Expect = 3e-04 Identities = 14/23 (60%), Positives = 15/23 (65%) Query: 2 GFKCGIIGLPNVGKSTLFNALTR 24 G K I G PNVGKS+L NAL Sbjct: 215 GLKVVIAGRPNVGKSSLLNALLG 237 >gnl|CDD|181957 PRK09563, rbgA, GTPase YlqF; Reviewed. Length = 287 Score = 41.7 bits (99), Expect = 3e-04 Identities = 16/28 (57%), Positives = 18/28 (64%) Query: 7 IIGLPNVGKSTLFNALTRTASAQAANYP 34 IIG+PNVGKSTL N L A+ N P Sbjct: 126 IIGIPNVGKSTLINRLAGKKIAKTGNRP 153 >gnl|CDD|163162 TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). Length = 351 Score = 41.3 bits (98), Expect = 4e-04 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Query: 6 GIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPR 51 ++G N GKSTLFNALT A AA+ F T++P + + +PD Sbjct: 193 ALVGYTNAGKSTLFNALTG-ADVYAADQLFATLDPTTRRLDLPDGG 237 >gnl|CDD|161885 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE. TrmE, also called MnmE and previously designated ThdF (thiophene and furan oxidation protein), is a GTPase involved in tRNA modification to create 5-methylaminomethyl-2-thiouridine in the wobble position of some tRNAs. This protein and GidA form an alpha2/beta2 heterotetramer. Length = 442 Score = 40.5 bits (95), Expect = 6e-04 Identities = 17/36 (47%), Positives = 22/36 (61%) Query: 2 GFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCT 37 GFK I+G PNVGKS+L NAL + A ++ T Sbjct: 203 GFKLAIVGSPNVGKSSLLNALLKQDRAIVSDIKGTT 238 >gnl|CDD|161878 TIGR00437, feoB, ferrous iron transporter FeoB. FeoB (773 amino acids in E. coli), a cytoplasmic membrane protein required for iron(II) update, is encoded in an operon with FeoA (75 amino acids), which is also required, and is regulated by Fur. There appear to be two copies in Archaeoglobus fulgidus and Clostridium acetobutylicum. Length = 591 Score = 40.1 bits (94), Expect = 8e-04 Identities = 20/37 (54%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Query: 9 GLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEV 45 G PNVGKSTLFNALT A+ N+P T+E G++ Sbjct: 1 GNPNVGKSTLFNALTG-ANQTVGNWPGVTVEKKEGKL 36 >gnl|CDD|181948 PRK09554, feoB, ferrous iron transport protein B; Reviewed. Length = 772 Score = 39.3 bits (92), Expect = 0.002 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Query: 6 GIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPD 49 G+IG PN GK+TLFN LT A + N+ T+E G+ + D Sbjct: 7 GLIGNPNSGKTTLFNQLT-GARQRVGNWAGVTVERKEGQFSTTD 49 >gnl|CDD|182934 PRK11058, PRK11058, GTPase HflX; Provisional. Length = 426 Score = 35.1 bits (81), Expect = 0.027 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Query: 7 IIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPD 49 ++G N GKSTLFN +T A AA+ F T++P + V D Sbjct: 202 LVGYTNAGKSTLFNRIT-EARVYAADQLFATLDPTLRRIDVAD 243 >gnl|CDD|181925 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed. Length = 712 Score = 34.0 bits (78), Expect = 0.068 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 19/95 (20%) Query: 7 IIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLVP 66 ++G PNVGKS+L N LT A + T +P + ++ EI L Sbjct: 455 LVGRPNVGKSSLLNQLTHEERAVVNDLAGTTRDP-----------VDEIVEIDGEDWL-- 501 Query: 67 TRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAI 101 F+D AG+ R K G ++ + +R AI Sbjct: 502 ----FIDTAGIKRRQHKLT--GAEYYSSLRTQAAI 530 Score = 29.8 bits (67), Expect = 1.1 Identities = 11/14 (78%), Positives = 12/14 (85%) Query: 7 IIGLPNVGKSTLFN 20 I+G PNVGKSTL N Sbjct: 280 IVGRPNVGKSTLVN 293 >gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era. Era is an essential GTPase in Escherichia coli and many other bacteria. It plays a role in ribosome biogenesis. Few bacteria lack this protein. Length = 270 Score = 32.4 bits (74), Expect = 0.19 Identities = 12/17 (70%), Positives = 13/17 (76%) Query: 6 GIIGLPNVGKSTLFNAL 22 I+G PNVGKSTL N L Sbjct: 4 AILGRPNVGKSTLLNQL 20 >gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed. Length = 472 Score = 31.1 bits (71), Expect = 0.50 Identities = 10/14 (71%), Positives = 12/14 (85%) Query: 7 IIGLPNVGKSTLFN 20 ++G PNVGKSTL N Sbjct: 43 VVGRPNVGKSTLVN 56 Score = 30.3 bits (69), Expect = 0.77 Identities = 10/17 (58%), Positives = 13/17 (76%) Query: 7 IIGLPNVGKSTLFNALT 23 ++G PNVGKS+L N L Sbjct: 216 LVGKPNVGKSSLLNKLA 232 >gnl|CDD|183324 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed. Length = 556 Score = 30.5 bits (70), Expect = 0.69 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Query: 6 GIIGLPN-VGKSTLFNALT 23 GIIG PN GKSTLF +T Sbjct: 354 GIIG-PNGAGKSTLFKMIT 371 >gnl|CDD|179035 PRK00454, engB, GTP-binding protein YsxC; Reviewed. Length = 196 Score = 30.1 bits (69), Expect = 1.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Query: 12 NVGKSTLFNALT 23 NVGKS+L NALT Sbjct: 34 NVGKSSLINALT 45 >gnl|CDD|151741 pfam11300, DUF3102, Protein of unknown function (DUF3102). This family of proteins has no known function. Length = 130 Score = 29.7 bits (67), Expect = 1.3 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Query: 251 LPEEERALFMEELDI-SISGLEL 272 +PEEER F+ E D+ S+S EL Sbjct: 101 VPEEEREQFIAENDVESMSTREL 123 >gnl|CDD|178676 PLN03130, PLN03130, ABC transporter C family member; Provisional. Length = 1622 Score = 29.3 bits (66), Expect = 1.4 Identities = 13/46 (28%), Positives = 19/46 (41%), Gaps = 12/46 (26%) Query: 4 KCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPD 49 K GI+G GKS++ NAL R +E G + + Sbjct: 1267 KVGIVGRTGAGKSSMLNALFR------------IVELERGRILIDG 1300 >gnl|CDD|163346 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes. Length = 179 Score = 29.4 bits (67), Expect = 1.6 Identities = 10/13 (76%), Positives = 11/13 (84%) Query: 12 NVGKSTLFNALTR 24 NVGKS+L NALT Sbjct: 28 NVGKSSLINALTN 40 >gnl|CDD|132636 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH. This family describes YqeH, a member of a larger family of GTPases involved in ribosome biogenesis. Like YqlF, it shows a cyclical permutation relative to GTPases EngA (in which the GTPase domain is duplicated), Era, and others. Members of this protein family are found in a relatively small number of bacterial species, including Bacillus subtilis but not Escherichia coli. Length = 360 Score = 29.1 bits (66), Expect = 1.8 Identities = 9/16 (56%), Positives = 13/16 (81%) Query: 7 IIGLPNVGKSTLFNAL 22 ++G+ NVGKS+L N L Sbjct: 159 VVGVTNVGKSSLINKL 174 >gnl|CDD|152367 pfam11932, DUF3450, Protein of unknown function (DUF3450). This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are about 260 amino acids in length. Length = 250 Score = 29.1 bits (66), Expect = 2.0 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 