BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780228|ref|YP_003064641.1| hypothetical protein
CLIBASIA_00565 [Candidatus Liberibacter asiaticus str. psy62]
         (346 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780228|ref|YP_003064641.1| hypothetical protein CLIBASIA_00565 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039905|gb|ACT56701.1| hypothetical protein CLIBASIA_00565 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 346

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/346 (100%), Positives = 346/346 (100%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS
Sbjct: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY
Sbjct: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
           SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI
Sbjct: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
           FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL
Sbjct: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE
Sbjct: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK
Sbjct: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346


>gi|315122332|ref|YP_004062821.1| hypothetical protein CKC_02920 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495734|gb|ADR52333.1| hypothetical protein CKC_02920 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 384

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 249/347 (71%), Positives = 300/347 (86%), Gaps = 1/347 (0%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           MK N     +IHHFRWAILVT+ G L  +GIGW+ +HTLSGT   +YICIILA++EISLS
Sbjct: 1   MKINPFQIDIIHHFRWAILVTIIGILLSIGIGWETSHTLSGTSEILYICIILAIIEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
            +NAILNAKN+QKMS +WQ+RFLTWGI+IAVFGMRI+FPI+IVCIV+TINPIEA+ +AI+
Sbjct: 61  CDNAILNAKNIQKMSPLWQRRFLTWGIVIAVFGMRIVFPIIIVCIVATINPIEAVKIAIF 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
           SPQDYLKIIS AH+PI+GFGGTFLMMVSLTFFFN    +HWI+FLEI MS+LS+I+GIK 
Sbjct: 121 SPQDYLKIISDAHIPIAGFGGTFLMMVSLTFFFNRNKNIHWINFLEIPMSYLSRIRGIKF 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS-SNNVTHGKHGLN 239
           F+VL +I GIS IL   ++Y  + SST A++ FY INFLES+LS D+ + +V   KHGL+
Sbjct: 181 FLVLLLIIGISCILSIRDIYILIFSSTFALMTFYAINFLESILSGDNQTKSVAQKKHGLS 240

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
           LFLYLEIIDASLS DGVISSFAITKNFFII+IGLTIGA+YVRSMT+LMLK+G+L KYKYL
Sbjct: 241 LFLYLEIIDASLSFDGVISSFAITKNFFIIIIGLTIGAVYVRSMTVLMLKKGMLQKYKYL 300

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           EHGS+YSIFVLS++MFLQT++++PEIFTGTSS +LI LSIYSSIKN 
Sbjct: 301 EHGSFYSIFVLSIVMFLQTVINVPEIFTGTSSVLLIILSIYSSIKND 347


>gi|222107044|ref|YP_002547835.1| hypothetical protein Avi_6115 [Agrobacterium vitis S4]
 gi|221738223|gb|ACM39119.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 353

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 242/339 (71%), Gaps = 1/339 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S++ +F+WA +VT+AG   G  +GW  T TL G  S  +IC +LAV+EISLSF+NAI+NA
Sbjct: 9   SVLSYFKWAFIVTIAGLALGAWLGWNMTGTLGGMASVFFICAVLAVLEISLSFDNAIVNA 68

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M+ +WQ+RFLTWGILIAVFGMRIIFP+ IV I + I PIEA+ LA   P +Y +I
Sbjct: 69  NKLKEMTPVWQQRFLTWGILIAVFGMRIIFPLAIVAIAAQIGPIEALKLAAAEPAEYARI 128

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +++AH+PI+ FGGTFLMMV L +FF+ +  +HWI F+E  M+  + IKGI++  VL +I 
Sbjct: 129 MNEAHLPIAAFGGTFLMMVGLNYFFDQEKDVHWIAFIEKHMARYASIKGIEVAFVLVLIL 188

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
             S+ L   E  +F+ S+   ++ F  +  +  +L +         K GL  F+YLE++D
Sbjct: 189 LFSSFLEGAEAITFLYSAIYGLLTFLAVELVGGLLDASQQTMSAAAKGGLGAFIYLEVLD 248

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T+N F+I IGL +GA+YVRSMT++++++G L +Y+YLEHG++Y+I 
Sbjct: 249 ASFSFDGVIGAFALTQNLFVIAIGLGVGAMYVRSMTIMLVEKGTLAEYRYLEHGAFYAIL 308

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK-NK 346
           +LSVIM+ QT+V IPE+ TG     LI +S++SSI+ NK
Sbjct: 309 ILSVIMYCQTLVHIPEVITGLGGAALIGISLWSSIRYNK 347


>gi|150376529|ref|YP_001313125.1| hypothetical protein Smed_4388 [Sinorhizobium medicae WSM419]
 gi|150031076|gb|ABR63192.1| protein of unknown function DUF475 [Sinorhizobium medicae WSM419]
          Length = 365

 Score =  355 bits (912), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 169/345 (48%), Positives = 246/345 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M   S   S + +F+WA +VT AG L G  +GWQ T TL G ++  +IC +LAV+EISLS
Sbjct: 1   MTGGSTQTSSLGYFKWAFIVTGAGLLLGAWLGWQSTGTLGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I ++I PIEA+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAASIGPIEAVILAAT 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 QPEEYSRIMHEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L  +E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSKLLEADEAVVFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++  L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKKTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSV+M+ QT+V IPE+ TG     LI LS++SS+++
Sbjct: 301 HGAFYAILILSVVMYFQTLVHIPEVITGLGGAGLIGLSLWSSVRH 345


>gi|84499490|ref|ZP_00997778.1| hypothetical protein OB2597_06165 [Oceanicola batsensis HTCC2597]
 gi|84392634|gb|EAQ04845.1| hypothetical protein OB2597_06165 [Oceanicola batsensis HTCC2597]
          Length = 357

 Score =  352 bits (902), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 160/334 (47%), Positives = 244/334 (73%), Gaps = 1/334 (0%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           I +F WA  VT AG + G  +GW  + T+ GT++  +IC +LAV+EISLSF+NAI+NA  
Sbjct: 18  ISYFFWAFAVTAAGLILGGWLGWAGSRTVEGTLTIFFICAVLAVLEISLSFDNAIVNANK 77

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ MS +WQ+RFLTWGILIAVFGMRI+FP++IV + + I P+EA+ LA   P+ Y +I+ 
Sbjct: 78  LKDMSPVWQRRFLTWGILIAVFGMRIVFPLLIVVVAADIGPVEAIRLAASEPEAYARIMH 137

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +AH+ I+ FGGTFLMMV L FFF+ +  +HW+ +LE  ++  + +KGI+I +VL ++  I
Sbjct: 138 EAHLSIAAFGGTFLMMVGLGFFFDHEKDIHWVRWLEERIARYASVKGIEIALVLGVVMAI 197

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           S +   ++ +SF+ S+   +I F  +  L  +L  + +   T  + GL  FLYLE++DAS
Sbjct: 198 SQLHGGDKGHSFLVSAIWGLITFLAVEVLGGILDRNEAMK-TGAQGGLGAFLYLEVLDAS 256

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L++Y+YLEHG++Y+I +L
Sbjct: 257 FSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLSQYRYLEHGAFYAITIL 316

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +VIMFLQ+ V+IPE+ TG    +LI ++++SSI+
Sbjct: 317 AVIMFLQSFVEIPEVITGLGGALLIGVALWSSIR 350


>gi|227820093|ref|YP_002824064.1| hypothetical protein NGR_b18640 [Sinorhizobium fredii NGR234]
 gi|227339092|gb|ACP23311.1| integral membrane protein [Sinorhizobium fredii NGR234]
          Length = 362

 Score =  351 bits (900), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 165/346 (47%), Positives = 246/346 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +   +S + +F+WA L T AG + G  +GWQ T TLSG ++  ++C +LAV+EISLS
Sbjct: 1   MTQSRSQSSTLDYFKWAFLTTAAGLILGAWVGWQSTGTLSGMMTVFFVCAVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGI+IAVFGMRI+FP++IV I + I PI+A+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGIIIAVFGMRIVFPLLIVVIAANIGPIDAVILAAA 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+  AH+PI+ FGGTFLMMV L +FF+ +  +HWI ++E  M+  + I+GI+I
Sbjct: 121 RPEEYSRIMHDAHLPIAAFGGTFLMMVGLNYFFDHEKDVHWIAWIERKMARFATIRGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L   E  +FV ++   ++ F  +  +  +L +         + G   
Sbjct: 181 AFVLALILGFSTLLEGEEAVAFVHAAVYGLLTFLVVEIVGGLLDATEQTMSAAARGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTVMLVEKGTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I VLSV+M+ QT+V IPE+ TG     LI LS++SSI++ 
Sbjct: 301 HGAFYAILVLSVVMYFQTLVHIPEVITGLGGAGLIGLSLWSSIRHN 346


>gi|327189635|gb|EGE56785.1| hypothetical protein RHECNPAF_570029 [Rhizobium etli CNPAF512]
          Length = 362

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 161/345 (46%), Positives = 243/345 (70%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  ++ + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQSATHKSSLGYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATAFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 61  FDNAIVNANKLKEMTPLWQKRFLTWGIIIAVFGMRIVFPLAIVAIAARIGPWDALVLAAR 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I++ AH+PI+ FGGTFLMMV L++FF+ + K+HW+  LE  M+  + I+GI+I
Sbjct: 121 EPEEYARIMNDAHLPIAAFGGTFLMMVGLSYFFDHEKKIHWLRGLEKVMARSATIRGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   E   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 181 AFVLALMLVFSWLIGGEEASIFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 241 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +L+VIM+ QT+V IPE+ TG     LI LS++SSI++
Sbjct: 301 HGAFYAILILAVIMYAQTLVHIPEVITGLGGAALIGLSLWSSIRH 345


>gi|190893419|ref|YP_001979961.1| hypothetical protein RHECIAT_CH0003846 [Rhizobium etli CIAT 652]
 gi|190698698|gb|ACE92783.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 389

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 161/345 (46%), Positives = 243/345 (70%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  ++ + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 28  MNQSATHKSSLGYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 87

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 88  FDNAIVNANKLKEMTPLWQKRFLTWGIIIAVFGMRIVFPLAIVAIAARIGPWDALVLAAR 147

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I++ AH+PI+ FGGTFLMMV L++FF+ + K+HW+  LE  M+  + I+GI+I
Sbjct: 148 EPEEYARIMNDAHLPIAAFGGTFLMMVGLSYFFDHEKKIHWLRGLEKVMARSATIRGIEI 207

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   E   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 208 AFVLALMLVFSWLIGGEEASIFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 267

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 268 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 327

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +L+VIM+ QT+V IPE+ TG     LI LS++SSI++
Sbjct: 328 HGAFYAILILAVIMYAQTLVHIPEVITGLGGAALIGLSLWSSIRH 372


>gi|86359171|ref|YP_471063.1| hypothetical protein RHE_CH03581 [Rhizobium etli CFN 42]
 gi|86283273|gb|ABC92336.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 463

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 161/345 (46%), Positives = 242/345 (70%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +    S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 101 MNQSQTDKSSLGYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICAVLAVLEISLS 160

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 161 FDNAIVNANKLKEMTPVWQKRFLTWGIIIAVFGMRIVFPLAIVAIAARIGPWDALVLAAR 220

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I++ AH+PI+ FGGTFLMMV L++FF+S+ K+HW+  LE  M+  + I+GI+I
Sbjct: 221 EPEEYARIMNDAHLPIAAFGGTFLMMVGLSYFFDSEKKIHWLRGLEKVMARSATIRGIEI 280

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   E   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 281 AFVLALMLVFSWLIGGEEASVFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 340

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 341 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 400

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +L+VIM+ QT++ IPE+ TG     LI LS++SSI++
Sbjct: 401 HGAFYAILILAVIMYAQTLMHIPEVITGLGGAALIGLSLWSSIRH 445


>gi|209550908|ref|YP_002282825.1| hypothetical protein Rleg2_3332 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536664|gb|ACI56599.1| protein of unknown function DUF475 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 363

 Score =  348 bits (893), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 161/345 (46%), Positives = 241/345 (69%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M   + + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQPATHHSSLSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 61  FDNAIVNANKLKEMTPVWQKRFLTWGIIIAVFGMRIVFPLAIVAIAARIGPWDALVLAAR 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I++ AH+PI+ FGGTFLMMV L++FF+ + K+HW   LE  M+  + I+GI+I
Sbjct: 121 EPEEYARIMTDAHLPIAAFGGTFLMMVGLSYFFDHEKKIHWFRGLEKVMARSATIRGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   +   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 181 AFVLALMLVFSWLIGGEQASVFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 241 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSVIM+ QT+V IPE+ TG     LI LS++SSI++
Sbjct: 301 HGAFYAILILSVIMYAQTLVHIPEVITGLGGATLIGLSLWSSIRH 345


>gi|241206320|ref|YP_002977416.1| hypothetical protein Rleg_3632 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860210|gb|ACS57877.1| protein of unknown function DUF475 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 363

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 237/337 (70%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLSF+NAI+NA
Sbjct: 9   SSLSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLSFDNAIVNA 68

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA   P +Y +I
Sbjct: 69  NKLKEMTPVWQKRFLTWGIIIAVFGMRIVFPLAIVAIAAQIGPWDALVLAAREPAEYARI 128

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH+PI+ FGGTFLMMV L +FFN + ++HWI  LE  M+  + IKGI+I  VL+++ 
Sbjct: 129 MNDAHLPIAAFGGTFLMMVGLNYFFNHEKQVHWIGGLEKMMARSATIKGIEIAFVLALML 188

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
             S ++   E   FV  +   ++ F  +  +  +L +         K GL  F+YLE++D
Sbjct: 189 VFSWLIGGEEATVFVHCAIYGLLTFLAVEVVGGLLDASQQTMSAAAKGGLGAFIYLEVLD 248

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG++Y+I 
Sbjct: 249 ASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLEHGAFYAIL 308

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +LSVIM+ QT+V IPE+ TG     LI LS++SSI++
Sbjct: 309 ILSVIMYAQTMVHIPEVITGLGGAALIGLSLWSSIRH 345


>gi|116253837|ref|YP_769675.1| hypothetical protein RL4100 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258485|emb|CAK09589.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 362

 Score =  346 bits (888), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 160/337 (47%), Positives = 238/337 (70%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLSF+NAI+NA
Sbjct: 8   SSLSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLSFDNAIVNA 67

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M+ +WQ+RFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA   P +Y +I
Sbjct: 68  NKLKEMTPVWQQRFLTWGIIIAVFGMRIVFPLAIVAIAAQIGPWDALVLAAREPAEYARI 127

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH+PI+ FGGTFLMMV L++FF+ + K+HW+  LE  M+  + I+GI+I  VL+++ 
Sbjct: 128 MNDAHLPIAAFGGTFLMMVGLSYFFDHEKKIHWLRGLEKVMARSATIRGIEIAFVLALML 187

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
             S ++   E   FV  +   ++ F  +  +  +L +         K GL  F+YLE++D
Sbjct: 188 VFSWLIGGEEASVFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGAFIYLEVLD 247

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG++Y+I 
Sbjct: 248 ASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLEHGAFYAIL 307

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +LSVIM+ QT+V IPE+ TG     LI LS++SSI++
Sbjct: 308 ILSVIMYAQTLVHIPEVITGLGGAALIGLSLWSSIRH 344


>gi|307309387|ref|ZP_07589046.1| protein of unknown function DUF475 [Sinorhizobium meliloti BL225C]
 gi|306900117|gb|EFN30736.1| protein of unknown function DUF475 [Sinorhizobium meliloti BL225C]
          Length = 365

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 167/345 (48%), Positives = 246/345 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +S   + + +F+WA +VT AG L G  +GWQ T T+ G ++  +IC +LAV+EISLS
Sbjct: 1   MTGSSAQTTALGYFKWAFIVTAAGLLLGGWLGWQSTGTIGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I + I PI+A+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAAGIGPIDAVILAAS 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 RPEEYSRIMHEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L   E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSRLLEAEEAVVFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSV+M+ QT++ IPE+ TG     LI LS++SSI++
Sbjct: 301 HGAFYAILILSVVMYFQTLIHIPEVITGLGGAGLIGLSLWSSIRH 345


>gi|307321370|ref|ZP_07600769.1| protein of unknown function DUF475 [Sinorhizobium meliloti AK83]
 gi|306893015|gb|EFN23802.1| protein of unknown function DUF475 [Sinorhizobium meliloti AK83]
          Length = 365

 Score =  337 bits (865), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 167/345 (48%), Positives = 246/345 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +S   + + +F+WA +VT AG L G  +GWQ T T+ G ++  +IC +LAV+EISLS
Sbjct: 1   MTGSSAQTTALGYFKWAFIVTAAGLLLGGWLGWQSTGTIGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I + I PI+A+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAAGIGPIDAVILAAA 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 RPEEYSRIMHEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L   E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSRLLEAEEAVIFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSV+M+ QT++ IPE+ TG     LI LS++SSI++
Sbjct: 301 HGAFYAILILSVVMYFQTLIHIPEVITGLGGAGLIGLSLWSSIRH 345


>gi|16265042|ref|NP_437834.1| hypothetical protein SM_b21468 [Sinorhizobium meliloti 1021]
 gi|15141181|emb|CAC49694.1| conserved hypothetical membrane protein [Sinorhizobium meliloti
           1021]
          Length = 365

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 167/345 (48%), Positives = 247/345 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +S   + + +F+WA +VT AG L G  +GWQ T T+ G ++  +IC +LAV+EISLS
Sbjct: 1   MTGSSAQTTALGYFKWAFIVTAAGLLLGGWLGWQSTGTIGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I + I+PI+A+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAAGISPIDAVILAAS 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 RPEEYSRIMLEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L   E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSRLLEAEEAVVFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSV+M+ QT++ IPE+ TG     LI LS++SSI++
Sbjct: 301 HGAFYAILILSVVMYFQTLIHIPEVITGLGGAGLIGLSLWSSIRH 345


>gi|222087106|ref|YP_002545641.1| hypothetical protein Arad_3862 [Agrobacterium radiobacter K84]
 gi|221724554|gb|ACM27710.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 366

 Score =  336 bits (862), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 169/339 (49%), Positives = 236/339 (69%), Gaps = 1/339 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S++ +F WA  VT AG   G  +GW  T T  G  +  +IC +LAV+EISLSF+NAI+NA
Sbjct: 9   SVLGYFGWAFAVTAAGLALGALLGWNATGTFGGLATAFFICAVLAVLEISLSFDNAIVNA 68

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M+ +WQ RFLTWGI+IAVFGMRIIFP+ IV I + INP EA+ LA   P+ Y +I
Sbjct: 69  NKLKEMTPLWQHRFLTWGIVIAVFGMRIIFPLAIVAIAAWINPWEALKLAAAEPEQYARI 128

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +  AH+PI+ FGGTFLMMV LT+FFN +  +HWI F+E AM+  + IKGI+I  VL +I 
Sbjct: 129 MHDAHLPIAAFGGTFLMMVGLTYFFNHEKDVHWIAFVEKAMARFATIKGIEIAFVLILIL 188

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
             S++L   +  +F+ +S   ++ F  +  L   L +         K G   FLYLE++D
Sbjct: 189 VFSSLLDGEDSTTFLHASIYGLLTFLLVEVLAGFLDASQKTMSAAAKGGFGAFLYLEVLD 248

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L  Y+YLEHG++Y+I 
Sbjct: 249 ASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLAHYRYLEHGAFYAIL 308

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK-NK 346
           +LSVIM++QT++ IPE+ TG     LI +S++SSI+ NK
Sbjct: 309 ILSVIMYVQTLMHIPEVITGLGGAALIGISLWSSIRYNK 347


>gi|221639890|ref|YP_002526152.1| hypothetical protein RSKD131_1791 [Rhodobacter sphaeroides KD131]
 gi|221160671|gb|ACM01651.1| Hypothetical Protein RSKD131_1791 [Rhodobacter sphaeroides KD131]
          Length = 360

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 160/336 (47%), Positives = 230/336 (68%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S I +F WA   TV G   G  +GWQ T T+ GT +  +IC +LAV+EISLSF+NAI+NA
Sbjct: 8   STISYFTWAFAFTVVGLALGGFLGWQTTGTIEGTATIFFICCVLAVLEISLSFDNAIVNA 67

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M+  WQ RFLTWGI+IAVFGMRIIFP++IV I + + P EA+ LA   P +Y +I
Sbjct: 68  NKLKTMTPEWQHRFLTWGIIIAVFGMRIIFPLLIVVIAAHLGPWEALKLAATQPAEYSRI 127

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           + +AH PI+ FGGTFLMMV LT+FF+ +  +HW+ ++E   S  S I+G+++ +VL  + 
Sbjct: 128 MHEAHTPIAAFGGTFLMMVGLTYFFDQEKDIHWVRWIEEQASRYSSIRGVEVAVVLCAVL 187

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
           G S +L   E   F++S+   ++ F  +  L   L           K G   FLYLE++D
Sbjct: 188 GFSRLLEGAEQQVFINSALYGLLTFLLVEVLGGFLDHRQQALDAAAKGGFGAFLYLEVLD 247

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG++Y+I 
Sbjct: 248 ASFSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVERGTLAQYRYLEHGAFYAIL 307

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +LSVIM++QT+  IPE+ TG     LI +S++SSI+
Sbjct: 308 ILSVIMYVQTLTHIPEVITGLGGAGLIGISLWSSIR 343


>gi|126462873|ref|YP_001043987.1| hypothetical protein Rsph17029_2112 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104537|gb|ABN77215.1| protein of unknown function DUF475 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 360

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 160/336 (47%), Positives = 230/336 (68%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S I +F WA   TV G   G  +GWQ T T+ GT +  +IC +LAV+EISLSF+NAI+NA
Sbjct: 8   STISYFTWAFAFTVVGLALGGFLGWQTTGTIEGTATIFFICCVLAVLEISLSFDNAIVNA 67

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M+  WQ RFLTWGI+IAVFGMRIIFP++IV I + + P EA+ LA   P +Y +I
Sbjct: 68  NKLKTMTPEWQHRFLTWGIIIAVFGMRIIFPLLIVVIAAHLGPWEALKLAATQPAEYSRI 127

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           + +AH PI+ FGGTFLMMV LT+FF+ +  +HW+ ++E   S  S I+G+++ +VL  + 
Sbjct: 128 MHEAHTPIAAFGGTFLMMVGLTYFFDQEKDIHWVRWIEEQASRYSSIRGVEVAVVLCAVL 187

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
           G S +L   E   F++S+   ++ F  +  L   L           K G   FLYLE++D
Sbjct: 188 GFSRLLEGAEQQVFINSALYGLLTFLLVEVLGGFLDHRQQALDAAAKGGFGAFLYLEVLD 247

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG++Y+I 
Sbjct: 248 ASFSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVERGTLAQYRYLEHGAFYAIL 307

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +LSVIM++QT+  IPE+ TG     LI +S++SSI+
Sbjct: 308 ILSVIMYVQTLTHIPEVITGLGGAGLIGISLWSSIR 343


