HHsearch alignment for GI: 254780228 and conserved domain: pfam03741

>pfam03741 TerC Integral membrane protein TerC family. This family contains a number of integral membrane proteins that also contains the TerC protein. TerC has been implicated in resistance to tellurium. This protein may be involved in efflux of tellurium ions. The tellurite-resistant Escherichia coli strain KL53 was found during testing of the group of clinical isolates for antibiotics and heavy metal ion resistance. Determinant of the tellurite resistance of the strain was located on a large conjugative plasmid. Analyses showed, the genes terB, terC, terD and terE are essential for conservation of the resistance. The members of the family contain a number of conserved aspartates that could be involved in binding to metal ions.
Probab=100.00  E-value=2.4e-44  Score=293.91  Aligned_cols=181  Identities=23%  Similarity=0.315  Sum_probs=156.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCHHHHHHHHH
Q ss_conf             99999998698999999998629999998999999999999999999999999984200689988740250146677764
Q gi|254780228|r   52 LAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ  131 (346)
Q Consensus        52 L~vLE~sLSvDNafV~a~If~~fp~~~q~rvL~~GIlgAvf~mR~iF~~liv~~~~~~~~~~~~~la~~~~~~y~~~l~~  131 (346)
T Consensus         3 l~~lE~vLs~DN~ivial~~~~lP~~~r~~al~~Gi~~A~-v~R~i~i~~~~~ll------------------------~   57 (184)
T pfam03741         3 LYLLEISLSVDNAFVIALIFRKLPPEQQKKALFWGIIGAL-VLRIILILLGSALL------------------------E   57 (184)
T ss_pred             EHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHH------------------------H
T ss_conf             0265599885499999999804899999999999999999-99999999999999------------------------9


Q ss_pred             HCHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCHHH
Q ss_conf             11289999999999999998511554442001344455552121101367899987653202376640101000000124
Q gi|254780228|r  132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAII  211 (346)
Q Consensus       132 ~~~~I~~~gG~fLl~~~lk~~~~~~~e~~w~~~~E~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  211 (346)
T Consensus        58 ~~~~l~~igg~~Li~~~~k~~~~~~~~~~~-~~~~~--------------------------------------------   92 (184)
T pfam03741        58 LFDWILLIGGAFLLYTAIKLLRENEEDDEE-NKIVR--------------------------------------------   92 (184)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCC-CHHHH--------------------------------------------
T ss_conf             707999999999999999998732344320-02345--------------------------------------------


Q ss_pred             HHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             33210001110355443431123469999999999887875411134552132099999999999999999999999987
Q gi|254780228|r  212 IFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG  291 (346)
Q Consensus       212 ~~~~~~~~~~~~~~~~~~~~~~~tpl~~~li~IE~~D~~FA~DSVpAafAIT~dpfIV~~g~~~gilglRslt~yFv~~g  291 (346)
T Consensus        93 -------------~~~~~~~~~~~~~~~av~~I~~~DlvFSlDSV~aa~g~t~~~~ii~~~~i~si~~m~~~--~~~~~~  157 (184)
T pfam03741        93 -------------ELKKVLPVTSSSLWLAVIQIELADLVFSLDSVPAAVGITDDPFIVITGNIFAILGLRFL--AFLLAK  157 (184)
T ss_pred             -------------HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH--HHHHHH
T ss_conf             -------------44301565403799999999999999876289999998135599999999999999999--999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99861002478999999999999984
Q gi|254780228|r  292 ILNKYKYLEHGSYYSIFVLSVIMFLQ  317 (346)
Q Consensus       292 ~l~~f~yLe~ga~~~l~~igvkmll~  317 (346)
T Consensus       158 ~i~~~~~l~~~~~~~L~~ig~kLi~e  183 (184)
T pfam03741       158 LIERFPYLKYLAAAILGFIGVKLLLE  183 (184)
T ss_pred             HHHHCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99987699999999999999999608