9/58 (15%) Query: 221 IYTEAVQRLASQQNAEMIIISAAIEAEISQLPEEERAL--FMEELDISISGLELLIRS 276 +Y + +QRL + Q E+ A+++ +I Q+ + + L M + I GLE + Sbjct: 71 VYNDQLQRLVANQQQEI----ASLQQQIEQIEKTRQGLVPLMYRM---IDGLEQFVAL 121 >gnl|CDD|180753 PRK06924, PRK06924, short chain dehydrogenase; Provisional. Length = 251 Score = 28.9 bits (65), Expect = 2.1 Identities = 14/73 (19%), Positives = 29/73 (39%), Gaps = 10/73 (13%) Query: 77 LVRGASKG--EGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRIDPINDIETIETELM 134 ++ G S+G E + NQ L E + + +++ + ++ + L Sbjct: 5 IITGTSQGLGEAIANQLL----EKGTHVISISRTENKELT----KLAEQYNSNLTFHSLD 56 Query: 135 LSDLERLERLFEK 147 L D+ LE F + Sbjct: 57 LQDVHELETNFNE 69 >gnl|CDD|185452 PTZ00109, PTZ00109, DNA gyrase subunit b; Provisional. Length = 903 Score = 29.1 bits (65), Expect = 2.1 Identities = 11/60 (18%), Positives = 22/60 (36%), Gaps = 12/60 (20%) Query: 180 RSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIYTEAVQRLASQQNAEMII 239 R LE L D P++K +N+++ + N+ E + + +I Sbjct: 378 REFLEELIKDKTPLYKDINIISIR------------GVIKNVNVEVSLSWSLESYTALIK 425 >gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family. Members of this protein family have two copies of the ABC transporter ATP-binding cassette, but are found outside the common ABC transporter operon structure that features integral membrane permease proteins and substrate-binding proteins encoded next to the ATP-binding cassette (ABC domain) protein. The member protein ChvD from Agrobacterium tumefaciens was identified as both a candidate to interact with VirB8, based on yeast two-hybrid analysis, and as an apparent regulator of VirG. The general function of this protein family is unknown. Length = 552 Score = 28.7 bits (65), Expect = 2.6 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 17/73 (23%) Query: 6 GIIGLPN-VGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKD- 63 G+IG PN GKSTLF +T +P+SG + + + KLA + +S+D Sbjct: 352 GVIG-PNGAGKSTLFRMITGQE------------QPDSGTIKIGETV--KLAYVDQSRDA 396 Query: 64 LVPTRMSFVDIAG 76 L P + + +I+G Sbjct: 397 LDPNKTVWEEISG 409 >gnl|CDD|184332 PRK13796, PRK13796, GTPase YqeH; Provisional. Length = 365 Score = 28.7 bits (65), Expect = 2.6 Identities = 9/16 (56%), Positives = 13/16 (81%) Query: 7 IIGLPNVGKSTLFNAL 22 ++G+ NVGKSTL N + Sbjct: 165 VVGVTNVGKSTLINRI 180 >gnl|CDD|180287 PRK05849, PRK05849, hypothetical protein; Provisional. Length = 783 Score = 28.0 bits (63), Expect = 4.3 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 7/54 (12%) Query: 124 NDIETIETELMLSDLERLERLFEKNKKYRNHKSEEIVLLQSIISSSLRLIEEGK 177 N I + ++ L DLE++E+L ++Y+ + + L I L+E+ K Sbjct: 399 NRIISPKSGLFRKDLEKIEKL---EERYKELLNSNLDPLDKI----YWLLEDCK 445 >gnl|CDD|162666 TIGR02027, rpoA, DNA-directed RNA polymerase, alpha subunit, bacterial and chloroplast-type. This family consists of the bacterial (and chloroplast) DNA-directed RNA polymerase alpha subunit, encoded by the rpoA gene. The RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. The amino terminal domain is involved in dimerizing and assembling the other RNA polymerase subunits into a transcriptionally active enzyme. The carboxy-terminal domain contains determinants for interaction with DNA and with transcriptional activator proteins. Length = 297 Score = 28.0 bits (63), Expect = 4.3 Identities = 15/53 (28%), Positives = 21/53 (39%) Query: 224 EAVQRLASQQNAEMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRS 276 EA + L + + E Q EEE + L I I L+L +RS Sbjct: 194 EAAKILIEHLEPFVNLDEEIEAFEEEQEEEEEELEDAKLLSIKIEELDLSVRS 246 >gnl|CDD|181855 PRK09435, PRK09435, membrane ATPase/protein kinase; Provisional. Length = 332 Score = 27.9 bits (63), Expect = 4.5 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 6 GIIGLPNVGKSTLFNAL 22 GI G+P VGKST AL Sbjct: 60 GITGVPGVGKSTFIEAL 76 >gnl|CDD|182558 PRK10572, PRK10572, DNA-binding transcriptional regulator AraC; Provisional. Length = 290 Score = 27.6 bits (62), Expect = 5.0 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 14/46 (30%) Query: 318 KGFIRALTISYKDYVAMGGENAAKEAGKARDEGKEYIVKDGDILHF 363 KG+I LTI G+ G + G+ ++ + GD+L F Sbjct: 48 KGYILNLTIR--------GQ------GVIFNGGRAFVCRPGDLLLF 79 >gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional. Length = 258 Score = 27.6 bits (62), Expect = 5.3 Identities = 32/106 (30%), Positives = 48/106 (45%), Gaps = 26/106 (24%) Query: 6 GIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEV--AVPDPRMHKLAEIAESKD 63 GI+G GK+TL NAL SA+ A P++GEV + D ++ L ++E++ Sbjct: 36 GIVGESGSGKTTLLNAL----SARLA--------PDAGEVHYRMRDGQLRDLYALSEAER 83 Query: 64 --LVPTRMSFVD---IAGLVRGASKGEGLGNQFLA-------HIRE 97 L+ T FV GL S G +G + +A IR Sbjct: 84 RRLLRTEWGFVHQHPRDGLRMQVSAGGNIGERLMAVGARHYGDIRA 129 >gnl|CDD|181623 PRK09047, PRK09047, RNA polymerase factor sigma-70; Validated. Length = 161 Score = 27.6 bits (62), Expect = 5.8 Identities = 10/41 (24%), Positives = 21/41 (51%), Gaps = 7/41 (17%) Query: 230 ASQQNAEMIIISAAIEAEISQLPEEERALFM----EELDIS 266 + A+++ IE I +LP +R F+ E++D++ Sbjct: 89 DKLERAQVL---QLIEEAIQKLPARQREAFLLRYWEDMDVA 126 >gnl|CDD|182605 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional. Length = 638 Score = 27.4 bits (61), Expect = 5.8 Identities = 14/34 (41%), Positives = 17/34 (50%) Query: 2 GFKCGIIGLPNVGKSTLFNALTRTASAQAANYPF 35 G K G++G GKSTL L SA +Y F Sbjct: 27 GQKVGLVGKNGCGKSTLLALLKNEISADGGSYTF 60 >gnl|CDD|149105 pfam07851, TMPIT, TMPIT-like protein. A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this. Length = 330 Score = 27.4 bits (61), Expect = 6.0 Identities = 13/45 (28%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Query: 142 ERLFEKNKKYRNHKSEEIVLLQSIISSSLRLIEEGKPVRSLLESL 186 ++L E ++ Y+ K EE+ LQ +S++ + K ++ L+ SL Sbjct: 14 QQLQETHRLYK-QKLEEVEKLQEQCTSAIA--RQRKRLKQLIVSL 55 >gnl|CDD|162913 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase. Length = 422 Score = 27.3 bits (61), Expect = 6.3 Identities = 13/28 (46%), Positives = 15/28 (53%) Query: 1 MGFKCGIIGLPNVGKSTLFNALTRTASA 28 G + GI VGKSTL + R ASA Sbjct: 144 EGQRIGIFAGAGVGKSTLLGMIARGASA 171 >gnl|CDD|183825 PRK12903, secA, preprotein translocase subunit SecA; Reviewed. Length = 925 Score = 27.3 bits (61), Expect = 6.3 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Query: 338 NAAKEAGKARDEGKEYIVKDGDIL 361 NA + A K E EYIV+DG I Sbjct: 289 NALR-AHKVMKEDVEYIVRDGKIE 311 >gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional. Length = 201 Score = 27.2 bits (61), Expect = 6.