BLAST/PSIBLAST alignment of GI: 254780228 and GI: 150376529 at iteration 1
>gi|150376529|ref|YP_001313125.1| hypothetical protein Smed_4388 [Sinorhizobium medicae WSM419] Length = 365
>gi|150031076|gb|ABR63192.1| protein of unknown function DUF475 [Sinorhizobium medicae WSM419] Length = 365
 Score =  355 bits (912), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 169/345 (48%), Positives = 246/345 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M   S   S + +F+WA +VT AG L G  +GWQ T TL G ++  +IC +LAV+EISLS
Sbjct: 1   MTGGSTQTSSLGYFKWAFIVTGAGLLLGAWLGWQSTGTLGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I ++I PIEA+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAASIGPIEAVILAAT 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 QPEEYSRIMHEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L  +E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSKLLEADEAVVFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++  L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKKTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSV+M+ QT+V IPE+ TG     LI LS++SS+++
Sbjct: 301 HGAFYAILILSVVMYFQTLVHIPEVITGLGGAGLIGLSLWSSVRH 345