>gi|77464028|ref|YP_353532.1| hypothetical protein RSP_0459 [Rhodobacter sphaeroides 2.4.1]
 gi|77388446|gb|ABA79631.1| hypothetical protein RSP_0459 [Rhodobacter sphaeroides 2.4.1]
          Length = 360

 Score =  333 bits (854), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 230/336 (68%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S I +F WA   T+ G   G  +GWQ T T+ GT +  +IC +LAV+EISLSF+NAI+NA
Sbjct: 8   STISYFTWAFAFTLVGLALGGFLGWQTTGTIEGTATIFFICCVLAVLEISLSFDNAIVNA 67

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M+  WQ RFLTWGI+IAVFGMRIIFP++IV I + + P EA+ LA   P +Y +I
Sbjct: 68  NKLKTMTPEWQHRFLTWGIIIAVFGMRIIFPLLIVVIAAHLGPWEALKLAATQPAEYSRI 127

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           + +AH PI+ FGGTFLMMV LT+FF+ +  +HW+ ++E   S  S I+G+++ +VL  + 
Sbjct: 128 MHEAHTPIAAFGGTFLMMVGLTYFFDQEKDIHWVRWIEEQASRYSSIRGVEVAVVLCAVL 187

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
           G S +L   E   F++S+   ++ F  +  L   L           K G   FLYLE++D
Sbjct: 188 GFSRLLEGAEQQVFINSALYGLLTFLLVEVLGGFLDHRQQALDAAAKGGFGAFLYLEVLD 247

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG++Y+I 
Sbjct: 248 ASFSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVERGTLAQYRYLEHGAFYAIL 307

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +LSVIM++QT+  IPE+ TG     LI +S++SSI+
Sbjct: 308 ILSVIMYVQTLTHIPEVITGLGGAGLIGISLWSSIR 343


>gi|325291647|ref|YP_004277511.1| hypothetical protein AGROH133_03244 [Agrobacterium sp. H13-3]
 gi|325059500|gb|ADY63191.1| hypothetical protein AGROH133_03244 [Agrobacterium sp. H13-3]
          Length = 368

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 158/344 (45%), Positives = 238/344 (69%), Gaps = 12/344 (3%)

Query: 13  HFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQ 72
           +F+WA +VT+ G + G  +GW+ T T+SGT +  +IC +LAV+EISLSF+NAI+NA  L+
Sbjct: 11  YFKWAFIVTIVGLILGGYLGWEMTGTVSGTATIFFICAVLAVLEISLSFDNAIVNANKLK 70

Query: 73  KMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQA 132
           +M+ +WQ RFLTWGILIAVFGMRI+FP++IV + + + P  A+ +A   P+ Y +I+  A
Sbjct: 71  EMTPVWQHRFLTWGILIAVFGMRIVFPLLIVVVAANVGPWTALVMAATQPERYAEIMRDA 130

Query: 133 HVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISN 192
           H+PI+ FGGTFLMMV L FFF+ +  +HW+ ++E   +  S +KGI+I  VL ++   S 
Sbjct: 131 HLPIAAFGGTFLMMVGLNFFFDHEKDVHWVRWIEEKAAVYSSVKGIEIAFVLVVMLAFSR 190

Query: 193 ILPTNE--------MYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG--KHGLNLFL 242
           I+  ++          +F  ++   ++ F  +  +  +L  D S  V  G  K G   FL
Sbjct: 191 IIGASDNPELGPVAANTFFHAAIWGLLTFLLVEVVGGIL--DRSQEVLEGAAKGGFGAFL 248

Query: 243 YLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           YLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L +Y+YLEHG
Sbjct: 249 YLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLEHG 308

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           ++Y+I +LSVIM++QT+  IPE+ TG     LI +S++SSI++ 
Sbjct: 309 AFYAILILSVIMYVQTMFHIPEVITGLGGATLIGISLWSSIRHN 352


>gi|15887561|ref|NP_353242.1| hypothetical protein Atu0209 [Agrobacterium tumefaciens str. C58]
 gi|15155096|gb|AAK86027.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 368

 Score =  328 bits (840), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 158/346 (45%), Positives = 237/346 (68%), Gaps = 12/346 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F+WA +VTV G + G  +GW+ T T+ GT +  +IC +LAV+EISLSF+NAI+NA  
Sbjct: 9   LSYFKWAFIVTVVGLILGGYLGWEMTGTIGGTATIFFICAVLAVLEISLSFDNAIVNANK 68

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M+ +WQ RFLTWGILIAVFGMRI+FP++IV + + + P  A+ +A   P+ Y +I+ 
Sbjct: 69  LKDMTPVWQHRFLTWGILIAVFGMRIVFPLLIVVVAANVGPWTALVMAATQPERYAEIMR 128

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH+PI+ FGGTFLMMV L FFF+ +  +HW+ ++E   +  S +KGI+I  VL ++   
Sbjct: 129 DAHLPIAAFGGTFLMMVGLNFFFDHEKDVHWVRWIEEKAATYSSVKGIEIAFVLIVMLVF 188

Query: 191 SNILPTNE--------MYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG--KHGLNL 240
           S I+  ++          +F  S+   ++ F  +  +  +L  D S  +  G  K G   
Sbjct: 189 SRIIGASDNPELGPVAANTFFHSAIWGLLTFLLVEVVGGIL--DRSQEMLEGAAKGGFGA 246

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 247 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 306

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +LSVIM++QT+  IPE+ TG     LI +S++SSI++ 
Sbjct: 307 HGAFYAILILSVIMYVQTMFHIPEVITGLGGATLIGISLWSSIRHN 352


>gi|119383066|ref|YP_914122.1| hypothetical protein Pden_0312 [Paracoccus denitrificans PD1222]
 gi|119372833|gb|ABL68426.1| protein of unknown function DUF475 [Paracoccus denitrificans
           PD1222]
          Length = 364

 Score =  325 bits (833), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 160/342 (46%), Positives = 234/342 (68%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           +N  +   +H+F+W+ +VT  G   G  +GWQ T T+ GT++  +IC +LAV+EISLSF+
Sbjct: 13  TNGTHRPTLHYFKWSFIVTALGLALGAVLGWQTTGTVGGTLTIFFICAVLAVLEISLSFD 72

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NAI+NA  L++M+  WQ+RFLTWGILIAVFGMRI+FP++IV I + I P +AM LA   P
Sbjct: 73  NAIVNANKLKEMTPKWQRRFLTWGILIAVFGMRIVFPLLIVVIAANIGPWQAMVLAASQP 132

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
            +Y +I+  AH+PI+ FGGTFLMMV L+FFF+ +  +HW+ +LE  M   + ++GI++ +
Sbjct: 133 DEYSRIMHDAHLPIAAFGGTFLMMVGLSFFFDHEKDVHWVRWLEHRMQRYATVRGIEVAV 192

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFL 242
           VL  +   S  L   +   F  S+   ++ F  +  L  +L S         K G+  FL
Sbjct: 193 VLVTVLIFSRFLEGADSQVFFHSAIWGLLTFLLVEVLGGLLDSSQEAMQAGAKGGIGAFL 252

Query: 243 YLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           YLE++DAS S DGVI +FA+T N F+I IGL IGA+YVRSMT++++++G L +Y++LEHG
Sbjct: 253 YLEVLDASFSFDGVIGAFALTHNLFVIAIGLGIGAMYVRSMTIMLVERGTLAEYRFLEHG 312

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           ++Y+I  LSVIMF+Q +V IPE+ TG     LI +S +SSI+
Sbjct: 313 AFYAIIALSVIMFVQPLVHIPEVITGLGGATLIGISFWSSIR 354


>gi|146278415|ref|YP_001168574.1| hypothetical protein Rsph17025_2380 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556656|gb|ABP71269.1| protein of unknown function DUF475 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 361

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 157/336 (46%), Positives = 232/336 (69%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +F WA L T  G   G  +GW  T T+ GT +  +IC +LAV+EISLSF+NAI+NA
Sbjct: 8   STVSYFTWAFLFTALGLALGGYLGWATTGTIEGTATIFFICCVLAVLEISLSFDNAIVNA 67

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M+  WQ+RFLTWGILIAVFGMRI+FP++IV I +++ P EA+ LA   P +Y +I
Sbjct: 68  NKLKTMTPKWQRRFLTWGILIAVFGMRIVFPLLIVVIAASLGPWEAVKLAATQPAEYSRI 127

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           + +AH PI+ FGGTFLMMV LT+FF+ +  +HW+ ++E   S  S I+G+++ +VL  + 
Sbjct: 128 MHEAHTPIAAFGGTFLMMVGLTYFFDQEKDIHWVRWIEEQASRYSSIRGVEVAVVLCAVL 187

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
           G S +L   E   F++S+   ++ F  +  L   L           K G+  FLYLE++D
Sbjct: 188 GFSRLLEGAEQQVFLNSAIYGLLTFLLVEVLGGFLDHRQQALDAAAKGGVGAFLYLEVLD 247

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG++Y+I 
Sbjct: 248 ASFSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVERGTLAQYRYLEHGAFYAIL 307

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +LS+IM++QT+  IPE+ TG     LI +S++SSI+
Sbjct: 308 ILSLIMYVQTLTHIPEVITGLGGAGLIGISLWSSIR 343


>gi|260576197|ref|ZP_05844190.1| protein of unknown function DUF475 [Rhodobacter sp. SW2]
 gi|259021677|gb|EEW24980.1| protein of unknown function DUF475 [Rhodobacter sp. SW2]
          Length = 346

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 237/338 (70%), Gaps = 4/338 (1%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +FRWA + T  G +    +GW F+ TL+G +S + I  +LAV+EISLSF+NAI+NA  
Sbjct: 1   MQYFRWAFVFTAIGLVGAFWLGWLFSGTLAGGLSFLLIGSVLAVLEISLSFDNAIVNANK 60

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++M+ +WQ RFLTWGI+IAVFGMRIIFP++IV + + I P +A+ LA  +P +Y  II 
Sbjct: 61  LKEMTPVWQHRFLTWGIIIAVFGMRIIFPLLIVVVAAHIGPWQALKLAALNPAEYASIIG 120

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +AH+ I+ FGG FLMMV L +FF+    +HWI  LE  MS  S ++GI++ IVL+++   
Sbjct: 121 EAHLSIAAFGGAFLMMVGLKYFFDEGKDVHWIATLERTMSKFSSVQGIELAIVLAVVMVF 180

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV--THGKHGLNLFLYLEIID 248
           ++++P  E+ +F+ ++ A ++ F  +  L  +L  D+S  V  +  + GL  FLYLE++D
Sbjct: 181 ASVMPEAEVATFLYAAVAGLLTFLLVEVLGHLL--DASQQVIGSAARGGLGAFLYLEVLD 238

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++  L +++YLEHG+++SI 
Sbjct: 239 ASFSFDGVIGAFALTQNLFLIAIGLGIGAMYVRSMTIMLVERNTLAEFRYLEHGAFWSIL 298

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +LS IMF QT+  IPE+ TG      I L++ SSI+ +
Sbjct: 299 ILSGIMFCQTLWHIPEVVTGLLGAGFIGLALLSSIRYR 336


>gi|240850907|ref|YP_002972307.1| hypothetical integral membrane protein [Bartonella grahamii as4aup]
 gi|240268030|gb|ACS51618.1| hypothetical integral membrane protein [Bartonella grahamii as4aup]
          Length = 350

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 153/340 (45%), Positives = 233/340 (68%), Gaps = 4/340 (1%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           SL+ +F +A   T+ G   G  IGW  T +++G +   +IC +L V+EISLSF+N+I+NA
Sbjct: 2   SLLRYFGFAFFFTIIGVFLGGVIGWFETESITGFLKYFFICFVLGVLEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L +M  +W++RFL WGILIAVFGMRI+FP+++V +   INPI A+ LAI+ P  Y ++
Sbjct: 62  RVLSRMDPLWRRRFLIWGILIAVFGMRIVFPLLVVVVAVGINPIAAVKLAIWEPHRYAEV 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH+ I+ FGGTFLMMV L +FF+S+ ++HW++ +E        + GI I IVL +I 
Sbjct: 122 LTDAHMGIAAFGGTFLMMVGLKYFFDSEKEVHWLNVIERPAQKFGALVGIDIAIVLILIL 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSS--NNVTHGKHGLNLFLYLEI 246
            +S  + T +  +F+ ++   ++ F G+  +  +L +       VTHG  G+  FLYLE+
Sbjct: 182 FVSAQIDTEDKITFLLAALYGLLTFIGVEVVGHLLDTPQKTLTTVTHG--GVGAFLYLEV 239

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGV+ +FA + N FII IGL IGA YVRSMT+++++ G L  Y+YLEHG++Y+
Sbjct: 240 LDASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRSMTIMLVESGTLLHYRYLEHGAFYA 299

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM+LQTI+ +PE+ TG     +I +++YSSI+ K
Sbjct: 300 ILVLAVIMYLQTIISVPEVLTGLVGVCIIGMALYSSIRFK 339


>gi|49474470|ref|YP_032512.1| hypothetical protein BQ09030 [Bartonella quintana str. Toulouse]
 gi|49239974|emb|CAF26381.1| hypothetical protein BQ09030 [Bartonella quintana str. Toulouse]
          Length = 350

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 151/338 (44%), Positives = 230/338 (68%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +F WA   T+ G   G  IGW  T ++ G +   +IC +L ++EISLSF+N+I+NA
Sbjct: 2   ALLGYFGWAFFFTIIGVFLGGAIGWFETGSVIGFLKYFFICCVLGILEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L KM  +W++RFL WGILIAVFGMRI+FP+++V +   I+P+ A+ LAI+ P  Y  I
Sbjct: 62  RVLAKMDPLWRRRFLVWGILIAVFGMRIVFPLLVVAVAVGISPVAAVKLAIWEPHQYATI 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +  +HV I+ FGGTFLMMV L +FF+S+ ++HW+ F+E     L  + GI I I+L++I 
Sbjct: 122 LMDSHVAIAAFGGTFLMMVGLKYFFDSEKEVHWLAFIERPAQKLGAVGGIDIAIILTLIL 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
             S  + T +  +F+ ++   ++ F G+  + S+L S  +      K G+  FLYLEI+D
Sbjct: 182 FFSGQVVTEDKIAFLLAALYGLLTFIGVEAISSLLDSPKTTLSAVFKGGVGAFLYLEILD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+ +FA + N FII IGL+IGA YVRSMT+++++ GIL  Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVVGAFAFSHNLFIIAIGLSIGAFYVRSMTIMLVESGILLHYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +L+VIM+LQT+V +PE+ TG     +I ++  SS++ K
Sbjct: 302 ILAVIMYLQTLVSVPEVLTGLVGVGIIGMAFCSSLRFK 339


>gi|163868728|ref|YP_001609940.1| hypothetical protein Btr_1608 [Bartonella tribocorum CIP 105476]
 gi|161018387|emb|CAK01945.1| conserved hypothetical membrane protein [Bartonella tribocorum CIP
           105476]
          Length = 349

 Score =  315 bits (808), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 230/338 (68%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +F +A   T+ G   G  IGW  T +++G +   +IC +L V+EISLSF+N+I+NA
Sbjct: 2   ALLRYFGFAFFFTIIGVFLGGAIGWFETGSITGFLKYFFICCVLGVLEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L +M  +W++RFL WGILIAVFGMRI+FP+++V +   INPI A+ LAI  P  Y ++
Sbjct: 62  RVLGRMDPLWRRRFLIWGILIAVFGMRIVFPLLVVVVAVGINPIAAVKLAIGEPHRYAEV 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH+ I+ FGGTFLMMV L +FF+S+ ++HW+  +E +   L  + GI I IVL +I 
Sbjct: 122 LTDAHMGIAAFGGTFLMMVGLKYFFDSEKEVHWLSVIERSAQKLGALVGIDIAIVLILIL 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
            +S  +   +  +F+ ++   ++ F G+  +  +L +      T  + GL  FLYLE++D
Sbjct: 182 FVSGQIVAEDRVTFLLAALYGLLTFIGVEAVGHLLDAPKKTLTTVAQGGLGAFLYLEVLD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+ +FA + N FII IGL IGA YVRSMT+++++ G L  Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRSMTIMLVESGTLLHYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VL+VIM+LQTI+ +PE+ TG     +I +++YSSI+ K
Sbjct: 302 VLAVIMYLQTIIPVPEVLTGLVGICIIGIALYSSIRFK 339


>gi|49475870|ref|YP_033911.1| hypothetical protein BH11410 [Bartonella henselae str. Houston-1]
 gi|49238678|emb|CAF27925.1| hypothetical protein BH11410 [Bartonella henselae str. Houston-1]
          Length = 352

 Score =  315 bits (807), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 151/337 (44%), Positives = 225/337 (66%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+ +  W    T+ G   G  IGW  T ++ G +   +IC +L V+EISLSF+N+I+NA+
Sbjct: 3   LVGYLGWPFFFTIIGVFLGGAIGWFETGSVIGFLKYFFICCVLGVLEISLSFDNSIINAR 62

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L++M  +W++RFL WGILIAVFGMR++FP+++V I   INPI A+ LAI+ P  Y  ++
Sbjct: 63  VLERMDPLWRRRFLVWGILIAVFGMRLVFPLLVVAIAVGINPIAAVKLAIWEPHHYAAVL 122

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  H+ I+ FGGTFLMMV L +FF+ + ++HW+ F+E     L  + GI I IVL +I  
Sbjct: 123 TDVHLAIAAFGGTFLMMVGLKYFFDPEKEVHWLVFIERPAQKLGALVGIDIAIVLVLILF 182

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  + T +   F+ +S   ++IF  +  + S+L +  +   T  K G   F YLEI+DA
Sbjct: 183 FSGQVVTEDKMVFLLASLYGLLIFIAVEAVSSLLDAPKTALTTVAKGGAGAFFYLEILDA 242

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGV+ +FA + N FII IGL+IGA YVRSMT+++++ GIL  Y+YLEHG++Y+I V
Sbjct: 243 SFSFDGVVGAFAFSHNLFIIAIGLSIGAFYVRSMTIMLVESGILLHYRYLEHGAFYAILV 302

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+VIM+LQT++ IPE+ TG     +I ++ YSS++ K
Sbjct: 303 LAVIMYLQTLLSIPEVLTGLVGVCIIGMAFYSSLRFK 339


>gi|87200060|ref|YP_497317.1| hypothetical protein Saro_2044 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135741|gb|ABD26483.1| protein of unknown function DUF475 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 355

 Score =  312 bits (800), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 151/340 (44%), Positives = 230/340 (67%), Gaps = 3/340 (0%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  ++ +IL T+      +  GW  T T SGT+S V+I  +L+++EISLSF+NA++NA 
Sbjct: 1   MLRFYKGSILFTLVCLALAVAYGWMQTGTASGTMSLVWIVFVLSILEISLSFDNAVVNAA 60

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M  +WQKRFLTWG++IAVFGMRI+FP+ IV I + + PIEA+NL++  P+ Y +I+
Sbjct: 61  VLEDMDEVWQKRFLTWGMVIAVFGMRIVFPLAIVAIAAGLGPIEALNLSLKDPKRYEEIV 120

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           S AHV I+GFGG FL MV L+FFF+ + ++HWI ++E  ++ +S IK  +I ++L  I+G
Sbjct: 121 SSAHVGIAGFGGAFLAMVGLSFFFDGEKEVHWIKWVEEKLAVVSNIKAAEIALLLLSIYG 180

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
           IS ILP  E  +FV +    ++ F  +  L ++L          G   + GL  FLYL +
Sbjct: 181 ISLILPPEEALTFVVAGVLGLVTFIAVEALGTILEMREEAQKAAGVVVRSGLGGFLYLNV 240

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FA++ N  II +GL+IGA++VRSMT++++++G L++Y+YLEHG++++
Sbjct: 241 LDASFSFDGVIGAFALSNNMVIIALGLSIGAMFVRSMTIMLVQKGTLSEYRYLEHGAFWA 300

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I  L  IM L     IPE  TG     LI LS++ SI++K
Sbjct: 301 IIALGAIMLLSARYHIPETVTGLIGAALIGLSLWWSIRHK 340


>gi|294677262|ref|YP_003577877.1| hypothetical protein RCAP_rcc01725 [Rhodobacter capsulatus SB 1003]
 gi|294476082|gb|ADE85470.1| protein of unknown function DUF475, transmembrane [Rhodobacter
           capsulatus SB 1003]
          Length = 344

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 152/339 (44%), Positives = 229/339 (67%), Gaps = 3/339 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +F WA   T  G    + +G+ + HT  G +S  ++  +LAV+EISLSF+NAI+NA
Sbjct: 3   STLQYFSWAFGFTAVGLALAMWLGFTYEHTTHGALSFFFVACVLAVLEISLSFDNAIINA 62

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L +M+  WQ+RFLTWGILIAVFGMRI+FP++IV I + I PIEA+ +A   P +Y +I
Sbjct: 63  NKLGQMTPEWQRRFLTWGILIAVFGMRILFPLLIVVIAAGIGPIEALRIAATQPAEYSRI 122

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           I +AH+ I+ FGG FLMMV+L++F +   ++HW   LE  +S  + I+GI++  +L+I+ 
Sbjct: 123 IGEAHLSIAAFGGAFLMMVALSYFVDESKEVHWFVALEKRLSSWASIRGIEVGFLLAIVL 182

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS-SNNVTHGKHGLNLFLYLEII 247
             +  LP     +F+ ++   ++ F  +  L  VL   S S +V  G  GL  FLYLE++
Sbjct: 183 AFAWWLPVKTEGTFLVAACTGLLTFLAVEGLGQVLDKASLSGDVAKG--GLGAFLYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T+N F+I IGL IGA YVRSMT++++++  L++++YLEHG+++SI
Sbjct: 241 DASFSFDGVIGAFALTQNLFLIAIGLGIGAFYVRSMTVMLVERQALSEFRYLEHGAFWSI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VLSV MF QT++ +PE  TG    + I LS+ SS++ +
Sbjct: 301 LVLSVAMFAQTLMHVPEWATGLLGVVFIGLSLMSSLRWR 339


>gi|119384926|ref|YP_915982.1| hypothetical protein Pden_2194 [Paracoccus denitrificans PD1222]
 gi|119374693|gb|ABL70286.1| protein of unknown function DUF475 [Paracoccus denitrificans
           PD1222]
          Length = 348

 Score =  311 bits (797), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 149/340 (43%), Positives = 229/340 (67%), Gaps = 2/340 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +  W  +VT AG      +GW++  T SG ++   I  ILAV+EISLSF+NAI+NA
Sbjct: 3   STLSYMTWPFIVTGAGLALAAFLGWEYHGTGSGALAFFLIAGILAVLEISLSFDNAIVNA 62

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M+  WQ+RFLTWGILIAVFGMR+IFP+++V I + + P EA+ LA   PQ+Y +I
Sbjct: 63  NKLKQMTPKWQRRFLTWGILIAVFGMRVIFPLLVVVIAAHLAPWEAIRLAATQPQEYSRI 122