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 7 IIGLPNVGKSTLFNALT 23 +G NVGKSTL LT Sbjct: 14 FVGRSNVGKSTLVRELT 30 >gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed. Length = 451 Score = 27.2 bits (61), Expect = 7.2 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 18/62 (29%) Query: 65 VPTRMSFV---DIAGLVRGASKGEGLGNQFLAHIREVDAIIHVLRCFKDENIIHVEGRID 121 +PT+M FV D+A +R A++ LG A + V V R F GRID Sbjct: 43 IPTKM-FVYAADVARTIREAAR---LGVD--AELDGVRWPDIVSRVF---------GRID 87 Query: 122 PI 123 PI Sbjct: 88 PI 89 >gnl|CDD|129833 TIGR00750, lao, LAO/AO transport system ATPase. Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however. Length = 300 Score = 27.0 bits (60), Expect = 7.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Query: 6 GIIGLPNVGKSTLFNALT 23 GI G P GKSTL AL Sbjct: 38 GITGTPGAGKSTLLEALG 55 >gnl|CDD|162807 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se. Length = 253 Score = 27.1 bits (60), Expect = 7.4 Identities = 26/91 (28%), Positives = 37/91 (40%), Gaps = 11/91 (12%) Query: 6 GIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAESKDLV 65 GI+G GKSTL L + T SG +++L+E AE + L+ Sbjct: 33 GIVGESGSGKSTLLGCLAGRLAPDHGT---ATYIMRSGAEL----ELYQLSE-AERRRLM 84 Query: 66 PTRMSFVD---IAGLVRGASKGEGLGNQFLA 93 T FV GL S G +G + +A Sbjct: 85 RTEWGFVHQNPRDGLRMRVSAGANIGERLMA 115 >gnl|CDD|178224 PLN02615, PLN02615, arginase. Length = 338 Score = 26.7 bits (59), Expect = 8.6 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 6/69 (8%) Query: 162 LQSIISSSLRLIEEGKPVRSLLESLD-SDAIPIFKSLNLLTAKPILYICNVSEH----DC 216 L ++IS S++L+ E +P+R L+ D S + P+ ++++ P+ I ++ H Sbjct: 131 LMNVISESVKLVMEEEPLRPLVLGGDHSISYPVVRAVSEKLGGPV-DILHLDAHPDIYHA 189 Query: 217 KKGNIYTEA 225 +GN Y+ A Sbjct: 190 FEGNKYSHA 198 >gnl|CDD|183003 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed. Length = 574 Score = 26.7 bits (60), Expect = 9.0 Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 15/60 (25%) Query: 2 GFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEVAVPDPRMHKLAEIAES 61 G K ++G GKSTL LTR + +P GE+ + +A+ +E+ Sbjct: 366 GEKVALLGRTGCGKSTLLQLLTR-------AW-----DPQQGEILLNG---QPIADYSEA 410 >gnl|CDD|179225 PRK01112, PRK01112, phosphoglyceromutase; Provisional. Length = 228 Score = 27.0 bits (60), Expect = 9.1 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 15/50 (30%) Query: 170 LRLIEEGKPV---------RSL---LESLDSDAIPIFKSLNLLTAKPILY 207 L +++GK V RSL LE L + + SL L T KPI+Y Sbjct: 167 LPHLQQGKNVFVSAHGNSLRSLIMDLEKLSEEEVL---SLELPTGKPIVY 213 >gnl|CDD|163576 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification. Length = 236 Score = 26.9 bits (60), Expect = 9.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Query: 5 CGIIGLPNVGKSTLFNALTRTASAQA 30 ++G GKSTLF+ LTR AQ Sbjct: 30 VALLGPNGAGKSTLFSLLTRLYVAQE 55 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0738 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 6,022,540 Number of extensions: 400859 Number of successful extensions: 1227 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1196 Number of HSP's successfully gapped: 80 Length of query: 367 Length of database: 5,994,473 Length adjustment: 95 Effective length of query: 272 Effective length of database: 3,941,713 Effective search space: 1072145936 Effective search space used: 1072145936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 58 (26.1 bits)