HHsearch alignment for GI: 254780228 and conserved domain: PRK10739

>PRK10739 putative dITP- and XTP- hydrolase; Provisional.
Probab=94.52  E-value=0.32  Score=26.06  Aligned_cols=83  Identities=18%  Similarity=0.244  Sum_probs=63.7

Q ss_pred             HHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCHHHHHHHHHHCHHH
Q ss_conf             99869899999999862999999899999999999999999999999998420068998874025014667776411289
Q gi|254780228|r   57 ISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPI  136 (346)
Q Consensus        57 ~sLSvDNafV~a~If~~fp~~~q~rvL~~GIlgAvf~mR~iF~~liv~~~~~~~~~~~~~la~~~~~~y~~~l~~~~~~I  136 (346)
T Consensus        14 iinPig~~PiFlslt~~~~~~~r~~ia~~a~~~a~-~il~~F~~~G~~il~~fg--------------------Isi~af   72 (197)
T PRK10739         14 IMDPLGNLPIFMSVLKHLEPKRRRAIMIRELLIAL-LVMLVFLFAGEKILAFLN--------------------LRAETV   72 (197)
T ss_pred             HHCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHC--------------------CCHHHH
T ss_conf             97621069999998479999999999999999999-999999998999999949--------------------988999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             999999999999998511554442
Q gi|254780228|r  137 SGFGGTFLMMVSLTFFFNSQNKLH  160 (346)
Q Consensus       137 ~~~gG~fLl~~~lk~~~~~~~e~~  160 (346)
T Consensus        73 rIaGGilL~~ia~~Ml~~~~~~~~   96 (197)
T PRK10739         73 SISGGIILFLIAIKMIFPSAEGNS   96 (197)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             998789999999998626665665