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           I +AH+PI+ FGG+FLM+V+L +FF+    + WI  +E A+  L +I+G+++  VL  + 
Sbjct: 123 IHEAHLPIAAFGGSFLMLVALNYFFDEAKDVDWIKGVEAALRKLGEIRGMEVGFVLVCML 182

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS--SDSSNNVTHGKHGLNLFLYLEI 246
            I   LP  + ++F+ ++   +I +  ++ L  VL     +       + G   FLYLE+
Sbjct: 183 VIVGQLPAEKEHAFIIAAIWGVITYLLVDMLGHVLDRWGGAPQPADMARGGFGAFLYLEV 242

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L  ++YLEHG+++S
Sbjct: 243 LDASFSFDGVIGAFALTQNLFLIAIGLGIGAMYVRSMTVMLVERGTLAAFRYLEHGAFWS 302

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           IFVLS++MF+QT+  IPE+ TG      I ++  SS+  +
Sbjct: 303 IFVLSILMFVQTLRPIPEVVTGLLGACFIGMAFLSSLAWR 342


>gi|85373895|ref|YP_457957.1| hypothetical protein ELI_05340 [Erythrobacter litoralis HTCC2594]
 gi|84786978|gb|ABC63160.1| conserved hypothetical membrane protein [Erythrobacter litoralis
           HTCC2594]
          Length = 352

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 146/339 (43%), Positives = 237/339 (69%), Gaps = 3/339 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ ++ +++  T   F      GW  T T+ GT+S ++I  +L+++E+SLSF+NA++NA
Sbjct: 3   TLLRYYTFSLAFTAVCFGLAAWYGWASTGTIWGTLSLLWIVFVLSILEVSLSFDNAVVNA 62

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M  +WQ+RFLT GILIAVFGMRI+FPI IV I + + P+EA+ L++  PQ+Y +I
Sbjct: 63  TVLREMDPVWQQRFLTIGILIAVFGMRIVFPIAIVAIAADLGPVEAITLSLNEPQEYERI 122

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +S+AH+ I+GFGG FL MV LTFFF+S+  +HWI  +E A++ +S +  ++I +VL++++
Sbjct: 123 VSEAHLGIAGFGGAFLAMVGLTFFFDSEKNVHWIGKIERAINRVSTVPAVEIGLVLALVY 182

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLE 245
           G+S +L  +E  +F++++   ++ + G+N + S++    +     G   + GL  FLYLE
Sbjct: 183 GVSTLLTADEAMTFLTAAILGLLTYIGVNAVGSLIEQRETRKKAAGEIVRSGLGGFLYLE 242

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           ++DAS S DGVI +FA++ N  +I +GL++GA++VRSMT+ +++QG L +Y+YLEHG+++
Sbjct: 243 VLDASFSFDGVIGAFALSNNMIVIALGLSVGAMFVRSMTIHLVRQGTLAQYRYLEHGAFW 302

Query: 306 SIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +I VL VIM L     IPE  TG    ILI LS+  SI+
Sbjct: 303 AIIVLGVIMLLSAKFHIPETITGLIGAILIGLSLLWSIR 341


>gi|256369881|ref|YP_003107392.1| hypothetical protein BMI_I1477 [Brucella microti CCM 4915]
 gi|256000044|gb|ACU48443.1| hypothetical protein BMI_I1477 [Brucella microti CCM 4915]
          Length = 353

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 225/333 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +IM++QT+V IPE+ TG     LI LS  SS++
Sbjct: 305 IIMYVQTLVPIPEVITGLIGAALIGLSFMSSLR 337


>gi|306844362|ref|ZP_07476953.1| integral membrane protein [Brucella sp. BO1]
 gi|306275298|gb|EFM57045.1| integral membrane protein [Brucella sp. BO1]
          Length = 353

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 225/333 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +IM++QT+V IPE+ TG     LI LS  SS++
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLR 337


>gi|161619411|ref|YP_001593298.1| hypothetical protein BCAN_A1500 [Brucella canis ATCC 23365]
 gi|254704721|ref|ZP_05166549.1| hypothetical protein Bsuib36_12542 [Brucella suis bv. 3 str. 686]
 gi|260566032|ref|ZP_05836502.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261755414|ref|ZP_05999123.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|161336222|gb|ABX62527.1| protein of unknown function DUF475 [Brucella canis ATCC 23365]
 gi|260155550|gb|EEW90630.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261745167|gb|EEY33093.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 353

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 225/333 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICTVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +IM++QT+V IPE+ TG     LI LS  SS++
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLR 337


>gi|23502334|ref|NP_698461.1| hypothetical protein BR1465 [Brucella suis 1330]
 gi|163843717|ref|YP_001628121.1| hypothetical protein BSUIS_A1518 [Brucella suis ATCC 23445]
 gi|254702184|ref|ZP_05164012.1| hypothetical protein Bsuib55_15179 [Brucella suis bv. 5 str. 513]
 gi|254719495|ref|ZP_05181306.1| hypothetical protein Bru83_08128 [Brucella sp. 83/13]
 gi|261752754|ref|ZP_05996463.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|265984504|ref|ZP_06097239.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294852787|ref|ZP_06793460.1| hypothetical protein BAZG_01721 [Brucella sp. NVSL 07-0026]
 gi|306839274|ref|ZP_07472091.1| integral membrane protein [Brucella sp. NF 2653]
 gi|306843180|ref|ZP_07475796.1| integral membrane protein [Brucella sp. BO2]
 gi|23348314|gb|AAN30376.1| membrane protein, putative [Brucella suis 1330]
 gi|163674440|gb|ABY38551.1| protein of unknown function DUF475 [Brucella suis ATCC 23445]
 gi|261742507|gb|EEY30433.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|264663096|gb|EEZ33357.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294821376|gb|EFG38375.1| hypothetical protein BAZG_01721 [Brucella sp. NVSL 07-0026]
 gi|306286631|gb|EFM58198.1| integral membrane protein [Brucella sp. BO2]
 gi|306405821|gb|EFM62083.1| integral membrane protein [Brucella sp. NF 2653]
          Length = 353

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 225/333 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +IM++QT+V IPE+ TG     LI LS  SS++
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLR 337


>gi|239832345|ref|ZP_04680674.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824612|gb|EEQ96180.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 385

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 226/334 (67%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ 
Sbjct: 34  LRYFIWPMVFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARI 93

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M+  WQ RFLTWGI+IAVFGMRIIFP+ IV +    +PI A+ LAI+ P +Y ++IS
Sbjct: 94  LRDMTPEWQHRFLTWGIIIAVFGMRIIFPLAIVAVAMWTDPISALKLAIWQPDEYARVIS 153

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           ++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   
Sbjct: 154 ESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIKAIESRMSKFASVQGVEIGVAIALIIFF 213

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           S  L     ++F+ ++   ++ F  +  L  VL +         + GL  F+YLE++DAS
Sbjct: 214 SYQLDAEHSHTFLIAALFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDAS 273

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+T N FII IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL
Sbjct: 274 FSFDGVIGAFALTTNLFIIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVL 333

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +VIM++QT+V IPE+ TG     LI LS  SS++
Sbjct: 334 AVIMYVQTLVHIPEVITGLIGAALIGLSFMSSLR 367


>gi|17986828|ref|NP_539462.1| hypothetical protein BMEI0545 [Brucella melitensis bv. 1 str. 16M]
 gi|17982462|gb|AAL51726.1| integral membrane protein [Brucella melitensis bv. 1 str. 16M]
          Length = 353

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 225/333 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLGIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +IM++QT+V IPE+ TG     LI LS  SS++
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSMR 337


>gi|62290356|ref|YP_222149.1| hypothetical protein BruAb1_1460 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700279|ref|YP_414853.1| hypothetical protein BAB1_1485 [Brucella melitensis biovar Abortus
           2308]
 gi|189024587|ref|YP_001935355.1| Protein of unknown function DUF475 [Brucella abortus S19]
 gi|225852945|ref|YP_002733178.1| hypothetical protein BMEA_A1515 [Brucella melitensis ATCC 23457]
 gi|237815860|ref|ZP_04594857.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254694148|ref|ZP_05155976.1| hypothetical protein Babob3T_05679 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697800|ref|ZP_05159628.1| hypothetical protein Babob28_08853 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730689|ref|ZP_05189267.1| hypothetical protein Babob42_05709 [Brucella abortus bv. 4 str.
           292]
 gi|256045092|ref|ZP_05447993.1| hypothetical protein Bmelb1R_11429 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256114022|ref|ZP_05454799.1| hypothetical protein Bmelb3E_14625 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256263573|ref|ZP_05466105.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260546896|ref|ZP_05822635.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565309|ref|ZP_05835793.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260758404|ref|ZP_05870752.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260762230|ref|ZP_05874573.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|261214447|ref|ZP_05928728.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|265991521|ref|ZP_06104078.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995359|ref|ZP_06107916.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|62196488|gb|AAX74788.1| hypothetical protein BruAb1_1460 [Brucella abortus bv. 1 str.
           9-941]
 gi|82616380|emb|CAJ11441.1| Protein of unknown function DUF475 [Brucella melitensis biovar
           Abortus 2308]
 gi|189020159|gb|ACD72881.1| Protein of unknown function DUF475 [Brucella abortus S19]
 gi|225641310|gb|ACO01224.1| protein of unknown function DUF475 [Brucella melitensis ATCC 23457]
 gi|237789158|gb|EEP63369.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260095946|gb|EEW79823.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151377|gb|EEW86471.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668722|gb|EEX55662.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672662|gb|EEX59483.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260916054|gb|EEX82915.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|262766472|gb|EEZ12261.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002305|gb|EEZ14880.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093624|gb|EEZ17629.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326409488|gb|ADZ66553.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326539194|gb|ADZ87409.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 353

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 225/333 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLGIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +IM++QT+V IPE+ TG     LI LS  SS++
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLR 337


>gi|254708137|ref|ZP_05169965.1| hypothetical protein BpinM_14582 [Brucella pinnipedialis
           M163/99/10]
 gi|254714499|ref|ZP_05176310.1| hypothetical protein BcetM6_14398 [Brucella ceti M644/93/1]
 gi|254717397|ref|ZP_05179208.1| hypothetical protein BcetM_13527 [Brucella ceti M13/05/1]
 gi|256160197|ref|ZP_05457891.1| hypothetical protein BcetM4_14404 [Brucella ceti M490/95/1]
 gi|256255403|ref|ZP_05460939.1| hypothetical protein BcetB_14176 [Brucella ceti B1/94]
 gi|261219226|ref|ZP_05933507.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261222606|ref|ZP_05936887.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261315639|ref|ZP_05954836.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261322287|ref|ZP_05961484.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|265998571|ref|ZP_06111128.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260921190|gb|EEX87843.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260924315|gb|EEX90883.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294977|gb|EEX98473.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261304665|gb|EEY08162.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|262553195|gb|EEZ09029.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 353

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 225/333 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRTIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +IM++QT+V IPE+ TG     LI LS  SS++
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLR 337


>gi|254710506|ref|ZP_05172317.1| hypothetical protein BpinB_09617 [Brucella pinnipedialis B2/94]
 gi|256031999|ref|ZP_05445613.1| hypothetical protein BpinM2_15384 [Brucella pinnipedialis
           M292/94/1]
 gi|261318075|ref|ZP_05957272.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|265989108|ref|ZP_06101665.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|261297298|gb|EEY00795.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|264661305|gb|EEZ31566.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 353

 Score =  308 bits (789), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 225/333 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRTIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +IM++QT+V IPE+ TG     LI LS  SS++
Sbjct: 305 IIMYVQTLVHIPEVITGLIGVALIGLSFMSSLR 337


>gi|153009036|ref|YP_001370251.1| hypothetical protein Oant_1706 [Ochrobactrum anthropi ATCC 49188]
 gi|151560924|gb|ABS14422.1| protein of unknown function DUF475 [Ochrobactrum anthropi ATCC
           49188]
          Length = 355

 Score =  308 bits (789), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 226/334 (67%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ 
Sbjct: 4   LRYFIWPMVFTVLGLAGAVWLGFEMTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARI 63

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M+  WQ RFLTWGI+IAVFGMRIIFP+ IV +    +PI A+ LAI+ P +Y ++IS
Sbjct: 64  LRDMTPEWQHRFLTWGIIIAVFGMRIIFPLAIVAVAMWTDPISALKLAIWQPDEYARVIS 123

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           ++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   
Sbjct: 124 ESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIKAIESRMSKFASVQGVEIGVAIALIIFF 183

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           S  L     ++F+ ++   ++ F  +  L  VL +         + GL  F+YLE++DAS
Sbjct: 184 SYQLDAEHSHTFLIAALFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDAS 243

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+T N FII IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL
Sbjct: 244 FSFDGVIGAFALTTNLFIIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVL 303

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +VIM++QT+V IPE+ TG     LI LS  SS++
Sbjct: 304 AVIMYVQTLVHIPEVITGLIGAALIGLSFMSSLR 337


>gi|332187491|ref|ZP_08389228.1| integral membrane TerC family protein [Sphingomonas sp. S17]
 gi|332012420|gb|EGI54488.1| integral membrane TerC family protein [Sphingomonas sp. S17]
          Length = 370

 Score =  308 bits (788), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 142/325 (43%), Positives = 219/325 (67%), Gaps = 8/325 (2%)

Query: 28  GLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGI 87
           G  IGW  TH ++GT+  ++I ++L V+E+SLSF+NA++NA  L+ M+ +WQ+RFLTWGI
Sbjct: 19  GAWIGWTLTHDIAGTLGILWIVLVLGVLEVSLSFDNAVVNATVLRDMTPVWQRRFLTWGI 78

Query: 88  LIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMV 147
           +IAVFGMRI+FP++IV I + + PI+A+ LA   P  Y +II+ AHV ISGFGG FL MV
Sbjct: 79  IIAVFGMRILFPLVIVAIAARLGPIDAVVLAATDPVAYERIITGAHVGISGFGGAFLAMV 138

Query: 148 SLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSST 207
            LTFF + +   HWI  +E   + LS+I G+ I IVL  ++ IS  +P  E  +F+++  
Sbjct: 139 GLTFFLDEEKDSHWIGLIERPFAGLSRISGLAIGIVLLALYSISRAIPAEEAMTFLTAGI 198

Query: 208 AAIIIFYGINFLESVLSSD--------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISS 259
             ++ +  +  + ++L  D        ++  V   K GL  FLYLE++DAS S DGVI +
Sbjct: 199 FGLLAYIAVQAVGAILEKDDEEPTSGNAAATVAVAKSGLAAFLYLEVLDASFSFDGVIGA 258

Query: 260 FAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI 319
           FA++ N FII +GL IGA++VRSMT++++ +G L +Y+YLEHG++Y+I  L+ IM +   
Sbjct: 259 FALSNNLFIIALGLGIGAMFVRSMTVMLVDKGTLTEYRYLEHGAFYAIIALAAIMLISIR 318

Query: 320 VDIPEIFTGTSSTILIFLSIYSSIK 344
           V++PE  TG      I +++++S++
Sbjct: 319 VEVPETVTGLIGAAFIGMALFASVR 343


>gi|254689657|ref|ZP_05152911.1| hypothetical protein Babob68_05689 [Brucella abortus bv. 6 str.
           870]
 gi|256257908|ref|ZP_05463444.1| hypothetical protein Babob9C_11296 [Brucella abortus bv. 9 str.
           C68]
 gi|260755185|ref|ZP_05867533.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260884200|ref|ZP_05895814.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297248742|ref|ZP_06932460.1| hypothetical protein BAYG_01708 [Brucella abortus bv. 5 str. B3196]
 gi|260675293|gb|EEX62114.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873728|gb|EEX80797.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297175911|gb|EFH35258.1| hypothetical protein BAYG_01708 [Brucella abortus bv. 5 str. B3196]
          Length = 353

 Score =  308 bits (788), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 225/333 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGTVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLGIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +IM++QT+V IPE+ TG     LI LS  SS++
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLR 337


>gi|256061520|ref|ZP_05451664.1| hypothetical protein Bneo5_14300 [Brucella neotomae 5K33]
 gi|261325528|ref|ZP_05964725.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301508|gb|EEY05005.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 353

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 145/333 (43%), Positives = 224/333 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +IM++Q +V IPE+ TG     LI LS  SS++
Sbjct: 305 IIMYVQMLVHIPEVITGLIGAALIGLSFMSSLR 337


>gi|225627910|ref|ZP_03785946.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260169136|ref|ZP_05755947.1| hypothetical protein BruF5_12406 [Brucella sp. F5/99]
 gi|261758643|ref|ZP_06002352.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|225617073|gb|EEH14119.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|261738627|gb|EEY26623.1| conserved hypothetical protein [Brucella sp. F5/99]
          Length = 353

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 224/333 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRTIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV      ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIVGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +IM++QT+V IPE+ TG     LI LS  SS++
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLR 337


>gi|182677243|ref|YP_001831389.1| hypothetical protein Bind_0244 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633126|gb|ACB93900.1| protein of unknown function DUF475 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 348

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 220/333 (66%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +FR ++L T+        +GW  T T+SG +ST++I ++L V+EISLSF+NAI+NA  
Sbjct: 1   MRYFRGSLLFTILCLFLAGWLGWSLTGTISGVLSTLWIALVLGVLEISLSFDNAIVNATV 60

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ +  +W++RFL WGILIAV GMRI+FP+MIV I + I P++A+ LAI  P+ Y +II+
Sbjct: 61  LRGLDPVWRRRFLIWGILIAVVGMRILFPLMIVAIAAHIGPLDALFLAILEPRHYEQIIT 120

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H+ ISGFGG FL MVSL FFF+S  ++HWI   E  ++ L  +  I   IVL  ++ +
Sbjct: 121 DVHITISGFGGAFLAMVSLKFFFDSSKRVHWIGLFEKRLARLGDLDAITHTIVLLALYAV 180

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           S +L   +    + +    ++ F G+  + +VL           + GL+ FLYLE++DAS
Sbjct: 181 SRLLAPEDAAELIVAGIFGLVTFVGVEVIGNVLGGPGGRTGEVARVGLSGFLYLEVLDAS 240

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGV+ +FA+T N F+I +GL IGA++VRSMT++++ +G L++Y+YLEHG++Y+I  L
Sbjct: 241 FSFDGVVGAFALTNNLFVIALGLGIGAMFVRSMTVMLVDRGTLSEYRYLEHGAFYAILAL 300

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + +M L    DIPE+ TG  S  LI LS+  SI
Sbjct: 301 AGVMLLSARYDIPEVVTGLISACLIGLSLLGSI 333


>gi|121602667|ref|YP_989241.1| hypothetical protein BARBAKC583_0961 [Bartonella bacilliformis
           KC583]
 gi|120614844|gb|ABM45445.1| putative membrane protein [Bartonella bacilliformis KC583]
          Length = 350

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 150/337 (44%), Positives = 224/337 (66%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L  +F+WA   T+ G   G  IGW  T+++ G +   +IC  L ++EISLSF+N+I+NA+
Sbjct: 3   LFRYFKWAFSFTIIGVCLGGVIGWFETNSIIGILKYFFICCTLGILEISLSFDNSIVNAR 62

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +M+ +W +RFLTWGI+IAVFGMRIIFP+++V   + I+PI A+ LAI+ P  Y  I+
Sbjct: 63  ILGRMNQLWSRRFLTWGIIIAVFGMRIIFPLLVVAFAAWISPIAAVKLAIWEPDQYATIL 122

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + +H  I+ FGGTFLMMV L +FF+ + K+HW+ F+E     L  + GI I IVL +I  
Sbjct: 123 TDSHAGIAAFGGTFLMMVGLKYFFDPEKKVHWLPFIEKPAQKLGFLVGIDIAIVLILILF 182

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  + T +  + + +    ++ F  +  + + L S      T  K GL  FLYLEI+DA
Sbjct: 183 FSGQVVTADKLTVLLAMLYGLLTFLVVGAVGAFLDSKEMTLTTTAKGGLGSFLYLEILDA 242

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGV+ +FA + N FII IGL+IGA YVRSMT+++++ G L +Y+YLEHG++Y+I +
Sbjct: 243 SFSFDGVVGAFAFSHNLFIIAIGLSIGAFYVRSMTVMLVETGTLLRYRYLEHGAFYAILI 302

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+VIM++Q I+ +PEI TG     +I ++ YSS++ K
Sbjct: 303 LAVIMYMQIIMPVPEILTGFIGIFVIGMAFYSSLRFK 339


>gi|319407522|emb|CBI81170.1| conserved membrane hypothetical protein [Bartonella sp. 1-1C]
          Length = 344

 Score =  299 bits (765), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 157/345 (45%), Positives = 227/345 (65%), Gaps = 14/345 (4%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +FRWA   T+ G L G  IGW  T T+ G     +IC +L ++EISLSF+N+I+NA
Sbjct: 2   ALLGYFRWAFFFTIIGILGGALIGWLETGTIVGCFKYFFICCVLGILEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L KM+ +W+ RFLTWGILIAVFGMRIIFP+++V + + INPI A+ LAI+ P  Y  I
Sbjct: 62  RFLGKMNQLWRDRFLTWGILIAVFGMRIIFPLLVVAVAAWINPIAAVQLAIWEPHQYAAI 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSK-IKGIKIFIVLSII 187
           +  AH  I+ FGGTFLMMV L +FF+ + K+HW+ F+E     LS  ++   I I++ ++
Sbjct: 122 LMDAHNSIAAFGGTFLMMVGLKYFFDPEKKVHWLTFIEKPAQRLSSFVRIDIIIILILML 181

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGI---NFLE---SVLSSDSSNNVTHGKHGLNLF 241
           F    I+  N++       T  + + YG+    F+E   S+L S  +  +T  K G  LF
Sbjct: 182 FFSGQIIAENKL-------TVLLAMLYGLLTFLFVEATCSLLDSQKNTLITVSKGGAGLF 234

Query: 242 LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEH 301
           LYLE++DAS S DGV+ +FA + N FII IGL IGA YVR++T+++ + G L  Y+YLEH
Sbjct: 235 LYLEVLDASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRAITIMLFETGTLLHYRYLEH 294

Query: 302 GSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           G++Y+I VL+VIM+ Q I+ IPE  TG     +I ++ YSS++ K
Sbjct: 295 GAFYAILVLAVIMYTQIIISIPEALTGLIGICIIGMAFYSSLRFK 339


>gi|319899174|ref|YP_004159267.1| hypothetical protein BARCL_1015 [Bartonella clarridgeiae 73]
 gi|319403138|emb|CBI76696.1| conserved membrane protein of unknown function [Bartonella
           clarridgeiae 73]
          Length = 350

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 150/339 (44%), Positives = 222/339 (65%), Gaps = 2/339 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +FRW    T+ G   G  IGW  T T+ G +   +IC +L ++EISLSF+N+I+NA
Sbjct: 2   ALLGYFRWPFFFTIIGIFWGGLIGWLETGTIVGCLKYFFICCVLGILEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L  M+ +W++RFLTWGILIAVFGMRI+FP+++V + + INPI A+ LAI+ P  Y  I
Sbjct: 62  RFLGAMNQLWRRRFLTWGILIAVFGMRIVFPLLVVAVSAWINPIAAVKLAIWDPHQYAAI 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+ FGGTFLMMV L +FF+S+ K+HW+ F+E     L     I I ++L ++ 
Sbjct: 122 LTDAHNGIAAFGGTFLMMVGLKYFFDSEKKVHWLVFIEKPAQKLGSFVKIDIIVILMLML 181

Query: 189 GIS-NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
             S  I+  N++   + +    ++ F  +  + S+L S     +   K G   FLYLE++
Sbjct: 182 FFSYQIVAENKLIVLL-AMLYGLLTFLIVEAICSLLDSQKDTLIAVSKGGAGSFLYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           D+S S DGVI +FA + N FII IGL IGA YVR+MT+++ + G L  Y+YLEHG++Y+I
Sbjct: 241 DSSFSFDGVIGAFAFSHNLFIIAIGLGIGAFYVRAMTIMLFETGTLLHYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL+VIM++Q I+ IPE  TG     +I ++ YSSI+ K
Sbjct: 301 LVLAVIMYMQIIMSIPEALTGLIGVCIIGIAFYSSIRFK 339


>gi|326387901|ref|ZP_08209507.1| hypothetical protein Y88_0816 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207947|gb|EGD58758.1| hypothetical protein Y88_0816 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 345

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 141/338 (41%), Positives = 222/338 (65%), Gaps = 3/338 (0%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F  ++L T+A     L  GW  T ++  T   +++ I+LAV+EISLSF+NA++NA 
Sbjct: 1   MLRQFTGSLLFTIAALFATLAYGWFLTGSVGATAGLIWVVIVLAVLEISLSFDNAVVNAA 60

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +M  IWQ+RFLTWG+L AVFGMRI+FP++IV + + + PI+A+ L++  P  Y +I+
Sbjct: 61  VLSEMDDIWQRRFLTWGMLFAVFGMRILFPLVIVALAAGLGPIDALKLSLTEPARYEQIV 120

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           S AH+ ISGFGG FL +V +T+F N +  +HWI +LE  +  ++ I+  +I ++L  +  
Sbjct: 121 SSAHIAISGFGGAFLALVGMTYFVNPEKTVHWIGWLERHLVAIATIRAAEIALLLVAMSV 180

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
           I+  LP +E   F+ +    I+ F  +  + +VL +        G   K GL  F+YL +
Sbjct: 181 IARFLPAHEALEFIEAGIGGIVAFVLVEGIGTVLEAREEARRAAGLAMKSGLGGFIYLNV 240

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FA++ N  II IGL++GA++VRS+TLL+++QG LN+Y+YLEHG++++
Sbjct: 241 LDASFSFDGVIGAFALSNNMVIIAIGLSVGAMFVRSITLLLVRQGTLNEYRYLEHGAFWA 300

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           I  L  IM L   V++PE  TG     LI +S++SS++
Sbjct: 301 IVALGTIMLLSPRVEVPETVTGLIGAALIGVSLWSSLR 338


>gi|319406022|emb|CBI79653.1| conserved membrane hypothetical protein [Bartonella sp. AR 15-3]
          Length = 350

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 224/338 (66%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +F+WA   TV G L G  IGW  T T+ G++   +IC IL ++EISLSF+N+I+N 
Sbjct: 2   ALLGYFKWAFFFTVIGMLLGAFIGWLETGTIVGSLKYFFICCILGILEISLSFDNSIINV 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L++M+ +W++RFLTWG+LIAVFGMRIIFP+++V I + INPI A+ LAI+ P  Y  I
Sbjct: 62  RFLKEMNQLWRRRFLTWGVLIAVFGMRIIFPLLVVAIAAWINPIAAIKLAIWDPHRYAAI 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +  AH  I+ FG TFLMMV L +FF+S+ K+HW+ F+E     L     I I I+L ++ 
Sbjct: 122 LMDAHKGIAAFGATFLMMVGLKYFFDSEKKIHWLVFIEKPAQKLGSFVQIDIIIILMLML 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
            IS  +      + + S    ++ F  +  + S+L S  +  +   K G   FLYLE++D
Sbjct: 182 FISEQIVAENKLTVLFSMLYGLVTFLLVEAICSLLDSQKNTLIAVAKGGAGSFLYLEVLD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+ +FA + N FII IGL IGA YVR+MT+++ + G L  Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRAMTIMLFETGTLLHYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +L++IM+++ I+ IPE+ TG     +I ++ YSSI+ K
Sbjct: 302 ILAMIMYIEIIMSIPEVLTGFIGVCIIGMAFYSSIRFK 339


>gi|319408838|emb|CBI82495.1| conserved membrane hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 346

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 225/338 (66%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +FRWA   T+ G   G  +GW  T +L G +   +IC +L ++EISLSF+N+I+NA
Sbjct: 2   ALLGYFRWAFFFTIIGVFGGGFVGWFETGSLIGFLKYFFICCVLGILEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L KM  +W +RFLTWGILIAVFGMRIIFP++IV   + I+PI A+ LA++ P  Y +I
Sbjct: 62  RILGKMDQLWSRRFLTWGILIAVFGMRIIFPLLIVAFAAWISPIAAVKLALWEPHQYAEI 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AHV I+ FGGTFLMMV L +FF+ + ++HW+ F+E     +    G+ I IVL ++ 
Sbjct: 122 LANAHVGIAAFGGTFLMMVGLKYFFDPKKEVHWLAFIEKPAQKVGSFVGVDIAIVLILML 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
                + T    + + +    ++ F  +  + S+L S  +  VT  K G+  FLYLEI+D
Sbjct: 182 FFLGQITTENKLTVLFAMLYGLLTFLVVEAVSSLLDSQKNTLVTIAKGGVGSFLYLEILD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+S+FA + N FII IGL IGA YVR++T+++++ G L  Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVMSAFAFSHNLFIIAIGLGIGAFYVRAITIMLVETGTLLHYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VL+VIM++Q I+ +PE  TG     ++ ++ YSSI+ K
Sbjct: 302 VLAVIMYIQIIMPVPEALTGLIGVCILGVAFYSSIRFK 339


>gi|148558899|ref|YP_001259351.1| hypothetical protein BOV_1419 [Brucella ovis ATCC 25840]
 gi|148370156|gb|ABQ60135.1| putative membrane protein [Brucella ovis ATCC 25840]
          Length = 319

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 208/302 (68%)

Query: 43  ISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMI 102
           +S   IC +L+V+EISLSF+NAI+NA+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ I
Sbjct: 2   VSVFIICAVLSVLEISLSFDNAIVNARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLAI 61

Query: 103 VCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWI 162
           V I    +PI A+ LAI+ P +Y ++I+++H  I+ FGGTFL+MV + +FF+ +  +HWI
Sbjct: 62  VAIAMWTDPISALKLAIWQPNEYARVIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWI 121

Query: 163 HFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESV 222
             +E  M   + ++G++I + +++I   S  L  +  ++FV +    ++ F  +  L  V
Sbjct: 122 RMIESRMPKFASVQGVEIGVAIALIIFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGEV 181

Query: 223 LSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRS 282
           L +         + GL  F+YLE++DAS S DGVI +FA+T N F+I IGL IGA YVRS
Sbjct: 182 LDATQEQMDMVHRGGLGAFIYLEVLDASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVRS 241

Query: 283 MTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           +T++++++  L +Y+YLEHG++Y+I VL++IM++QT+V IPE+ TG     LI LS  SS
Sbjct: 242 LTIMLVERKTLGQYRYLEHGAFYAILVLAIIMYVQTLVHIPEVITGLIGAALIGLSFMSS 301

Query: 343 IK 344
           ++
Sbjct: 302 LR 303


>gi|310817114|ref|YP_003965078.1| hypothetical protein EIO_2703 [Ketogulonicigenium vulgare Y25]
 gi|308755849|gb|ADO43778.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 348

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 147/336 (43%), Positives = 227/336 (67%), Gaps = 2/336 (0%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQ-FTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           + +F+W  +VT  G +    +GW      +S  +S +++ I+LA++EISLSF+NAI+NA 
Sbjct: 5   LKYFKWPFIVTATGLILSFWLGWNSGPGGMSPALSFLFVGIVLAILEISLSFDNAIVNAN 64

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M+ +WQ+RFLTWGILIAVFGMR++FP++IV + + I PIEA+ LA      Y  II
Sbjct: 65  KLKDMTPVWQRRFLTWGILIAVFGMRVVFPVLIVVVAARIGPIEAIWLAATDEAQYAAII 124

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           ++AH  I+ FG TFLMMV L FF NS+  +HWI   E  ++H S ++G ++ +VL I+  
Sbjct: 125 NEAHPSIAAFGSTFLMMVGLKFFMNSEKDVHWIGGFERWLNHFSSVRGFEVALVLVIVMI 184

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            SN +P  E  +F++S+   ++ F  +  +  +L    +   T  K G   FLYLE++DA
Sbjct: 185 FSNFVPEGEELTFLTSAIYGLLTFLIVEVIGHLLDEQQAALSTAAKGGFGAFLYLEVLDA 244

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++  L +++YLEHG++YSI +
Sbjct: 245 SFSFDGVIGAFALTQNLFLIAIGLGIGAMYVRSMTIMLVERQTLAQFRYLEHGAFYSILI 304

Query: 310 LSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIK 344
           LSVIM +QT+ + +PE+ TG      I  ++++SI+
Sbjct: 305 LSVIMLIQTLHIHVPEVITGLLGAGFIATALWASIR 340


>gi|319404526|emb|CBI78131.1| conserved membrane hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 344

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 152/339 (44%), Positives = 226/339 (66%), Gaps = 2/339 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +FRWA   T+ G L G  IGW  T T+ G     +IC +L ++EISLSF+N+I+NA
Sbjct: 2   ALLGYFRWAFFFTIIGILGGGLIGWLETGTIVGCFKYFFICCVLGILEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L KM+ +W+ RFLTWGILIAVFGMRIIFP+++V + + INPI A+ LAI+ P  Y  I
Sbjct: 62  RFLGKMNQLWRHRFLTWGILIAVFGMRIIFPLLVVAVAAWINPIAAVQLAIWEPHQYAAI 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSK-IKGIKIFIVLSII 187
           ++  H  I+ FGGTFLMMV L +FF+ + K+HW+ F+E     LS  ++   I I++ ++
Sbjct: 122 LTDTHDSIAAFGGTFLMMVGLKYFFDPEKKVHWLTFIEKPAQRLSSFVRIDIIIILILML 181

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
           F    I+  N++ + + +    ++ F  +    S+L S  +  +T  K G  LFLYLE++
Sbjct: 182 FFSGQIVAENKL-TVLLAMLYGLLTFLIVEATCSLLDSQKNTLITVSKGGAGLFLYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGV+ +FA + N FII IGL IGA YVR++T+++ + G L  Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRAITIMLFETGTLLHYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL+VIM++Q I+ IPE  TG     +I ++ YSS++ K
Sbjct: 301 LVLAVIMYMQIIISIPEALTGLIGICIIGMAFYSSLRFK 339


>gi|296283953|ref|ZP_06861951.1| hypothetical protein CbatJ_10031 [Citromicrobium bathyomarinum
           JL354]
          Length = 352

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 136/338 (40%), Positives = 221/338 (65%), Gaps = 2/338 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ H+  ++L T+  F+      W    ++      ++I ++L+++EISLSF+NA++NA
Sbjct: 3   TLLRHYWGSLLFTLVCFIAAGFYAWNAGGSVGSVAHVLWIVLVLSILEISLSFDNAVVNA 62

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M   WQ+RFLTWGILIAVFGMRI+FP+ IV + + ++P+ A++L++  P+ Y  I
Sbjct: 63  TVLREMDEKWQRRFLTWGILIAVFGMRIVFPLAIVAVAANLDPLSAIDLSLNDPERYEAI 122

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +S AHV I+GFGG FL MV L FFF+    + WI  LE+A+   S+I+  +I I+L +++
Sbjct: 123 VSSAHVGIAGFGGAFLTMVGLNFFFDGDKDVDWIRGLELALRRFSEIRAAEIGILLLMLY 182

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG--KHGLNLFLYLEI 246
           GIS +LP  E   F+++    ++ +  ++ + +VL       +  G  + GL  FLYLE+
Sbjct: 183 GISTMLPEGEAMVFLTAGILGLVTYIAVDAIGTVLDKVERRKMAEGAVRSGLGGFLYLEV 242

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FA++ N  II +GL+IGA++VRSMT+ +++ G L KY++LEHG++++
Sbjct: 243 LDASFSFDGVIGAFALSNNMLIIALGLSIGALFVRSMTVHLVRAGTLTKYRFLEHGAFWA 302

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           I  L +IM L     I E  TG    +LI +S+  S++
Sbjct: 303 IIALGLIMLLSAKFHISESITGLIGAVLIGISLLWSMR 340


>gi|149184855|ref|ZP_01863173.1| hypothetical protein ED21_29093 [Erythrobacter sp. SD-21]
 gi|148832175|gb|EDL50608.1| hypothetical protein ED21_29093 [Erythrobacter sp. SD-21]
          Length = 356

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 138/337 (40%), Positives = 228/337 (67%), Gaps = 3/337 (0%)

Query: 13  HFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQ 72
           ++ +++L T   F   +  GW  T +++ T+  ++I ++L+++E+SLSF+NA++NA  L+
Sbjct: 7   YYTFSLLFTAVCFALAVWYGWSSTGSITATLGILWIVVVLSILEVSLSFDNAVVNATVLR 66

Query: 73  KMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQA 132
            M  +WQ+RFLT GILIAVFGMRI+FPI IV + + + P EA++L++  PQ Y +I+S A
Sbjct: 67  DMDPVWQQRFLTIGILIAVFGMRIVFPIAIVSLAAGVGPGEAVSLSLNDPQRYEQIVSDA 126

Query: 133 HVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISN 192
           HV I+GFGG FL MV LTFFF     +HWI  LE  ++  S +  ++I +VLS+++G+S 
Sbjct: 127 HVSIAGFGGAFLAMVGLTFFFEEDKDVHWIAVLERTINKFSNVPAVEIGLVLSLVYGVST 186

Query: 193 ILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEIIDA 249
           +L  ++  +F++++   ++ F  ++ + +++ +  +     G   K GL  FLYLE++DA
Sbjct: 187 LLSPDDAITFLTAAILGLVTFIAVHAIAAIIEAQEARKKAAGEIVKSGLGGFLYLEVLDA 246

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA++ N  II +GL++GA++VRSMT+ +++ G L +Y+YLEHG++++I V
Sbjct: 247 SFSFDGVIGAFALSNNMIIIALGLSVGAMFVRSMTIHLVRTGTLAQYRYLEHGAFWAIIV 306

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L +IM L     IPE  TG    +LI LS + S+++ 
Sbjct: 307 LGIIMLLSARWHIPETVTGLLGAVLIGLSFWWSVRHN 343


>gi|332185742|ref|ZP_08387489.1| integral membrane TerC family protein [Sphingomonas sp. S17]
 gi|332014100|gb|EGI56158.1| integral membrane TerC family protein [Sphingomonas sp. S17]
          Length = 362

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 209/317 (65%), Gaps = 1/317 (0%)

Query: 31  IGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIA 90
           +G+Q T TL GT+S ++I  +L V+E+SLSF+NA++NA  L+ M   W++RFLTWGILIA
Sbjct: 23  LGFQSTGTLPGTLSVLWIVAVLGVLEVSLSFDNAVVNATVLRDMDDKWRRRFLTWGILIA 82

Query: 91  VFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLT 150
           VFGMRI+FP+ IV I + + PIEA+ LA   P  Y +II+ AHV ISGFGG+FL MV L 
Sbjct: 83  VFGMRIVFPLAIVAIAAHMGPIEAIKLAAGDPVRYEQIITSAHVGISGFGGSFLAMVGLN 142

Query: 151 FFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAI 210
           FF   +   HW+  +E  ++ L +I G+   IVL  ++ IS  +P  E  +F+++    +
Sbjct: 143 FFLGDEKDEHWLGVIERPLAALREISGLATGIVLLALYTISQFIPVEEAMTFLTAGIFGL 202

Query: 211 IIFYGINFLESVLS-SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFII 269
           + +  ++ +  +L     +      + G   FLYLE++DAS S DGVI +FA++ N FII
Sbjct: 203 LTYIAVHAVGVLLEGDGDAATGAAARSGFAAFLYLEVLDASFSFDGVIGAFALSNNLFII 262

Query: 270 VIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGT 329
            +GL IGA++VRSMT++++ +G L +Y+YLEHG++Y+I  L+ IM L    +IPE  TG 
Sbjct: 263 ALGLGIGAMFVRSMTIMLVDKGTLTQYRYLEHGAFYAILALAAIMLLSVRFEIPETVTGL 322

Query: 330 SSTILIFLSIYSSIKNK 346
               LI LS ++S+++ 
Sbjct: 323 IGATLIGLSFWASVRSN 339


>gi|85709685|ref|ZP_01040750.1| hypothetical protein NAP1_12408 [Erythrobacter sp. NAP1]
 gi|85688395|gb|EAQ28399.1| hypothetical protein NAP1_12408 [Erythrobacter sp. NAP1]
          Length = 350

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 140/335 (41%), Positives = 224/335 (66%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ HF  ++L T      G   GW    T+ G +S ++IC +LAV+E+SLSF+NA +NA 
Sbjct: 1   MLKHFWGSLLFTAVCLALGGWYGWALHGTIGGMLSILWICAVLAVLEVSLSFDNAAVNAS 60

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M  +WQ+RFLTWGI IAVFGMRI+FPI+IV + +++ PI+A+ LA+  P +Y +I+
Sbjct: 61  ILKDMDPVWQQRFLTWGIAIAVFGMRIVFPIVIVMVAASLGPIDAVRLALSDPAEYQRIV 120

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           S AH+ + GFGG FL MV L FFF++  +L+WI  +E  ++ ++ I+ I I +VL+  + 
Sbjct: 121 SDAHIGLMGFGGAFLGMVGLKFFFDADKELNWIASIERPLAKVADIEAISIGLVLAATWA 180

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S +L   +  +F+ ++   ++ +  +  +  VL   + ++    K G   FLYLE++DA
Sbjct: 181 TSTMLADADALTFIIAAIGGLLTYLAVEIVNHVLEPPTPSSGDVAKAGFGAFLYLEVLDA 240

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA+T N  II IGL IGA++VRSMT+ ++++G +++Y+YLEHG++Y+I  
Sbjct: 241 SFSFDGVIGAFALTNNLIIIAIGLGIGAMFVRSMTIFLVRKGTMSEYRYLEHGAFYAILA 300

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           L+ IM++ T   IPE+ TG    +LI L+ +SS++
Sbjct: 301 LATIMYINTFSHIPEVITGLIGAVLIGLAFWSSVR 335


>gi|292493000|ref|YP_003528439.1| hypothetical protein Nhal_2992 [Nitrosococcus halophilus Nc4]
 gi|291581595|gb|ADE16052.1| protein of unknown function DUF475 [Nitrosococcus halophilus Nc4]
          Length = 340

 Score =  269 bits (687), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 216/339 (63%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF+++ LVT  G +            L G  + ++I  IL+++E+SLSF+NA++NA  
Sbjct: 1   MRHFKYSFLVTAVGLIAAF---------LWGGPTGLFIAAILSILEVSLSFDNAVVNASV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M   WQ RFLTWGILIAVFGMR++FPI IV +V+ I  +E   +A+  P+ Y   + 
Sbjct: 52  LKDMDPKWQARFLTWGILIAVFGMRLVFPIAIVAVVADIEMLEVTQMALNDPETYSTHLL 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            +HV IS FGG FL+MV L+F  +   +LHW+  +E  ++ + K++ I+I I L++++G+
Sbjct: 112 ASHVEISAFGGMFLLMVFLSFLLDETKELHWLGIVEEKLAGIGKLESIEIVIALAVLWGL 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-VTH-GKH-GLNLFLYLEII 247
             +LP  E  S + S  + I++F  +     +   +     V H  +H GL  FLYLE++
Sbjct: 172 QGVLPPEEKLSALLSGISGIMLFVLVGSASGLFEEEEKGEAVVHAARHSGLMGFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAITK+  II++GL +GA++VRS+T+ ++++G L++Y +LEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAITKDVIIIMLGLAVGAMFVRSITVYLVRKGTLDEYVFLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L+ IM   T V IPE+ TG      I LS+ SS++ +
Sbjct: 292 GALAFIMLASTKVHIPEVITGLIGAAFIGLSLVSSVRYR 330


>gi|42523881|ref|NP_969261.1| hypothetical protein Bd2441 [Bdellovibrio bacteriovorus HD100]
 gi|39576088|emb|CAE80254.1| conserved hypothetical membrane protein [Bdellovibrio bacteriovorus
           HD100]
          Length = 355

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 138/337 (40%), Positives = 222/337 (65%), Gaps = 3/337 (0%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + + T  G +    +G  +  T+   +  ++I  ILA++EISLSF+NAI+NA  
Sbjct: 13  MKYFTGSFVFTFFGLIASYFVGHYYGGTVGAGLQALFIATILAILEISLSFDNAIVNAVV 72

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++M+ +W+ RFLTWG+LIAVFGMR++FP++IV  ++ +NP EA+ +A   P DY K++ 
Sbjct: 73  LKEMTPVWRHRFLTWGMLIAVFGMRLVFPLLIVTFMADVNPWEALVIAATKPDDYAKMML 132

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHL-SKIKGIKIFIVLSIIFG 189
            AH+ ++ FGG+FL+MV+L +F++    LHWI F+E    ++ SK++ I++ + L I+  
Sbjct: 133 DAHLQVAAFGGSFLLMVALKYFYDGSKDLHWIPFIEKPTRYIGSKVEAIEVCLSLIILIL 192

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVL-SSDSSNNVTHGKHGLNLFLYLEIID 248
           I+N L   E   F+ +  A +I +  ++ + S L +SD      H K    +FLYLE++D
Sbjct: 193 ITNFLKQEEALPFLMAGMAGLITYVIVDGIGSWLEASDDQIKDVH-KASAGMFLYLEVLD 251

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+ +FAIT N FII+IGL+IGA +VRS+T++ +++  L K+ +LEHG++Y+I 
Sbjct: 252 ASFSFDGVVGAFAITHNLFIIMIGLSIGAFFVRSLTIMFVEKEALTKFAFLEHGAFYAIG 311

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +L++IM     + IPE FTG S  I+I  S   S+K 
Sbjct: 312 LLAMIMLADPFLHIPEWFTGLSGGIIILTSFIWSLKK 348


>gi|300114608|ref|YP_003761183.1| hypothetical protein Nwat_2028 [Nitrosococcus watsonii C-113]
 gi|299540545|gb|ADJ28862.1| protein of unknown function DUF475 [Nitrosococcus watsonii C-113]
          Length = 340

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 212/339 (62%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HFR++ LVTV G +            L G  + ++I  IL V+EISLSF+NA++NA  
Sbjct: 1   MRHFRYSFLVTVVGLIAAF---------LWGGPAGLFIAAILGVLEISLSFDNAVVNASV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M   WQ RFLTWGILIAVFGMR++FP+ IV IV+ I  +E   +A+  P  Y   + 
Sbjct: 52  LKDMDPKWQARFLTWGILIAVFGMRLVFPVAIVAIVADIGMLEVTQMALNDPDTYSAHLH 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            +HV IS FGG FL+MV L+F  +   +LHW+   E  +S + K++ I+I I L +++ +
Sbjct: 112 ASHVDISAFGGMFLLMVFLSFLLDETKELHWLGRAEEKLSRIGKLESIEIVIALGVLWAL 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-SDSSNNVTHG--KHGLNLFLYLEII 247
            + LP  E    + +  + +++F  +     +    ++   V H   + G+  FLYLE++
Sbjct: 172 QSFLPPEEKLGAMLAGISGVMLFVIVGSASGLFEVEETGEAVAHAAKRSGVMGFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAI+K+  II++GL IGA++VRS+T+ ++++G L++Y +LEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAISKDVIIIMLGLAIGAMFVRSITVYLVRKGTLSEYVFLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L++IM   T V IPE+ TG      I LS+ SSI+ +
Sbjct: 292 GALALIMLASTKVHIPEVITGMIGAAFIGLSLLSSIRYR 330


>gi|77164520|ref|YP_343045.1| hypothetical protein Noc_1007 [Nitrosococcus oceani ATCC 19707]
 gi|254434206|ref|ZP_05047714.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
 gi|76882834|gb|ABA57515.1| Protein of unknown function DUF475 [Nitrosococcus oceani ATCC
           19707]
 gi|207090539|gb|EDZ67810.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
          Length = 333

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 214/339 (63%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF+++ LVTVAG +            L G  + ++I  IL V+EISLSF+NA++NA  
Sbjct: 1   MRHFKYSFLVTVAGLVAAF---------LWGGPAGLFIAAILGVLEISLSFDNAVVNASV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M   WQ RFLTWGILIAVFGMR++FP+ IV IV+ I  +E   +A+  P  Y   + 
Sbjct: 52  LKDMDPKWQARFLTWGILIAVFGMRLVFPVAIVAIVADIGILEVTQMALNDPDAYSAHLL 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            +HV IS FGG FL+MV L+F  +   +LHW   +E  ++ + K++ I+I I L +++ +
Sbjct: 112 ASHVDISAFGGMFLLMVFLSFLLDETKELHWWGLVEEKLAGIGKLESIEIVIALGVLWAL 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-SDSSNNVTHG--KHGLNLFLYLEII 247
            + LP  E    + +  + +++F  +     +    ++   VTH   + G+  FLYLE++
Sbjct: 172 QSFLPPEEKLDAMLAGISGVMLFVIVGSASGLFEVEETGEAVTHAAKRSGVMGFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAI+K+  II++GL IGA++VRS+T+ ++++G L++Y +LEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAISKDVIIIMLGLAIGAMFVRSITVYLVRKGTLSEYVFLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L++IM   T V IPE+ TG      I LS+ SSI+ +
Sbjct: 292 GALALIMLASTKVHIPEVVTGLIGAAFIGLSLLSSIRYR 330


>gi|90409338|ref|ZP_01217428.1| hypothetical protein PCNPT3_06878 [Psychromonas sp. CNPT3]
 gi|90309556|gb|EAS37751.1| hypothetical protein PCNPT3_06878 [Psychromonas sp. CNPT3]
          Length = 344

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 207/325 (63%), Gaps = 16/325 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR + LVT  G L G          L G    +++  +L+V+EISLSF+NA++NA  
Sbjct: 4   LRFFRGSFLVTFIGALLGY---------LIGGFEALFLIFVLSVLEISLSFDNAVVNATV 54

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+KM ++W+KRFLTWGILI+VFGMR+IFP+ +V +V+ ++P  A+ +AI SP  Y  ++ 
Sbjct: 55  LKKMDALWRKRFLTWGILISVFGMRVIFPVAVVSVVAGVSPWSAILIAINSPSQYQVLMQ 114

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK-GIKIFIVLSIIFG 189
            AH+ + GFGG+FL++V L FF N     HWI  +E  + H+ K+K    IF VL I+  
Sbjct: 115 SAHISLMGFGGSFLLLVGLDFFLNEDKTEHWIGIIERPLLHIGKLKFSAPIFTVLGILLI 174

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN------VTHGKHGLNLFLY 243
               LP  + YSF++S  + I+ F  I+ + + +             V   K  L +FLY
Sbjct: 175 AGLYLPDADQYSFIASGASGIVAFTLIHKISAQMEKREDRRASCNGTVVVAKSSLGMFLY 234

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           LE++DAS S DGVI +FAIT N  II  GL IGA++VRS+T++ ++  +L +Y+YL+HG+
Sbjct: 235 LELLDASFSFDGVIGAFAITTNLLIIATGLGIGAMFVRSLTIMFVENNVLEEYQYLQHGA 294

Query: 304 YYSIFVLSVIMFLQTIVDIPEIFTG 328
           +Y++  L++IMFL+T + +PEI TG
Sbjct: 295 FYAVIALAIIMFLKTFIHVPEILTG 319


>gi|325518381|gb|EGC98102.1| hypothetical protein B1M_43243 [Burkholderia sp. TJI49]
          Length = 338

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 197/308 (63%), Gaps = 7/308 (2%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           L G +  + I  +L+V+EISLS +NA++NA  L+  S  W+ RF+ +G+ +AVFGMR++F
Sbjct: 21  LLGGVKDMLIVAVLSVLEISLSLDNAVVNASVLKNWSEKWRNRFMVFGLPVAVFGMRLVF 80

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNK 158
           P++IV ++  I   +A+ LAI SP+ Y  +++ AH  +S FGG FL+MV   F  +++  
Sbjct: 81  PLLIVAVIGHIGLWDALRLAIESPEQYAAMLTSAHHEVSAFGGAFLLMVFFKFMLDTEKD 140

Query: 159 LHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIF---YG 215
            HWI FLE  M HL +I  +++ + L II   S  +P  E  SF+ +    +I F   +G
Sbjct: 141 EHWIGFLEGPMRHLGRITALEVALTLGIIIVASFYVPGAEQVSFLLAGAFGVIGFVIAHG 200

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           +  L  V   D+   V   + GL  FLYLE++D+S S DGVI +FA++ N F+I +GL +
Sbjct: 201 VGDL--VGGEDTGTRVV--REGLAGFLYLEVLDSSFSFDGVIGAFALSNNIFLIALGLGV 256

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA Y+R MTL++LK+G L +Y+YLEHG++++I  L+ IMFL    D+PE+ TG     +I
Sbjct: 257 GAAYIREMTLVLLKKGTLAQYRYLEHGAFWAIGALAAIMFLGVKFDVPEVVTGLVGAAMI 316

Query: 336 FLSIYSSI 343
             +++SSI
Sbjct: 317 GAAVWSSI 324


>gi|329849078|ref|ZP_08264106.1| integral membrane protein TerC family protein [Asticcacaulis
           biprosthecum C19]
 gi|328844141|gb|EGF93710.1| integral membrane protein TerC family protein [Asticcacaulis
           biprosthecum C19]
          Length = 378

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/315 (40%), Positives = 201/315 (63%), Gaps = 1/315 (0%)

Query: 33  WQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVF 92
           +Q     S  +  V++  +L V+E SLS +NA++NA  L+ M  +WQ+RFLTWGILIAVF
Sbjct: 25  YQSGGMASAVLQMVFLACVLGVMETSLSLDNAVVNASILKDMDPVWQRRFLTWGILIAVF 84

Query: 93  GMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFF 152
           GMRIIFPI+IV I + + P EA  +AI   + Y  I++ AH+ ISGFGG FLM+V L FF
Sbjct: 85  GMRIIFPILIVSISAMVTPWEATRIAIMDHERYETIVTGAHIGISGFGGAFLMLVGLNFF 144

Query: 153 FNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIII 212
           F+   + HW+ F+E  ++ L+KI      +   +I G+S ++   E  +F+ +  + ++ 
Sbjct: 145 FDDDREHHWLGFIERPLAALAKIPFSPYIVTALLIGGLSFMVHGEEQKTFLIAGLSGVVT 204

Query: 213 FYGIN-FLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVI 271
           F+ +  F + V   +  +     + G   F+YLE +DAS S DGVI +FAIT +  +I +
Sbjct: 205 FFAVQKFGDWVGGGEKDHTGAVVRTGAGGFIYLEFLDASFSFDGVIGAFAITNDIILIAL 264

Query: 272 GLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSS 331
           GL IGA++VRSMT+ +++ G L ++++LE G++Y+I  L+ IM L   + IPE+ TG   
Sbjct: 265 GLGIGAMFVRSMTIALVRGGHLAEFRFLEAGAFYAIIALASIMLLSIKLHIPEVVTGLIG 324

Query: 332 TILIFLSIYSSIKNK 346
            I+I +S++ SI++K
Sbjct: 325 AIIIGVSLWVSIEHK 339


>gi|15807218|ref|NP_295948.1| hypothetical protein DR_2226 [Deinococcus radiodurans R1]
 gi|6460030|gb|AAF11774.1|AE002055_6 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 349

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 138/337 (40%), Positives = 213/337 (63%), Gaps = 11/337 (3%)

Query: 14  FRWAILVTVAGFLCGLGIGW----QFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           F +A LVTV   +C     W    +  HTL+   + + I ++L V+EISLSF+NA++NA 
Sbjct: 8   FGFATLVTV---ICLAIAAWDGYARGGHTLAALANALVIAVLLGVLEISLSFDNAVVNAS 64

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  WQKRFL WGILIAVFGMR IFPI+IV + S +   E +  A  +P  Y + +
Sbjct: 65  VLRTMSEKWQKRFLLWGILIAVFGMRFIFPIVIVALTSGLGMGEVIREAFGNPDIYAEHL 124

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
            +AHV IS FGG FLMMV L +F +   + HW+  LE  +  + K+  ++  IV +++  
Sbjct: 125 EKAHVAISAFGGAFLMMVFLKYFMDPDKEEHWLTPLERPLGRIGKLDTVQAVIVGALLLI 184

Query: 190 ISNI-LPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
           ++++ +   E +  +++    ++++  ++ + ++  +D+      G  GL  FLYLEI+D
Sbjct: 185 LTHLFVAPAEQFQALTAGLVGLLVYLVMDAIGNLFETDNLAT-KAGAAGLASFLYLEILD 243

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS SLDGVI +FA+TK+  +I  GLTIGAI+VRS+T++M+K+G L  Y++LEHG++Y I 
Sbjct: 244 ASFSLDGVIGAFALTKDIVLIAAGLTIGAIFVRSLTVMMVKKGTLEAYRFLEHGAHYGIG 303

Query: 309 VLSVIMFLQTIVD--IPEIFTGTSSTILIFLSIYSSI 343
            L+VIM L    D  IPE+ TG      I L++++S+
Sbjct: 304 ALAVIMLLSMNRDIHIPEVVTGLIGAGFIVLAVWASL 340


>gi|134296360|ref|YP_001120095.1| hypothetical protein Bcep1808_2261 [Burkholderia vietnamiensis G4]
 gi|134139517|gb|ABO55260.1| protein of unknown function DUF475 [Burkholderia vietnamiensis G4]
          Length = 338

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 197/308 (63%), Gaps = 7/308 (2%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           L G +  + I  +L+V+EISLS +NA++NA  L+  S  W+ RF+ +G+ +AVFGMR++F
Sbjct: 21  LLGGVKDMLIVAVLSVLEISLSLDNAVVNASVLKNWSEKWRNRFMVFGLPVAVFGMRLVF 80

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNK 158
           P++IV ++  I  ++A+ LAI +P+ Y  +++ AH  +S FGG FL+MV   F  + +  
Sbjct: 81  PLLIVAVIGHIGLLDALTLAIEAPEKYAAVLTSAHHEVSAFGGAFLLMVFFKFMLDKEKD 140

Query: 159 LHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIF---YG 215
            HWI FLE  M HL +I  +++ + L+I+   S  +P  E  SF+ +    +I F   +G
Sbjct: 141 EHWIGFLEGPMRHLGRITALEVALTLAIVIVASFYVPAAEQVSFLLAGAFGVIGFVIAHG 200

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           +  L  V   D+   V   + G+  F+YLE++D+S S DGVI +FA++ N F+I +GL +
Sbjct: 201 VGDL--VGGEDTGTRVV--REGVAGFMYLEVLDSSFSFDGVIGAFALSNNIFLIALGLGV 256

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA Y+R MTL++LK+G L +Y+YLEHG++++I  L+ IMF+   +D+PEI TG      I
Sbjct: 257 GAAYIREMTLVLLKKGTLAQYRYLEHGAFWAIGALATIMFVGVKLDVPEIVTGLIGAATI 316

Query: 336 FLSIYSSI 343
             ++ SSI
Sbjct: 317 AAAVGSSI 324


>gi|237746918|ref|ZP_04577398.1| predicted protein [Oxalobacter formigenes HOxBLS]
 gi|229378269|gb|EEO28360.1| predicted protein [Oxalobacter formigenes HOxBLS]
          Length = 336

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 127/304 (41%), Positives = 198/304 (65%), Gaps = 1/304 (0%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G  + V     L V+E++LSF+NA++NA  L+  + +W++ FL WGI IAVFGMR++FP+
Sbjct: 26  GGTAAVATIFFLTVLEVALSFDNAVVNAGVLKNWNHLWRQHFLIWGIFIAVFGMRLVFPL 85

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
            IV +V+ INPIEA+N+A+Y P+ Y ++++ AH  ++ FGG FLMMV L+FF       H
Sbjct: 86  AIVSVVAHINPIEAVNVALYRPEIYSRLMAAAHHQVAAFGGVFLMMVFLSFFVARHKTEH 145

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLE 220
           W+ F+E  ++ L +++ I+  + L  +   S  +  +E + F+ +    +I++     + 
Sbjct: 146 WLAFIEKPLTRLGQMEAIQAALTLITLTMFSYFVSQSERFEFLLAGMWGLIVYVLTKGIA 205

Query: 221 SVLSSDSSNNVTHGKH-GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIY 279
           S+LS   ++   H  H G+  FLYLE+IDAS S DGV+ +FA+T N FII +GL  GA++
Sbjct: 206 SLLSPHDAHIEQHVVHQGVGGFLYLELIDASFSFDGVLGAFAMTNNLFIIALGLGAGAMF 265

Query: 280 VRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSI 339
           VRS T+L++++G LN Y+YLEHG++++I  L+ +M L  I  IPE  TG    ILI  S+
Sbjct: 266 VRSFTVLLVEKGTLNHYRYLEHGAFWAIGSLAFLMLLGVIFAIPEAITGLLGAILILASL 325

Query: 340 YSSI 343
            SSI
Sbjct: 326 GSSI 329


>gi|78066974|ref|YP_369743.1| hypothetical protein Bcep18194_A5505 [Burkholderia sp. 383]
 gi|77967719|gb|ABB09099.1| protein of unknown function DUF475 [Burkholderia sp. 383]
          Length = 359

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/306 (40%), Positives = 198/306 (64%), Gaps = 7/306 (2%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G +  + I  +L+V+EISLS +NA++NA  L+  S  W+ RF+ +G+ +AVFGMR++FP+
Sbjct: 44  GGVKDMLIVAVLSVLEISLSLDNAVVNASVLKNWSEKWRNRFMVFGLPVAVFGMRLVFPL 103

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV ++  I   +A+ LAI SP+ Y  I++ AH  +S FGG FL+MV   F  +++   H
Sbjct: 104 LIVAVIGHIGMWDALKLAIESPEQYASILTSAHHQVSAFGGAFLLMVFFKFMLDTEKDEH 163

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIF---YGIN 217
           WI FLE  MSHL +I  +++ + L+II   S  +P  E  +F+ +    +I F   +GI 
Sbjct: 164 WIGFLEGPMSHLGRITALEVALTLAIIIIASLYVPAAEQVAFLLAGAFGVISFVIAHGIG 223

Query: 218 FLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGA 277
            L  +   ++   V   + G+  F+YLE++D+S S DGVI +FA++ N F+I +GL +GA
Sbjct: 224 DL--IGGEETGTRVV--REGVAGFMYLEVLDSSFSFDGVIGAFALSNNIFLIALGLGVGA 279

Query: 278 IYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFL 337
            Y+R MTL++LK+G L +Y+YLEHG++++I  L+ IMFL    ++PE+ TG     +I  
Sbjct: 280 AYIREMTLVLLKKGTLAQYRYLEHGAFWAIGALATIMFLGVKFEVPEVITGLVGAAMIAA 339

Query: 338 SIYSSI 343
           +++SSI
Sbjct: 340 AVWSSI 345


>gi|206560630|ref|YP_002231395.1| hypothetical protein BCAL2269 [Burkholderia cenocepacia J2315]
 gi|198036672|emb|CAR52570.1| putative membrane protein [Burkholderia cenocepacia J2315]
          Length = 330

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 121/306 (39%), Positives = 195/306 (63%), Gaps = 7/306 (2%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G +  + I  +L V+EISLS +NA++NA  L+  S  W+ RF+ +G+ +AVFGMR++FP+
Sbjct: 15  GGVKDMLIVAVLCVLEISLSLDNAVVNASVLKNWSEKWRNRFMVFGLPVAVFGMRLVFPL 74

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV ++  I   +A+ LAI SP  Y  +++ AH  +S FGG FL+MV   F  +++   H
Sbjct: 75  LIVAVIGHIGLWDALTLAIESPDKYAAVLTSAHHEVSAFGGAFLLMVFFKFMLDTEKDEH 134

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIF---YGIN 217
           WI FLE  M HL +I  +++ + L+I+   S  +P  E  SF+ +    +I F   +G+ 
Sbjct: 135 WIGFLEGPMRHLGRITALEVALTLAIVIVASFYVPATEQVSFLLAGAFGVIGFVIAHGVG 194

Query: 218 FLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGA 277
            L  V   D+   V   + G+  F+YLE++D+S S DGVI +FA++ N F+I +GL +GA
Sbjct: 195 DL--VGGEDTGTRVV--REGVAGFMYLEVLDSSFSFDGVIGAFALSNNIFLIALGLGVGA 250

Query: 278 IYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFL 337
            Y+R MTL++LK+G L +Y++LEHG++++I  L+ IMFL    ++PE+ TG     +I  
Sbjct: 251 AYIREMTLVLLKKGTLAQYRFLEHGAFWAIGALATIMFLGVKFEVPEVVTGLIGAAMIAA 310

Query: 338 SIYSSI 343
           +++SSI
Sbjct: 311 AVWSSI 316


>gi|134288489|ref|YP_001110652.1| hypothetical protein Bcep1808_6963 [Burkholderia vietnamiensis G4]
 gi|134133139|gb|ABO59849.1| protein of unknown function DUF475 [Burkholderia vietnamiensis G4]
          Length = 340

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 128/308 (41%), Positives = 195/308 (63%), Gaps = 7/308 (2%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           L G +  + I  +L+V+EISLS +NA++NA  L+  S  WQ RF+ +G+ IAVFGMR++F
Sbjct: 21  LMGGVKDMIIVGVLSVLEISLSLDNAVVNASVLKHWSKKWQDRFMVFGLPIAVFGMRLVF 80

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNK 158
           P++IV I+  I   EA +LA+  P  Y  I++ AH  +S FGG FL+MV   F F+S  +
Sbjct: 81  PLLIVAIIGHIGFWEAASLALKDPAQYASILTSAHHEVSAFGGAFLLMVFFKFMFDSGKE 140

Query: 159 LHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIF---YG 215
            HWI F+E AM+ L +I  +++ + L I+   S  +P  E  +F+ +    +I F   +G
Sbjct: 141 EHWIGFVEQAMARLGRITAVEVALTLGIVVLASFHVPAQEQIAFLLAGVFGVISFVVAHG 200

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           I  L      D+   V   + G+  FLYLE++D+S S DGVI +FA++ N F+I IGL +
Sbjct: 201 IGDLMG--GEDTGTRVV--REGVAGFLYLEVLDSSFSFDGVIGAFALSDNVFLIAIGLGV 256

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA Y+R MTL++LK+G L  YKYLE G++++I  L+ IMFL    ++PE+ TG    + I
Sbjct: 257 GAAYIREMTLVLLKKGTLASYKYLECGAFWAIGALATIMFLNVKFEVPEVVTGLIGAVTI 316

Query: 336 FLSIYSSI 343
            L++++SI
Sbjct: 317 GLAVWTSI 324


>gi|307822897|ref|ZP_07653127.1| protein of unknown function DUF475 [Methylobacter tundripaludum
           SV96]
 gi|307735672|gb|EFO06519.1| protein of unknown function DUF475 [Methylobacter tundripaludum
           SV96]
          Length = 334

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 135/340 (39%), Positives = 208/340 (61%), Gaps = 14/340 (4%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           + HFR +  VT    +C      W       G I   +I IIL V+E+SLSF+NA++NA 
Sbjct: 1   MQHFRLSFFVTA---VCLAAAFYW-------GGIMGAFIAIILGVLEVSLSFDNAVVNAS 50

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L++M   WQK FLTWGILIAVFGMR++FPI+IV   + I+ +    +A+     Y K +
Sbjct: 51  ILKRMDDRWQKYFLTWGILIAVFGMRLLFPIVIVSAATGIDFMGVTEMALKDTATYAKHL 110

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
             +HV I+ FGG FL+MV  +F F+   +LHW+ ++E  MS   K++ I+I + L  +  
Sbjct: 111 DASHVQIAAFGGMFLLMVFYSFIFDETKELHWLGYIEEKMSSFGKLEAIEIIMALGPLLI 170

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
           I N LP       + +    +I+F  ++ L ++   +           K G+  F+YLE+
Sbjct: 171 IQNYLPQEIRLDALVAGVTGVILFVIVDSLAALFEHEEEGEEVVAVLKKSGMMSFIYLEV 230

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+T+ ++++G L++Y +LEHG++Y+
Sbjct: 231 LDASFSFDGVIGAFAITQDVVIIMLGLAIGAMFVRSLTVYLVRKGTLDEYVFLEHGAHYA 290

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+ IM +     IPE+ TG +  +LI LS+ SSI+ K
Sbjct: 291 IGVLAGIMLVSMTHHIPEVITGLTGAVLIALSVISSIRYK 330


>gi|325284560|ref|YP_004264023.1| hypothetical protein Deipr_2032 [Deinococcus proteolyticus MRP]
 gi|324316049|gb|ADY27163.1| protein of unknown function DUF475 [Deinococcus proteolyticus MRP]
          Length = 351

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 138/338 (40%), Positives = 209/338 (61%), Gaps = 7/338 (2%)

Query: 14  FRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQK 73
           F +A LVT+         G+     L      + I ++L V+EISLSF+NA++NA  L+ 
Sbjct: 8   FGFASLVTLVCLAVAAWDGYTRGGGLDAMWQALAIAVLLGVLEISLSFDNAVVNATVLRT 67

Query: 74  MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAH 133
           MS  WQ+RFLTWGILIAVFGMR IFPI+IV + + +   E +  A  +P+ Y + + +AH
Sbjct: 68  MSQKWQQRFLTWGILIAVFGMRFIFPILIVALSAGLGFGEVVREAFANPELYAEHLERAH 127

Query: 134 VPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISN- 192
           V IS FGG FLMMV L +F ++   +HW+   E  ++   K+  I+  IV  ++  + + 
Sbjct: 128 VTISAFGGAFLMMVFLKYFMDAAKDVHWLRRAERLLARAGKLDSIQGIIVGVLLLALVHY 187

Query: 193 -ILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
            + P  E +S +S+    ++++  ++ + ++   D     + G  G + FLYLEI+DAS 
Sbjct: 188 TVAPA-EQFSALSAGLVGLLVYLMMDTVSNLFEVDGLTEKS-GAAGASAFLYLEILDASF 245

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           SLDGVI +FA+TK+  +I  GLTIGAI+VRS+T++M+K+G L  Y++LEHG++Y I  L+
Sbjct: 246 SLDGVIGAFALTKDVVLIAAGLTIGAIFVRSLTIMMVKKGTLEAYRFLEHGAHYGIGALA 305

Query: 312 VIMFLQTIVD--IPEIFTGTSSTILIFLSIYSSIK-NK 346
            IM L    D  IPE+ TG      I L+I+SS++ NK
Sbjct: 306 TIMLLSMNRDVHIPELVTGLIGAGFIGLAIWSSLQANK 343


>gi|320334757|ref|YP_004171468.1| hypothetical protein Deima_2163 [Deinococcus maricopensis DSM
           21211]
 gi|319756046|gb|ADV67803.1| protein of unknown function DUF475 [Deinococcus maricopensis DSM
           21211]
          Length = 354

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 139/339 (41%), Positives = 213/339 (62%), Gaps = 5/339 (1%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           SL   F +A +VTV   +     G + T  +S  +S   I  IL V+E+SLSF+NA++NA
Sbjct: 3   SLTKEFGFAGIVTVICLVVAALYGLR-TGGVSQALSYFLIAAILGVMELSLSFDNAVVNA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ MS +WQ+RFLTWGILIAVFGMR +FPI+IV +V+ +   E +NLA  +P  Y   
Sbjct: 62  TVLRNMSEVWQRRFLTWGILIAVFGMRFLFPIVIVAVVAGLGFGEVINLAFTNPPAYAHH 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV-LSII 187
           + +AH+PIS FGG FLM+V L +  +     HW+  +E  +S L ++  I++FI  + ++
Sbjct: 122 LEEAHIPISAFGGAFLMLVFLKYLIDPDKDTHWLAPIERRLSKLGRLDTIQVFITGVLLL 181

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
             +   +P+ E +S + +    I+ +  ++ L  +  +D+          ++ FLYLE++
Sbjct: 182 LLVHFAVPSAEKFSALLAGVIGILTYVLVDALGGLFDADNLAADAAKAGAIS-FLYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS SLDGVI +FAIT++  +I  GLTIGA++VRS+TL+++ +G L  Y+YLEHG++Y I
Sbjct: 241 DASFSLDGVIGAFAITQDIVVIAAGLTIGAVFVRSITLMLVHRGTLQAYRYLEHGAHYGI 300

Query: 308 FVLSVIMFL--QTIVDIPEIFTGTSSTILIFLSIYSSIK 344
             L++IM L     V IPE+ TG      I LSI+SS++
Sbjct: 301 GALAIIMLLSMNPNVHIPEVVTGLIGVGFIVLSIWSSLR 339


>gi|237749072|ref|ZP_04579552.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229380434|gb|EEO30525.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 336

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 129/336 (38%), Positives = 212/336 (63%), Gaps = 10/336 (2%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +F  + +V VA F+ G  IG          I+T++    L V+E++LSF+NA++NA
Sbjct: 3   SYLSYFTSSFIVCVAAFVVGYAIGG------PAAIATIFF---LTVLEVALSFDNAVVNA 53

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+  S IW++ FL WGI +AVFGMR++FP++IVC+   + P EA+N+AIY P +Y +I
Sbjct: 54  GILKHWSHIWRQHFLLWGIFVAVFGMRLVFPLLIVCVAGHMGPAEALNIAIYLPHEYSRI 113

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  ++ FGG FL+MV L+FF       HW+ F+E  ++ L +++ I+  + L  + 
Sbjct: 114 MASAHHEVAAFGGVFLLMVFLSFFVARHKTEHWLAFIEKPLTRLGQMEAIQAALTLITLT 173

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH-GLNLFLYLEII 247
            I+  +  +E + F+ +    ++++     + S+LS        H  H G+  FLYLE+I
Sbjct: 174 AITYFVSPDERFEFLLAGMWGLVVYVLTKGVASLLSPHDQQIEQHIVHQGVGGFLYLELI 233

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGV+ +FA+T N FII +GL  GA++VRS T+L++++G L+ Y+YLEHG++++I
Sbjct: 234 DASFSFDGVLGAFAMTNNLFIIALGLGAGAMFVRSFTILLVEKGTLSHYRYLEHGAFWAI 293

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+++M L  +  +PE  TG    +LI  ++ SSI
Sbjct: 294 GSLALLMLLGVLFPVPEAITGLLGALLIIAALGSSI 329


>gi|167589002|ref|ZP_02381390.1| hypothetical protein BuboB_26950 [Burkholderia ubonensis Bu]
          Length = 338

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 122/306 (39%), Positives = 193/306 (63%), Gaps = 7/306 (2%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G    + I  +L V+EISLS +NA++NA  L+  S  W+ RF+ +G+ +AVFGMR++FP+
Sbjct: 23  GGFKDMLIVAVLCVLEISLSLDNAVVNASVLKNWSEKWRNRFMVFGLPVAVFGMRLVFPL 82

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV ++  I   EA+ LAI +P  Y  I++ AH  +S FGG FL+MV   F  ++    H
Sbjct: 83  LIVAVIGHIGMWEALTLAIDAPDKYAAILTSAHHQVSAFGGAFLLMVFFKFMLDTGKDEH 142

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIF---YGIN 217
           WI   E  M HL +I  +++ + L+I+   S  +P+ E  SF+ +    +I F   +GI 
Sbjct: 143 WIGIFEGPMRHLGRITALEVALTLAIVIIASLYVPSAEQVSFLLAGAFGVISFVIAHGIG 202

Query: 218 FLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGA 277
            L  +   D+ + V   + G+  F+YLE++D+S S DGVI +FA++ N F+I +GL +GA
Sbjct: 203 DL--IGGEDTGSRVV--REGVAGFMYLEVLDSSFSFDGVIGAFALSNNIFLIALGLGVGA 258

Query: 278 IYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFL 337
            Y+R MTL++LK+G L +Y+YLEHG++++I  L+ IMFL   ++IPE+ TG      I  
Sbjct: 259 AYIREMTLVLLKKGTLAQYRYLEHGAFWAIGALAAIMFLGVKLEIPEVVTGLIGAATIGA 318

Query: 338 SIYSSI 343
           +++SSI
Sbjct: 319 AVWSSI 324


>gi|226953622|ref|ZP_03824086.1| integral membrane protein [Acinetobacter sp. ATCC 27244]
 gi|294651866|ref|ZP_06729157.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|226835625|gb|EEH68008.1| integral membrane protein [Acinetobacter sp. ATCC 27244]
 gi|292822255|gb|EFF81167.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 360

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 134/354 (37%), Positives = 214/354 (60%), Gaps = 23/354 (6%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           + HFR++I  T+   +C  L   W +TH     IST+     I +ILA++E+SLSF+NA+
Sbjct: 1   MKHFRFSIFFTI---VCLALSAYWGYTHGPEAGISTMLKALTITVILAIMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GIL+AVFGMR+IFPI+IV + + +  +E + LA+  P+ Y
Sbjct: 58  VNASVLRNWDHFWKMLFLTVGILVAVFGMRLIFPILIVAVTADMGMMEVVKLALNDPKSY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + + + H  I+ FGGTFL+MV L FFF+ + + HW  ++E  ++HL+ +  + +FI L 
Sbjct: 118 SERLMEHHPEIAAFGGTFLLMVFLNFFFDDEKETHWFRWIESKLAHLASVPAMSVFIALV 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-----SDSSNNVTHG------ 234
            +  ++  +   +      +    I+++ G+  L  +L       D+ N VT G      
Sbjct: 178 AMLIMAAHVDEAKRLVVTMAGIWGIVVYIGVKVLSHLLGGEPEVDDNGNAVTQGADGASK 237

Query: 235 ---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
              K G+  FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ ++++G
Sbjct: 238 GVVKAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEKG 297

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
            L+ Y +LEHG++Y+I  L+ IM    T + +PE+ TG      I  ++ +SI+
Sbjct: 298 TLDAYIFLEHGAHYAIGALAFIMIASGTGLHVPEVVTGLIGVAFIVWAVIASIQ 351


>gi|237653141|ref|YP_002889455.1| hypothetical protein Tmz1t_2476 [Thauera sp. MZ1T]
 gi|237624388|gb|ACR01078.1| protein of unknown function DUF475 [Thauera sp. MZ1T]
          Length = 339

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 120/305 (39%), Positives = 196/305 (64%), Gaps = 2/305 (0%)

Query: 44  STVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIV 103
              +I  +LAV+E SLSF+NA++NA  L+ M   W++RFL WGILIAVFGMRI+FP+ IV
Sbjct: 28  PAAFIVAVLAVLETSLSFDNAVVNATVLRHMDEKWRQRFLLWGILIAVFGMRIVFPLAIV 87

Query: 104 CIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIH 163
            +V+++ P+E ++LA+++P +Y ++++ AH  I+ FGG FLMMV L FF +     HW+ 
Sbjct: 88  GVVASLGPVEVVDLALFNPDEYARLLTSAHHEIAAFGGAFLMMVFLKFFIDENKDTHWLA 147

Query: 164 FLEIAMSHLSKIKGIKIFIVLSIIFGISN-ILPTNEMYSFVSSSTAAIIIFYGINFLESV 222
            +E  ++ L +++  +I + L  I   S  I   ++   F+ +    +I++   + L ++
Sbjct: 148 PIESPLTKLGRLEAAQILLTLLAILATSAWIDGADKRMEFIVAGVWGLIVYIAADGLGAI 207

Query: 223 LSSDSSNNVTH-GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
           +  +         K G   F+YLE++DAS S DGVI +FA+T +  II IGL +GA++VR
Sbjct: 208 MGGEEGEGGKMVAKTGFAGFMYLELLDASFSFDGVIGAFALTTSLPIIAIGLGVGAMFVR 267

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYS 341
           S TL+++ +G L  Y+YLEHG++++I  L+ IMF+   + IPE FTG    +LI  + +S
Sbjct: 268 SFTLMLVYRGTLEAYRYLEHGAFWAIGALAAIMFVGVHMHIPETFTGLIGAVLIGAAFWS 327

Query: 342 SIKNK 346
           S+++ 
Sbjct: 328 SLRHN 332


>gi|261403113|ref|YP_003247337.1| protein of unknown function DUF475 [Methanocaldococcus vulcanius
           M7]
 gi|261370106|gb|ACX72855.1| protein of unknown function DUF475 [Methanocaldococcus vulcanius
           M7]
          Length = 341

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 140/336 (41%), Positives = 215/336 (63%), Gaps = 10/336 (2%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
            LI++F+++I  T+   +            L G    +Y+ IIL ++E+SLSF+NA++NA
Sbjct: 5   ELINNFKFSIFFTIICLILAF---------LWGNFIGLYVAIILGILEVSLSFDNAVVNA 55

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M   WQK FLT GILIAVFGMR+ FP++IV I S INPI+ +N+A+ +P +Y   
Sbjct: 56  TVLKRMDEYWQKMFLTVGILIAVFGMRLTFPLVIVSIASHINPIDVVNMALNNPSEYAMH 115

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           + +AH  IS FGG FL+MV L +F N +   HWI  +E  ++ L K++ I+I I L I+ 
Sbjct: 116 LKEAHPLISAFGGAFLLMVFLKYFLNEEKDTHWIGLIEKPLAKLGKLESIEIVIALFILL 175

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG-KHGLNLFLYLEII 247
               I+P++E  + + S    II++  ++ +   +       V    K GL LFLYLE++
Sbjct: 176 LALKIVPSSEQLTVLISGILGIIVYVLVDSIGEYMQEKEQEMVNSAIKGGLILFLYLELL 235

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT++  +I +GL IGA++VRS+T+ ++K+G L++Y YLEHG+ Y+I
Sbjct: 236 DASFSFDGVIGAFAITRDIILIALGLGIGAMFVRSLTVYLVKKGTLDEYIYLEHGAMYAI 295

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+++MF+     IPE  TG+   +LI L++ SSI
Sbjct: 296 GTLAMLMFIGIRYHIPEYITGSIGALLIGLALVSSI 331


>gi|330984164|gb|EGH82267.1| hypothetical protein PLA107_03950 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 342

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 202/309 (65%), Gaps = 3/309 (0%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G  S  +  +IL V+E+S+S +NA+ NAK L+ MS  WQ  FLT GI IAVF +R+I P+
Sbjct: 22  GGPSAAFAVLILGVLEVSVSLDNAVANAKVLKDMSRFWQMAFLTVGIFIAVFVVRLILPV 81

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
            IV + + ++ ++  ++ +  P  Y   + +AH+ IS FGG FL+MV L F FN + +  
Sbjct: 82  EIVALAANLSFMDTAHMLVNDPVQYSHHLHEAHLSISAFGGMFLLMVFLDFVFNDEKEHF 141

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLE 220
           W+  +E  ++    + GIK F+ L+++ GI+++L   +  +F+ + +  ++IF+ ++ L+
Sbjct: 142 WLGAVEEKLASFGGVDGIKAFVALAVLMGIASVLEGAKSATFLYAGSLGLVIFFAMSLLK 201

Query: 221 SVLSSDSSNNV---THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGA 277
           ++     + +    T  K GL  FLYLE++DAS SLDGVI +FAI+K+  +I +GLTIGA
Sbjct: 202 NLFEEKETGDAVVNTVKKGGLVSFLYLEVLDASFSLDGVIGAFAISKDPVVIGMGLTIGA 261

Query: 278 IYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFL 337
           ++VRS+T+ ++K+G L++  YLE G+  +I VL++IM     VDIPE+FT     +LI L
Sbjct: 262 MFVRSLTVYLVKKGTLDELVYLEAGAMCAIGVLALIMISSGFVDIPELFTALVGAVLIGL 321

Query: 338 SIYSSIKNK 346
           S++SS+++K
Sbjct: 322 SVWSSLRHK 330


>gi|237749821|ref|ZP_04580301.1| integral membrane protein [Helicobacter bilis ATCC 43879]
 gi|229374571|gb|EEO24962.1| integral membrane protein [Helicobacter bilis ATCC 43879]
          Length = 324

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 138/340 (40%), Positives = 208/340 (61%), Gaps = 23/340 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIG-WQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           + HF  + +VT+ G +    +G WQ           +YICI+L+++E+SLSF+NA++NAK
Sbjct: 1   MKHFYSSFVVTLIGLVLAFYVGAWQ----------AIYICILLSILEVSLSFDNAVVNAK 50

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L  M   WQKRF+ WGI IAVFGMR IFPI+IV + + +  +E +NLA+YSPQ+Y K +
Sbjct: 51  VLDTMDIKWQKRFIYWGIPIAVFGMRFIFPIVIVAVAARLGMLETLNLALYSPQEYHKTL 110

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
            +    I  FG  FL+MV L FFF+   ++HW+ F+E  + M    K       ++L+I 
Sbjct: 111 EETRFEIYAFGAGFLLMVCLQFFFSEDKEVHWLSFIEDNVIMRFFMKFPNFA--LLLAIT 168

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
            GI  +  T+ +   V  +    I+ Y I     + S+D        ++GL  FLYLE++
Sbjct: 169 LGIILLALTDNI--LVGMAYFCAIVLYLI-----IHSADKFLGAGGVRNGLMGFLYLEVL 221

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+++N FII+IGL IGA++VRS+TL +++   L K  YLEHG++Y+I
Sbjct: 222 DASFSFDGVIGAFALSENIFIIMIGLGIGAMFVRSLTLYLVEHKTLQKLIYLEHGAHYAI 281

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLS-IYSSIKNK 346
             L++IM L+  +++ EI TG      I ++ I S + NK
Sbjct: 282 GALAIIMLLKIFMEVSEIITGLIGVGFIGIAFICSRVANK 321


>gi|50086415|ref|YP_047925.1| hypothetical protein ACIAD3451 [Acinetobacter sp. ADP1]
 gi|49532391|emb|CAG70103.1| putative integral membrane protein [Acinetobacter sp. ADP1]
          Length = 360

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 132/354 (37%), Positives = 210/354 (59%), Gaps = 23/354 (6%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           + HFR++I  TV   +C  L   W +TH     +ST++    I  ILAV+E+SLSF+NA+
Sbjct: 1   MKHFRFSIFFTV---ICLALSAYWGYTHGPEAGLSTMFKALTITAILAVMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GILIAVFGMR+IFP+ IV + + +  IE   +A+  P++Y
Sbjct: 58  VNASVLRGWDHFWKMLFLTVGILIAVFGMRLIFPVAIVAVTADMGMIEVAKMALNDPKNY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + + Q H  I+ FGGTFL+MV L FFF+     HW  ++E  +++L+ I  + +F+ L 
Sbjct: 118 SERLMQHHAEIAAFGGTFLLMVFLNFFFDDGKDTHWFKWIEAKLANLANIPAMSVFVALV 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-----SDSSNNVTHG------ 234
            +  ++  +  ++      +    ++++ G+  L  +L       ++ N + H       
Sbjct: 178 AMLIMAAYVSDDKRLVVTMAGIWGLVVYIGVQVLSHLLGGEPEIDENGNAIGHDGSGAST 237

Query: 235 ---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
              K G   FLYLE++DAS S DGVI +FAIT +  II++GL IGA++VRSMT+ ++++G
Sbjct: 238 GVIKAGFGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAMFVRSMTVYLVEKG 297

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
            L+ Y YLEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+
Sbjct: 298 TLDAYIYLEHGAHYAIGALAFIMLASGTGVHVPEVVTGLIGVAFIVWAVLASIQ 351


>gi|289641606|ref|ZP_06473767.1| protein of unknown function DUF475 [Frankia symbiont of Datisca
           glomerata]
 gi|289508587|gb|EFD29525.1| protein of unknown function DUF475 [Frankia symbiont of Datisca
           glomerata]
          Length = 426

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 133/389 (34%), Positives = 212/389 (54%), Gaps = 54/389 (13%)

Query: 2   KSNSLYASLIHHFR---WAILVTVAGF-LCGLGIGWQFTHTLSGTISTVYICIILAVVEI 57
           +S      L+H  R   W++ +TVAG  L G+         L G   T  I  ILAV+EI
Sbjct: 20  RSGGRLPVLVHALRIFGWSLAITVAGVALAGV---------LDGP-KTAAIVAILAVLEI 69

Query: 58  SLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           SLSF+NA++NA  L++M+  WQK FLT G+LIAVFGMR++FPI+IV + + + PIE  +L
Sbjct: 70  SLSFDNAVINATILRRMNEFWQKIFLTVGVLIAVFGMRLLFPIVIVALTAHLGPIEVFDL 129

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
           A+ +P +Y   +  AH  I+ FGG FL M+ L F F+ +  + W+ ++E  +    ++  
Sbjct: 130 ALNNPDEYATRLHDAHPAIAAFGGIFLFMIFLDFMFDPERDVQWLRWIEEPLRRAGQLDV 189

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFL------ESVLSSD----- 226
           +   + L  +  ++     +     +++  A I  + G+  L        V + D     
Sbjct: 190 LSAVVALVALLIVAEAFSGDATQQVLTAGVAGIATYLGVRGLGEFFEARGVGADDDDAQE 249

Query: 227 -----------------SSNNVTHGKHGLN------------LFLYLEIIDASLSLDGVI 257
                            S+   T GK G N            LF+YLE++DAS S DGV+
Sbjct: 250 AEKDTGDATAVVPAGAASTAEATGGKGGPNALVLASGKAAFFLFMYLEVLDASFSFDGVV 309

Query: 258 SSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ 317
            +FAIT+  F+I  GL IGA+Y+RS+T+ ++++G L +Y YLEHG++Y+I  L+VI+ + 
Sbjct: 310 GAFAITQEIFVIAAGLGIGAMYIRSITVYLVRKGTLQEYVYLEHGAHYAIGALAVILAVS 369

Query: 318 TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
              ++PEI TG      I +++ SS++ +
Sbjct: 370 IETEVPEIITGLVGVGFIGVALVSSLRRR 398


>gi|50085094|ref|YP_046604.1| hypothetical protein ACIAD1956 [Acinetobacter sp. ADP1]
 gi|49531070|emb|CAG68782.1| conserved hypothetical protein; putative membrane protein
           [Acinetobacter sp. ADP1]
          Length = 356

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 131/350 (37%), Positives = 207/350 (59%), Gaps = 20/350 (5%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHT----LSGTISTVYICIILAVVEISLSFENAI 65
           + HFR++I+ T+   +C  L   W  TH     LS  +  + I  +LAV+E+SLSF+NA+
Sbjct: 1   MKHFRFSIIFTI---ICLALSAWWGLTHGPNAGLSMMLKVLLITTVLAVMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+K FLT GIL+AVFGMR+IFP++IV + + +  IE   LA+  P+ Y
Sbjct: 58  VNASVLRNWDEFWKKLFLTVGILVAVFGMRLIFPLLIVGVTADMGMIEVAKLALNDPKTY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + +   H  I+ FGG FLM+V L F F+     HW H+LE  +S+L+ I  + +F+ L 
Sbjct: 118 SEKLLAHHAEIAAFGGMFLMLVFLNFLFDDGKDTHWFHWLETHLSNLANIPAMSVFVSLI 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH--------- 236
            +  ++  +P  +    + +    I+++ G+  L  +L   S ++ T  K          
Sbjct: 178 ALLIMAAFVPEQQKLIVIMAGIWGIVVYIGVQVLGHLLEGSSEDDETDEKQVSGTSTNIV 237

Query: 237 --GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
             G+  FLYLE++DAS S DGVI +FAIT +  +I++GL IGA++VRSMT+ ++++G L 
Sbjct: 238 KAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAMFVRSMTIYLVEKGTLE 297

Query: 295 KYKYLEHGSYYSIFVLSVIM-FLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            + YLEHG++Y+I  L+ IM +  T   +PE+ TG      I  ++ SSI
Sbjct: 298 AFIYLEHGAHYAIGALAAIMLYTGTGGHVPEVVTGLIGVAFIIWAVLSSI 347


>gi|262373717|ref|ZP_06066995.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262311470|gb|EEY92556.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 360

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 133/352 (37%), Positives = 209/352 (59%), Gaps = 23/352 (6%)

Query: 13  HFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAILN 67
           HFR++I  TV   +C  L   W +TH     I+T+     I  ILAV+E+SLSF+NA++N
Sbjct: 3   HFRFSIFFTV---VCLALSAYWGYTHGPEAGIATMLKALTITAILAVMEVSLSFDNAVVN 59

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+     W+  FLT GILIAVFGMR++FP++IV + + +  +E + LA+  P+ Y  
Sbjct: 60  ASVLRNWDHFWKMIFLTVGILIAVFGMRLVFPVVIVAVTADMGMMEVVKLALNDPKSYSA 119

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
            + + H  I+ FGGTFL+MV L FFF+ + + HW  ++E  +SHL+ +  + +FI L  +
Sbjct: 120 RLMEHHAEIAAFGGTFLLMVFLNFFFDDEKETHWFRWIESKLSHLASVPAMSVFIALVAM 179

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSS-----NNVTHG-------- 234
             ++  +  ++      +    I+++ G+  L  +L  +       N V H         
Sbjct: 180 LIMAANVEESKRLVVTMAGIWGIVVYIGVQVLSHLLGGEPEIDEHGNAVMHDGNGAASGV 239

Query: 235 -KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
            K G   FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ ++++G L
Sbjct: 240 VKAGFGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEKGTL 299

Query: 294 NKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
           + Y +LEHG++Y+I  L+ IM    T + +PE+ TG      I  ++ +SI+
Sbjct: 300 DAYIFLEHGAHYAIGALAFIMIASGTGLHVPEVVTGLIGVAFIVWAVIASIQ 351


>gi|21244793|ref|NP_644375.1| hypothetical protein XAC4076 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21110492|gb|AAM38911.1| integral membrane protein [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 347

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 127/341 (37%), Positives = 221/341 (64%), Gaps = 8/341 (2%)

Query: 10  LIHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +   FR ++LV V   +C GL   W  T ++ G    +++C++L+V+E+SLSF+NA++NA
Sbjct: 1   MFRDFRMSLLVAV---ICLGLAAWWGHTSSM-GIWQALWLCLVLSVLEVSLSFDNAVVNA 56

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y ++
Sbjct: 57  GVLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQV 116

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ 
Sbjct: 117 LTDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLL 176

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLE 245
           G    LP     S + +    I+++  +  ++++  ++ S + + G   + G+  FLYLE
Sbjct: 177 GTKLFLPDGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLE 236

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           ++DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y
Sbjct: 237 VLDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHY 296

Query: 306 SIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 297 AIGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|294664798|ref|ZP_06730122.1| integral membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292605429|gb|EFF48756.1| integral membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 347

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 219/340 (64%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV  A    GL   W  T ++ G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSLLV--AAICLGLAAWWGHTSSM-GIWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP     S + +    I+++  +  ++++  ++ S + + G   + G+  FLYLE+
Sbjct: 178 TKLFLPDGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|71065324|ref|YP_264051.1| hypothetical protein Psyc_0764 [Psychrobacter arcticus 273-4]
 gi|71038309|gb|AAZ18617.1| uncharacterized transmembrane protein [Psychrobacter arcticus
           273-4]
          Length = 355

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 123/328 (37%), Positives = 203/328 (61%), Gaps = 15/328 (4%)

Query: 33  WQFTHT-LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAV 91
           W ++H  + G I+T+ I  ILAV+EISLSF+NA++NA  L+     W+K FLT GILIAV
Sbjct: 21  WGYSHGGMGGLITTLSITAILAVMEISLSFDNAVVNASVLKGWDEFWKKIFLTVGILIAV 80

Query: 92  FGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTF 151
           FGMR++FPI+IV + + +  +E +NLA+Y P++Y   +   H  IS FGG FL++V L F
Sbjct: 81  FGMRLVFPIVIVAVTADLGMMEVINLALYQPEEYSARLMAHHAEISAFGGIFLLLVFLNF 140

Query: 152 FFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAII 211
            F+ + ++HW H+LE  ++ L K+  + +F+ L ++    +     +  + + +    I+
Sbjct: 141 IFDDK-EVHWFHWLESRLAKLGKVDAMSVFVALIVLMFAVSWANAEQGSAVLIAGVWGIL 199

Query: 212 IFYGINFLESVLS-------------SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVIS 258
           ++ G+  +  +L              S ++      K G+  FLYLE++DAS S DGVI 
Sbjct: 200 VYLGVQVISGMLEGDLEEDLENEENGSGAAATSAIMKGGIIGFLYLEVLDASFSFDGVIG 259

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
           +FAIT +  +I++GL IGA++VRSMT+ ++ +G L+++ YLEHG++Y+I  L++IM L  
Sbjct: 260 AFAITNDVIVIMLGLAIGAMFVRSMTIFLVDKGTLDEFIYLEHGAHYAIGALAIIMLLSV 319

Query: 319 IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
              +PE+ TG      I  ++ +S+K +
Sbjct: 320 KFHVPELITGLIGIAFIGWALLASLKYR 347


>gi|154148595|ref|YP_001405960.1| integral membrane protein [Campylobacter hominis ATCC BAA-381]
 gi|153804604|gb|ABS51611.1| integral membrane protein [Campylobacter hominis ATCC BAA-381]
          Length = 324

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 194/308 (62%), Gaps = 11/308 (3%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G+ + VYIC +L V+E+SLSF+NA++NAK L  MS IWQ+RF+TWGI IAVFGMR+IFPI
Sbjct: 22  GSFAAVYICFLLTVLEVSLSFDNAVVNAKILNNMSKIWQRRFITWGIFIAVFGMRLIFPI 81

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV I +     E   LA+  P  Y +I+S++   I  FGG FLMM+ L FFF+ +  + 
Sbjct: 82  LIVSIATKHGLTETFMLALKDPDLYHEILSESKNEIYIFGGGFLMMIFLNFFFDKERDVF 141

Query: 161 WIHFLE--IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINF 218
           WI   E  I      K   I   + L++I G+  I  + ++ S + +  +AII++  I  
Sbjct: 142 WIKPFEKNIITEFFKKFNNIS--LTLALILGVFIIYQSGDI-SLILAYFSAIILYNLIQN 198

Query: 219 LESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
            + V S +   N      G+  FLYLE++DAS S DGVI +FA+++N FII+IGL  GA+
Sbjct: 199 FDDVFSKNGIRN------GIVGFLYLEMLDASFSFDGVIGAFALSENIFIIMIGLGSGAM 252

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           +VRSMTL +++   L  + +LEHG++Y+IF L+VIM L+T + I EI TGT     I LS
Sbjct: 253 FVRSMTLYLVEHKTLEHFIFLEHGAHYAIFALAVIMLLKTQMQISEILTGTLGFGFILLS 312

Query: 339 IYSSIKNK 346
              SI  K
Sbjct: 313 FLCSIFYK 320


>gi|56552674|ref|YP_163513.1| hypothetical protein ZMO1778 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|4378178|gb|AAD19423.1| unknown [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56544248|gb|AAV90402.1| protein of unknown function DUF475 [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 339

 Score =  235 bits (599), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 209/340 (61%), Gaps = 9/340 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGW--QFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
           ++ HFR + LVT+ G +     G+  Q  H +SG ++  ++  +LA++E + SF+NA++N
Sbjct: 1   MLKHFRASFLVTILGLITAFIFGYYAQGHHLISG-LNAAFLAFLLAILETAFSFDNAVVN 59

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+ ++  WQK FLTWG+++AVFGMRI+FP++IV   + ++P EA  +A+++   Y +
Sbjct: 60  ASVLKNLTPKWQKCFLTWGMIVAVFGMRILFPLLIVSFSAWVDPWEATKIALFNHARYEE 119

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +++ AH  I+GFG  FLM+V L+FF   ++   WI ++E  +  L  I  I   +   I+
Sbjct: 120 VVTAAHASIAGFGSAFLMLVGLSFFVKEEHSPIWISWIEKPLMALRVIPFISYILTFLIM 179

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
            G +      + YSF  ++   +  ++ +   E  +        T GK GL  F+YLE +
Sbjct: 180 AGFAFWFDQKDSYSFSVAALFGMAAYFLLEQFERFMGKP-----TPGKAGLATFIYLEFL 234

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T +  +I IGL IGA++VRSMT+ +++ G L++Y YLE G++Y+I
Sbjct: 235 DASFSFDGVIGAFAVTNDIVLIAIGLGIGAMFVRSMTVALVQGGHLSQYPYLEAGAFYAI 294

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLS-IYSSIKNK 346
             L+ I  L   +++PEI +G S  + I  S +YS I+N+
Sbjct: 295 VTLAFITALNVRIEVPEIISGLSGLVWIGGSLVYSMIENR 334


>gi|260753678|ref|YP_003226571.1| hypothetical protein Za10_1449 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258553041|gb|ACV75987.1| protein of unknown function DUF475 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 339

 Score =  235 bits (599), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 208/340 (61%), Gaps = 9/340 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGW--QFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
           ++ HFR + LVT+ G +     G+  Q  H +SG +   ++  +LA++E + SF+NA++N
Sbjct: 1   MLKHFRASFLVTILGLITAFIFGYYAQGHHLISG-LDAAFLAFLLAILETAFSFDNAVVN 59

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+ ++  WQK FLTWG+++AVFGMRI+FP++IV   + ++P EA  +A+++   Y +
Sbjct: 60  ASVLKNLTPKWQKCFLTWGMIVAVFGMRILFPLLIVSFSAWVDPWEATKIALFNHARYEE 119

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +++ AH  I+GFG  FLM+V L+FF   ++   WI ++E  +  L  I  I   +   I+
Sbjct: 120 VVTAAHASIAGFGSAFLMLVGLSFFVKEEHSPIWISWIEKPLMALRVIPFISYILTFLIM 179

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
            G +      + YSF  ++   +  ++ +   E  +        T GK GL  F+YLE +
Sbjct: 180 AGFAFWFDQKDGYSFSVAALFGMAAYFLLEQFERFMGKP-----TPGKAGLATFIYLEFL 234

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T +  +I IGL IGA++VRSMT+ +++ G L++Y YLE G++Y+I
Sbjct: 235 DASFSFDGVIGAFAVTNDIVLIAIGLGIGAMFVRSMTVALVQGGHLSQYPYLEAGAFYAI 294

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLS-IYSSIKNK 346
             L+ I  L   +++PEI +G S  + I  S +YS I+N+
Sbjct: 295 VTLAFITALNVRIEVPEIISGLSGLVWIGGSLVYSMIENR 334


>gi|78778040|ref|YP_394355.1| hypothetical protein Suden_1846 [Sulfurimonas denitrificans DSM
           1251]
 gi|78498580|gb|ABB45120.1| Protein of unknown function DUF475 [Sulfurimonas denitrificans DSM
           1251]
          Length = 341

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 128/337 (37%), Positives = 206/337 (61%), Gaps = 4/337 (1%)

Query: 13  HFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQ 72
           +F+++ + T    L  L  G+      S  +S + + +ILA +E+SLSF+NA++NA  L+
Sbjct: 3   YFKFSFIFTFIALLISLWWGYHLG-GWSSALSMMLVTLILASMEVSLSFDNAVVNASILK 61

Query: 73  KMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQA 132
                W+K FLT GILIAVFGMR++FP++IV   + +  +E  NLA+ +P +Y   +   
Sbjct: 62  TWDEYWKKLFLTVGILIAVFGMRLLFPLVIVAQTADMGILEVWNLALDNPVEYSSKLIAH 121

Query: 133 HVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISN 192
           H  IS FGG FL++V L F  + +  +HWI  +E  +  L KI+ I IF+ + ++   + 
Sbjct: 122 HAEISAFGGVFLLLVFLNFMLDEEKNIHWIEIIEKKLGLLGKIEAISIFVSIVVLMFFAT 181

Query: 193 ILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN---NVTHGKHGLNLFLYLEIIDA 249
            +   +  + +++    II++  ++ L  VL  +      + T  K  +  FLYLE++DA
Sbjct: 182 FVEEGQKLAVLNAGLWGIIVYVSVDILGFVLEKEDEKKHISSTVKKGSIGGFLYLEVLDA 241

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FAITK+  +I++GL IGA++VRS+T+ ++++G L+ Y YLEHG++Y+I +
Sbjct: 242 SFSFDGVIGAFAITKDIVVIMLGLGIGAMFVRSITIYLVEKGTLDSYIYLEHGAHYAIGI 301

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+ IM       IPE+FTG      I LS+YSSIK +
Sbjct: 302 LAFIMLFGMKFHIPELFTGLVGVAFILLSLYSSIKYR 338


>gi|58424690|gb|AAW73727.1| integral membrane protein [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 381

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 128/348 (36%), Positives = 222/348 (63%), Gaps = 8/348 (2%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLS-GTISTVYICIILAVVEISLSF 61
           S  L   +   FR ++LV     +C LG+   + HT + G    +++C++L+V+E+SLSF
Sbjct: 28  SARLGVPMFREFRMSLLVAA---VC-LGVAAWWGHTTALGLWQALWLCLVLSVLEVSLSF 83

Query: 62  ENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYS 121
           +NA++NA  L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +     M +A+  
Sbjct: 84  DNAVVNAGVLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLAPVMQMALKE 143

Query: 122 PQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIF 181
           P+ Y ++++  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + 
Sbjct: 144 PERYSQVLTDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVI 203

Query: 182 IVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGL 238
           + +S++ G    LP     S + +    I+++  +  ++++  ++ S +   G   + G+
Sbjct: 204 VAVSVLLGTKLFLPEGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGI 263

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
             FLYLE++DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +
Sbjct: 264 AAFLYLEVLDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVF 323

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           LEHG++Y+I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 324 LEHGAHYAIGVLAIIMLVGTVHHVPEVLTGLIGVAFIAASVWSSIRYR 371


>gi|294625677|ref|ZP_06704299.1| integral membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292600046|gb|EFF44161.1| integral membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 347

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 219/340 (64%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV  A    GL   W  T ++ G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSLLV--AAICLGLAAWWGHTSSM-GIWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLIGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP     S + +    I+++  +  ++++  ++ S + + G   + G+  FLYLE+
Sbjct: 178 TKLFLPDGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVYHVPEVLTGLIGVGFIAASVWSSIRYR 337


>gi|84622095|ref|YP_449467.1| integral membrane protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|84366035|dbj|BAE67193.1| integral membrane protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 347

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 126/341 (36%), Positives = 221/341 (64%), Gaps = 8/341 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLS-GTISTVYICIILAVVEISLSFENAILNA 68
           +   FR ++LV     +C LG+   + HT + G    +++C++L+V+E+SLSF+NA++NA
Sbjct: 1   MFREFRMSLLVAA---VC-LGVAAWWGHTTALGLWQALWLCLVLSVLEVSLSFDNAVVNA 56

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P+ Y ++
Sbjct: 57  GVLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPERYSQV 116

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ 
Sbjct: 117 LTDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLL 176

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLE 245
           G    LP     S + +    I+++  +  ++++  ++ S +   G   + G+  FLYLE
Sbjct: 177 GTKLFLPEGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLE 236

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           ++DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y
Sbjct: 237 VLDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHY 296

Query: 306 SIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 297 AIGVLAIIMLVGTVHHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|302518790|ref|ZP_07271132.1| integral membrane protein [Streptomyces sp. SPB78]
 gi|302427685|gb|EFK99500.1| integral membrane protein [Streptomyces sp. SPB78]
          Length = 375

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 130/353 (36%), Positives = 208/353 (58%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T+ G ++  +        +  ILAV+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFGITVLGLVAAAFYGGWTAFGVVAILAVLEISLSFDNAVINAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV + + INP++A++LAI +   Y  +++ AH  I+ FGG F
Sbjct: 67  TVGVLIAVFGMRLVFPVLIVAVTAKINPVDAVDLAINNKDHYQALVTDAHPAIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPT------- 196
           LMM+ L F F   + + W+ +LE  ++ L K+  + + + L ++   S  + T       
Sbjct: 127 LMMIFLDFIFEDHD-IKWLGWLERPLAKLGKVDMLSVCVALILLLIASMTVATHAHVHGG 185

Query: 197 ---NEMYSFVSSSTAAIIIFYGI----NFLESVL-----------------SSDSSNNVT 232
              ++  + + S  A +I +  +     F E+ L                  +  S    
Sbjct: 186 GHVDKAETVLLSGIAGLITYLIVGGLSGFFENKLEDEEEREEEREEEAVKGGTSRSAVAL 245

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE+IDAS S DGVI +FAIT +  ++ +GL IGA+Y+RS+T+ +++QG 
Sbjct: 246 AGKGAFFMFLYLEVIDASFSFDGVIGAFAITNDIILMALGLGIGAMYIRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  LSV++ +    +IPE+ TG    +LI  S +SS++ 
Sbjct: 306 LDDYVYLEHGAHYAIGALSVLLLVTIRYEIPEVVTGLIGVVLIAASFWSSVRR 358


>gi|78049718|ref|YP_365893.1| hypothetical protein XCV4162 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325927514|ref|ZP_08188752.1| hypothetical protein XPE_2776 [Xanthomonas perforans 91-118]
 gi|78038148|emb|CAJ25893.1| putative membrane protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|325542107|gb|EGD13611.1| hypothetical protein XPE_2776 [Xanthomonas perforans 91-118]
          Length = 347

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 126/341 (36%), Positives = 220/341 (64%), Gaps = 8/341 (2%)

Query: 10  LIHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +   FR + +VT    +C GL   W  T ++ G    +++C++L+V+E+SLSF+NA++NA
Sbjct: 1   MFRDFRMSFVVTA---ICLGLAAWWGHTSSM-GIWQALWLCLVLSVLEVSLSFDNAVVNA 56

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y ++
Sbjct: 57  GVLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQV 116

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ 
Sbjct: 117 LTDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLL 176

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLE 245
           G    LP     S + +    I+++  +  ++++  ++ S + + G   + G+  FLYLE
Sbjct: 177 GTKLFLPEAIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLE 236

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           ++DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y
Sbjct: 237 VLDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHY 296

Query: 306 SIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 297 AIGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|182438928|ref|YP_001826647.1| hypothetical protein SGR_5135 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326779584|ref|ZP_08238849.1| protein of unknown function DUF475 [Streptomyces cf. griseus
           XylebKG-1]
 gi|178467444|dbj|BAG21964.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326659917|gb|EGE44763.1| protein of unknown function DUF475 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 383

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 128/354 (36%), Positives = 202/354 (57%), Gaps = 39/354 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V+        I +IL+V+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVFYGGWQAFGIVLILSVLEISLSFDNAVINAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T GILIAVFGMR++FP++IV + + + PIEA++L+   P  Y ++++ AH  I+ FGG F
Sbjct: 67  TIGILIAVFGMRLVFPVVIVAVSAQLGPIEAIDLSFNDPDRYKELVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           L+M+ L F F+    +HW+ ++E  ++ L K+  + + + L ++   +    T    +  
Sbjct: 127 LLMIFLDFIFDEDRDIHWLRWIERPLAKLGKVDMLSVCVALIVLLITATTFATQAHQHGG 186

Query: 203 VSSSTAAIIIFYGINFLESVL------------------------------SSDSSNNVT 232
             +  A+ ++  GI  L + L                                  +    
Sbjct: 187 GHADKASTVMLSGIAGLITYLVVGGLSGFFEGKLEEEEEREHEAEEEAKEKGKPVTGVAL 246

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    LFLYLE++DAS S DGVI +FAIT    ++ +GL IGA+YVRS+T+ ++++G 
Sbjct: 247 AGKAAFFLFLYLEVLDASFSFDGVIGAFAITNEIVLMALGLGIGAMYVRSLTVYLVREGT 306

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+ Y YLEHG++Y+I  LS+I+ +     I E  TG+   ILI LS +SS++  
Sbjct: 307 LDDYVYLEHGAHYAIGALSIILLITIQFQINEFITGSVGVILIALSFWSSVRRN 360


>gi|295839202|ref|ZP_06826135.1| integral membrane protein [Streptomyces sp. SPB74]
 gi|197695653|gb|EDY42586.1| integral membrane protein [Streptomyces sp. SPB74]
          Length = 375

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 131/355 (36%), Positives = 211/355 (59%), Gaps = 41/355 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T+ G ++  +        +  ILAV+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFGITVLGLVAAAFYGGWTAFGVVAILAVLEISLSFDNAVINAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV + + INP++A++LAI +   Y ++++ AH  I+ FGG F
Sbjct: 67  TVGVLIAVFGMRLVFPVLIVAVTAKINPVDAVDLAINNKDHYQELVTDAHPAIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPT------- 196
           L+M+ L F F  ++ + W+ +LE  ++ L K+  + + + L ++   S  + T       
Sbjct: 127 LLMIFLDFIFEDRD-IKWLGWLERPLAKLGKVDMLSVCVALILLLIASMTVATHAHVHGG 185

Query: 197 ---NEMYSFVSSSTAAIIIFYGI----NFLESVL-----------------SSDSSNNVT 232
              ++  + + S  A +I +  +     F E+ L                     S    
Sbjct: 186 GHVDKAETVLLSGIAGLITYLIVGGLSGFFENKLEDEEEAEEEREEEAAKSGKPRSAVAL 245

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE+IDAS S DGVI +FAIT +  ++ +GL IGA+Y+RS+T+ +++QG 
Sbjct: 246 AGKGAFFMFLYLEVIDASFSFDGVIGAFAITNDIILMALGLGIGAMYIRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI-KNK 346
           L+ Y YLEHG++Y+I  LSV++ +    +IPE+ TG    +LI  S +SS+ +NK
Sbjct: 306 LDDYVYLEHGAHYAIGALSVLLLVTIRYEIPEVVTGLIGVVLIAASFWSSVQRNK 360


>gi|122879022|ref|YP_199112.6| hypothetical protein XOO0473 [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 347

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 126/341 (36%), Positives = 220/341 (64%), Gaps = 8/341 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLS-GTISTVYICIILAVVEISLSFENAILNA 68
           +   FR ++LV     +C LG+   + HT + G    +++C++L+V+E+SLSF+NA++NA
Sbjct: 1   MFREFRMSLLVAA---VC-LGVAAWWGHTTALGLWQALWLCLVLSVLEVSLSFDNAVVNA 56

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +     M +A+  P+ Y ++
Sbjct: 57  GVLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLAPVMQMALKEPERYSQV 116

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ 
Sbjct: 117 LTDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLL 176

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLE 245
           G    LP     S + +    I+++  +  ++++  ++ S +   G   + G+  FLYLE
Sbjct: 177 GTKLFLPEGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLE 236

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           ++DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y
Sbjct: 237 VLDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHY 296

Query: 306 SIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 297 AIGVLAIIMLVGTVHHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|21233409|ref|NP_639326.1| hypothetical protein XCC3987 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66770374|ref|YP_245136.1| hypothetical protein XC_4077 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188993574|ref|YP_001905584.1| hypothetical protein xccb100_4179 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21115249|gb|AAM43208.1| integral membrane protein [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66575706|gb|AAY51116.1| integral membrane protein [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167735334|emb|CAP53548.1| integral membrane protein [Xanthomonas campestris pv. campestris]
          Length = 347

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 126/341 (36%), Positives = 218/341 (63%), Gaps = 8/341 (2%)

Query: 10  LIHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +   FR + LVT    +C GL   W  T ++ G    +++C++L+V+E+SLSF+NA++NA
Sbjct: 1   MFRDFRMSFLVTA---ICLGLAAWWGHTSSM-GIWQALWLCLVLSVLEVSLSFDNAVVNA 56

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M+  W+K FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y ++
Sbjct: 57  GVLKHMNEFWRKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQV 116

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++  +  I+ FGG FL++V L F F+   KLHW+  +E  +  L K   + + + +S++ 
Sbjct: 117 LTDHYPSIAAFGGMFLLLVFLNFLFDQDRKLHWLGPVERLVGKLGKADAMSVIVAVSVLL 176

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLE 245
           G    LP     S + +    I+++  +  ++++  ++ S + + G   + G+  FLYLE
Sbjct: 177 GTKLFLPDAVFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLE 236

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           ++DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y
Sbjct: 237 VLDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHY 296

Query: 306 SIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 297 AIGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|149194204|ref|ZP_01871302.1| integral membrane protein [Caminibacter mediatlanticus TB-2]
 gi|149136157|gb|EDM24635.1| integral membrane protein [Caminibacter mediatlanticus TB-2]
          Length = 321

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 124/284 (43%), Positives = 189/284 (66%), Gaps = 10/284 (3%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G +S +YI  ILA++EISLSF+NA++NAK L+ M  +WQ+RFLTWGILIAVFGMR +FPI
Sbjct: 22  GGLSAIYITSILALLEISLSFDNAVVNAKILKNMDKVWQRRFLTWGILIAVFGMRFVFPI 81

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV + + I  I+ +NLA++ PQ Y +++      I  FGG FL MV   F F  + ++ 
Sbjct: 82  LIVSVAANIGIIKTINLALFDPQKYHEVLVNVEKLIYAFGGAFLWMVFSDFLFE-EKEVR 140

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLE 220
           WI  +E       ++  I   +++++I G+  I  + + Y    +    I+I+  ++ + 
Sbjct: 141 WIKPIEKTAEKFGRVNNIS--LIVAMIIGLIVIYDSKD-YKIAIAYFLGILIYSILHGIN 197

Query: 221 SVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S LS++ +      K GL  FLYLE++DAS S DGVI +FAIT N  II++GL IGA++V
Sbjct: 198 SALSTEGA------KSGLMGFLYLEVLDASFSFDGVIGAFAITSNILIIMLGLGIGAMFV 251

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPE 324
           RS+T+ M+++G+L++YKYLEHG++Y+I +L+VIM L+    I E
Sbjct: 252 RSLTIWMVERGVLDEYKYLEHGAHYAIGILAVIMLLKIFFHISE 295


>gi|318058639|ref|ZP_07977362.1| hypothetical protein SSA3_11895 [Streptomyces sp. SA3_actG]
 gi|318077136|ref|ZP_07984468.1| hypothetical protein SSA3_10533 [Streptomyces sp. SA3_actF]
          Length = 379

 Score =  233 bits (593), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 130/357 (36%), Positives = 208/357 (58%), Gaps = 44/357 (12%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T+ G ++  +        +  ILAV+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFGITVLGLVAAAFYGGWTAFGVVAILAVLEISLSFDNAVINAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV + + INP++A++LAI +   Y  +++ AH  I+ FGG F
Sbjct: 67  TVGVLIAVFGMRLVFPVLIVAVTAKINPVDAVDLAINNKDHYQALVTDAHPAIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPT------- 196
           LMM+ L F F   + + W+ +LE  ++ L K+  + + + L ++   S  + T       
Sbjct: 127 LMMIFLDFIFEDHD-IKWLGWLERPLAKLGKVDMLSVCVALILLLIASMTVATHAHVHGG 185

Query: 197 ---NEMYSFVSSSTAAIIIFYGI----NFLESVL---------------------SSDSS 228
              ++  + + S  A +I +  +     F E+ L                      +  S
Sbjct: 186 GHVDKAETVLLSGIAGLITYLIVGGLSGFFENKLEDEEEREEEREEEREEEAVKGGTSRS 245

Query: 229 NNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLML 288
                GK    +FLYLE+IDAS S DGVI +FAIT +  ++ +GL IGA+Y+RS+T+ ++
Sbjct: 246 AVALAGKGAFFMFLYLEVIDASFSFDGVIGAFAITNDIILMALGLGIGAMYIRSLTVYLV 305

Query: 289 KQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +QG L+ Y YLEHG++Y+I  LSV++ +    +IPE+ TG    +LI  S +SS++ 
Sbjct: 306 RQGTLDDYVYLEHGAHYAIGALSVLLLVTIRYEIPEVVTGLIGVVLIAASFWSSVRR 362


>gi|239940900|ref|ZP_04692837.1| hypothetical protein SrosN15_07875 [Streptomyces roseosporus NRRL
           15998]
 gi|239987378|ref|ZP_04708042.1| hypothetical protein SrosN1_08742 [Streptomyces roseosporus NRRL
           11379]
 gi|291444335|ref|ZP_06583725.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
 gi|291347282|gb|EFE74186.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
          Length = 383

 Score =  232 bits (592), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 129/354 (36%), Positives = 202/354 (57%), Gaps = 39/354 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ ++        I  IL+V+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAIFYGGWQAFGIVAILSVLEISLSFDNAVINAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T GILIAVFGMR++FP++IV + + + PIEA++L+   P  Y ++++ AH  I+ FGG F
Sbjct: 67  TIGILIAVFGMRLVFPVVIVAVSAKLGPIEAIDLSFNDPDKYKELVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           L+M+ L F F+    +HW+ ++E  ++ L K+  + + + L I+   +    T    +  
Sbjct: 127 LLMIFLDFIFDEDRDIHWLRWIERPLAKLGKVDMLSVCVALIILLITAMTFATQAHQHGG 186

Query: 203 VSSSTAAIIIFYGINFLESVL------------------------------SSDSSNNVT 232
                +A ++  GI  L + L                                  +    
Sbjct: 187 GHVDKSATVMLSGIAGLITYLIVGGLSGFFEGKLEEEEEREHEAEEEAKKKGKPVTGVAL 246

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    LFLYLE++DAS S DGVI +FAIT    ++ +GL IGA+YVRS+T+ ++++G 
Sbjct: 247 AGKAAFFLFLYLEVLDASFSFDGVIGAFAITNEIVLMALGLGIGAMYVRSLTVYLVREGT 306

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+ Y YLEHG++Y+I  LS+I+ +    +I E+ TG+   ILI LS +SS+K  
Sbjct: 307 LDDYVYLEHGAHYAIGALSIILLITIQHEINELITGSVGVILIALSFWSSVKRN 360


>gi|257454294|ref|ZP_05619560.1| integral membrane protein [Enhydrobacter aerosaccus SK60]
 gi|257448311|gb|EEV23288.1| integral membrane protein [Enhydrobacter aerosaccus SK60]
          Length = 357

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 122/329 (37%), Positives = 209/329 (63%), Gaps = 16/329 (4%)

Query: 33  WQFTHT-LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAV 91
           W F+H  +S  +S +++ +ILAV+EISLSF+NA++NA  L+     W+  FLT G+LIAV
Sbjct: 21  WGFSHGGVSTMMSALFVTLILAVMEISLSFDNAVVNASVLKTWDKFWKMIFLTVGMLIAV 80

Query: 92  FGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTF 151
           FGMR++FPI+IV + + +  ++ +N+A+ +P++Y   + + H  I+ FGG FL++V L F
Sbjct: 81  FGMRLVFPIVIVAVTADMGMMDVINMALNNPKEYSAKLIEHHAEIAAFGGMFLLLVFLNF 140

Query: 152 FFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAII 211
            F+ + ++ W  +LE  ++   K+  + +F+ L+++      +      + +++    I+
Sbjct: 141 IFD-EKEVMWFEWLERKLARFGKVDAMSVFVALALLMMALFWVDPARKAAVLTAGVFGIL 199

Query: 212 IFYGINFLESVL-----SSDSSNNVTHGKH--------GLNLFLYLEIIDASLSLDGVIS 258
           I+   N L S+L       +S+ +V  GK         G+  FLYLE++DAS S DGVI 
Sbjct: 200 IYLATNVLSSLLEGADDDDESTPDVIEGKEVAGAIAKGGIAGFLYLEVLDASFSFDGVIG 259

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
           +FAIT +  II++GL IGA++VRSMT+ ++++G L+++ YLEHG++Y+I  L+VIM L T
Sbjct: 260 AFAITNDVIIIMLGLAIGAMFVRSMTIFLVEKGTLDEFVYLEHGAHYAIGALAVIMLLAT 319

Query: 319 I-VDIPEIFTGTSSTILIFLSIYSSIKNK 346
           + +++PEI TG      I  ++ +SI  +
Sbjct: 320 VHIEVPEIVTGLIGIAFIVWAVINSISYR 348


>gi|15837794|ref|NP_298482.1| hypothetical protein XF1192 [Xylella fastidiosa 9a5c]
 gi|9106162|gb|AAF84002.1|AE003953_6 integral membrane protein [Xylella fastidiosa 9a5c]
          Length = 341

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 124/340 (36%), Positives = 216/340 (63%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T   F   L   W ++  L G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFT--AFCLSLAAWWGYSTAL-GVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GI IAVFGMR++FPI+IV + + +  I  M LA+  P+ Y +++
Sbjct: 58  ILKHMSEFWRKLFLTIGIFIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   I + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAIAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM + T+  +PE+ TG     LI  S++SS + +
Sbjct: 298 IGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYR 337


>gi|328882227|emb|CCA55466.1| Integral membrane protein [Streptomyces venezuelae ATCC 10712]
          Length = 381

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 205/353 (58%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V         I  IL V+EISLSF+NA++NA  LQKM++ WQK FL
Sbjct: 7   GWSFAITALGLVAAVLYGGWEAFGIVAILCVLEISLSFDNAVVNAGILQKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV I + I PIEA++LA+     Y ++++ AH  I+ FGG F
Sbjct: 67  TIGVLIAVFGMRLVFPVVIVAISAKIGPIEAVDLALNDADRYQELVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPT------- 196
           L+M+ L F F  ++ + W+ ++E  ++ L K+  + + I L ++   +    T       
Sbjct: 127 LLMIFLDFIFEDRD-IQWLRWIERPLAKLGKVDMLSVCIALIVLLVSAMTFATHAHQHGG 185

Query: 197 ---NEMYSFVSSSTAAIIIFYGINFLESVLSSD-----------------SSNNVT---- 232
              ++  + + S  A +I +  +  L     +                  S   VT    
Sbjct: 186 THVDKAQTVLISGIAGLITYLVVGGLSGYFENKLEEEEEREHEAEEAAKRSGKKVTAVQL 245

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FA+T +  ++ +GL +GA+YVRS+T+ +++QG 
Sbjct: 246 AGKAAFFMFLYLEVLDASFSFDGVIGAFAVTNDIVLMALGLGVGAMYVRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L+V++ +    +IPE+ TG+   ILI  S +SS++ 
Sbjct: 306 LDDYVYLEHGAHYAIGALAVLLLVTIQYEIPEVITGSIGVILIAWSFWSSVRR 358


>gi|262377227|ref|ZP_06070452.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262307965|gb|EEY89103.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 361

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 131/356 (36%), Positives = 208/356 (58%), Gaps = 23/356 (6%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           + HF ++I  ++   +C GL   W +TH     + T+     I  ILA++E+SLSF+NA+
Sbjct: 1   MKHFGFSIAFSI---VCLGLSAYWGYTHGPDAGLQTMLTALTITAILAIMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  +E + LA+  P++Y
Sbjct: 58  VNASVLRGWDHFWKMLFLTVGILIAVFGMRLIFPVVIVAVTADLGFMEVVRLALNDPKEY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
              +   H  I+ FGG FL+MV L FF + +   HW   +E  +S+L+ +  + +FI L 
Sbjct: 118 SARLMAHHPEIAAFGGAFLLMVFLNFFLDEEKDTHWFRRVERRLSNLANVPAMSVFIALV 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD------------SSNNVTH 233
            +  ++  +   +  +   +    I+I+ G+  L  +L  +              N V  
Sbjct: 178 ALLIMAANVDEAKRLAVTMAGIWGIVIYIGVQVLSHMLGGEPEVDEEGNAIRHDENGVPT 237

Query: 234 G--KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
           G  K G+  FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ +++QG
Sbjct: 238 GVVKAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEQG 297

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L+ Y YLEHG++Y+I  L+ IM    T + +PE+ TG      I  ++++SI+ K
Sbjct: 298 TLDAYIYLEHGAHYAIGALAFIMIASGTGLHVPEVVTGLIGVAFIVWAVFASIQYK 353


>gi|224372322|ref|YP_002606694.1| hypothetical protein NAMH_0271 [Nautilia profundicola AmH]
 gi|223588816|gb|ACM92552.1| integral membrane protein [Nautilia profundicola AmH]
          Length = 318

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 129/288 (44%), Positives = 191/288 (66%), Gaps = 14/288 (4%)

Query: 44  STVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIV 103
           S VY+  ILA++E+SLSF+NA++NAK L+ M  IW+KRFLTWG++IAVFGMR IFPI+IV
Sbjct: 25  SAVYLTSILAILEVSLSFDNAVVNAKILKDMDKIWEKRFLTWGMVIAVFGMRFIFPILIV 84

Query: 104 CIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIH 163
            + + +  +E +N+AI  P+ Y +++ ++   I  FGG FL +V   F F    ++ WI 
Sbjct: 85  AVAANLGVVETLNIAINHPEQYHEVLLKSENLIYAFGGAFLWLVFTDFLF-EHKEIRWIK 143

Query: 164 FLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLE-SV 222
            +E     L ++  I   ++++ + GI  I           S +  I I Y +  L  S+
Sbjct: 144 PVERYAEKLGRVNNIS--LIVATVIGIIVIY---------DSKSYEIGIAYLLGMLTYSL 192

Query: 223 LSS-DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
           L+  + +  V   K+GL  FLYLEI+DAS S DGVI +FAIT N FII+IGL IGA++VR
Sbjct: 193 LNGINEAFAVEGAKNGLMGFLYLEILDASFSFDGVIGAFAITGNIFIIMIGLGIGAMFVR 252

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGT 329
           S+T+ M+++G+L++YKYLEHG++Y+I VL+VIM L+  + I E+ TGT
Sbjct: 253 SLTIWMVEKGVLSEYKYLEHGAHYAIGVLAVIMLLKIFMHIGEVLTGT 300


>gi|71276516|ref|ZP_00652791.1| Protein of unknown function DUF475 [Xylella fastidiosa Dixon]
 gi|170729737|ref|YP_001775170.1| hypothetical protein Xfasm12_0534 [Xylella fastidiosa M12]
 gi|71162693|gb|EAO12420.1| Protein of unknown function DUF475 [Xylella fastidiosa Dixon]
 gi|167964530|gb|ACA11540.1| integral membrane protein [Xylella fastidiosa M12]
          Length = 345

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 124/340 (36%), Positives = 216/340 (63%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T   F   L   W ++  L G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFT--AFCLSLAAWWGYSTAL-GVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GILIAVFGMR++FPI+IV + + +  I  M LA+  P+ Y  ++
Sbjct: 58  ILKHMSEFWRKLFLTIGILIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSLVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   + + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAMAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM + T+  +PE+ TG     LI  S++SS + +
Sbjct: 298 IGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYR 337


>gi|325920185|ref|ZP_08182144.1| hypothetical protein XGA_1089 [Xanthomonas gardneri ATCC 19865]
 gi|325549325|gb|EGD20220.1| hypothetical protein XGA_1089 [Xanthomonas gardneri ATCC 19865]
          Length = 346

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 218/340 (64%), Gaps = 7/340 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLS-GTISTVYICIILAVVEISLSFENAILNA 68
           +   FR + LVT    +C LG+   + HT S G    +++C++L+V+E+SLSF+NA++NA
Sbjct: 1   MFRDFRMSFLVTA---VC-LGVAAWWGHTTSMGLWQALWLCLVLSVLEVSLSFDNAVVNA 56

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y ++
Sbjct: 57  GVLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQV 116

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + ++++ 
Sbjct: 117 LTDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVTVLL 176

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN--VTHGKHGLNLFLYLEI 246
                LP     S + +    I+++  +  ++++  S+ S +      + G+  FLYLE+
Sbjct: 177 CTKLFLPDAVFQSVLFAGLGGILLYLLVGSVDALFESEESEDGMGPAKRSGIAAFLYLEV 236

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 237 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 296

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 297 IGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 336


>gi|121583381|ref|YP_973812.1| hypothetical protein Pnap_4653 [Polaromonas naphthalenivorans CJ2]
 gi|120596635|gb|ABM40070.1| protein of unknown function DUF475 [Polaromonas naphthalenivorans
           CJ2]
          Length = 359

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 129/348 (37%), Positives = 220/348 (63%), Gaps = 7/348 (2%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT-HTLSGTISTVYICIILAVVEISLSF 61
           +N+    ++ HF+ +  +T+   L GLG  W +     +G +  +++  ILAV+E+SLSF
Sbjct: 5   TNACQYLIMKHFKISFFITL--ILLGLGAFWGYGLGGTTGALQALFVVSILAVMEVSLSF 62

Query: 62  ENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYS 121
           +NA++NA  L+  +  WQK FLT GI+IAVFGMR++FPI+IV I + +  ++ M +A+ +
Sbjct: 63  DNAVVNASVLRTWNPFWQKLFLTVGIIIAVFGMRLVFPILIVSIATGLGLLDVMTMALNT 122

Query: 122 PQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIF 181
           P++Y + ++  H  ++ FGG+FL++V L F F+ +  LHW+ ++E  +      +G+   
Sbjct: 123 PEEYSRHLTANHAQVAAFGGSFLLLVFLNFLFDQEKDLHWLGWIEEKLGKHGN-EGLSTL 181

Query: 182 IVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV--THGKHG-L 238
           + +  +FG   ++P  +  S + +  + I ++  ++FL  +L ++  + V  T  K G +
Sbjct: 182 VAMLAVFGCMTLVPEVQKLSVLMAGISGIAVYLAVSFLSGLLEAEEHDPVIGTAIKRGSI 241

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
             FLYLE++DAS S DGVI +FAIT +  II++GL IGA++VRSMT+ ++ +G L ++ Y
Sbjct: 242 GGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAMFVRSMTVFLVHKGTLEEFVY 301

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           LEHG++Y+I +L++IM       I E FTG S    I LS++SS+  K
Sbjct: 302 LEHGAHYAIGILALIMLASVKFHISEWFTGLSGVAFICLSLWSSVHYK 349


>gi|188578924|ref|YP_001915853.1| hypothetical protein PXO_02894 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188523376|gb|ACD61321.1| integral membrane protein [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 341

 Score =  229 bits (585), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 122/328 (37%), Positives = 211/328 (64%), Gaps = 4/328 (1%)

Query: 22  VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR 81
           VA    G+   W  T  L G    +++C++L+V+E+SLSF+NA++NA  L+ M++ WQK 
Sbjct: 5   VAAVCLGVAAWWGHTTAL-GLWQALWLCLVLSVLEVSLSFDNAVVNAGVLKHMNAFWQKL 63

Query: 82  FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGG 141
           FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P+ Y ++++  +  I+ FGG
Sbjct: 64  FLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPERYSQVLTDNYPSIAAFGG 123

Query: 142 TFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYS 201
            FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++      LP     S
Sbjct: 124 MFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLCTKLFLPEGIFQS 183

Query: 202 FVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEIIDASLSLDGVIS 258
            + +    I+++  +  ++++  ++ S +   G   + G+  FLYLE++DAS S DGVI 
Sbjct: 184 VLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEVLDASFSFDGVIG 243

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
           +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I VL++IM + T
Sbjct: 244 AFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAIGVLAIIMLVGT 303

Query: 319 IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +  +PE+ TG      I  S++SSI+ +
Sbjct: 304 VYHVPEVLTGLIGVAFIAASVWSSIRYR 331


>gi|166710315|ref|ZP_02241522.1| integral membrane protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 341

 Score =  229 bits (585), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 122/328 (37%), Positives = 211/328 (64%), Gaps = 4/328 (1%)

Query: 22  VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR 81
           VA    G+   W  T T  G    +++C++L+V+E+SLSF+NA++NA  L+ M++ WQK 
Sbjct: 5   VAAVCLGVAAWWGHT-TAMGLWQALWLCLVLSVLEVSLSFDNAVVNAGVLKHMNAFWQKL 63

Query: 82  FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGG 141
           FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P+ Y ++++  +  I+ FGG
Sbjct: 64  FLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPERYSQVLTDNYPSIAAFGG 123

Query: 142 TFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYS 201
            FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++      LP     S
Sbjct: 124 MFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLCTKLFLPEGIFQS 183

Query: 202 FVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEIIDASLSLDGVIS 258
            + +    I+++  +  ++++  ++ S +   G   + G+  FLYLE++DAS S DGVI 
Sbjct: 184 VLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEVLDASFSFDGVIG 243

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
           +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I VL++IM + T
Sbjct: 244 AFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAIGVLAIIMLVGT 303

Query: 319 IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +  +PE+ TG      I  S++SSI+ +
Sbjct: 304 VYHVPEVLTGLIGVAFIAASVWSSIRYR 331


>gi|289664732|ref|ZP_06486313.1| hypothetical protein XcampvN_17108 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289670855|ref|ZP_06491930.1| hypothetical protein XcampmN_20803 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 341

 Score =  229 bits (585), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 120/316 (37%), Positives = 208/316 (65%), Gaps = 4/316 (1%)

Query: 35  FTHTLS-GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFG 93
           + HT S G    +++C++L+V+E+SLSF+NA++NA  L+ M++ WQK FLT GILIAVFG
Sbjct: 16  WGHTTSMGLWQALWLCLVLSVLEVSLSFDNAVVNAGVLKHMNAFWQKLFLTVGILIAVFG 75

Query: 94  MRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFF 153
           MR++FPI+IV + + +     M +A+  P+ Y ++++  +  I+ FGG FL++V L F F
Sbjct: 76  MRLVFPIVIVSVATGMGLAPVMQMALKEPERYSQVLTDNYPSIAAFGGMFLLLVFLNFLF 135

Query: 154 NSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIF 213
           + + KLHW+  +E  +  L K   + + + +S++ G    LP     S + +    I+++
Sbjct: 136 DQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLGTKLFLPDGIFQSVLFAGLGGILLY 195

Query: 214 YGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIV 270
             +  ++++  ++ S +   G   + G+  FLYLE++DAS S DGVI +FAIT++  II+
Sbjct: 196 LLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEVLDASFSFDGVIGAFAITRDVVIIM 255

Query: 271 IGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTS 330
           +GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I VL++IM + T+  +PE+ TG  
Sbjct: 256 LGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAIGVLAIIMLVGTVYHVPEVLTGLI 315

Query: 331 STILIFLSIYSSIKNK 346
               I  S++SSI+ +
Sbjct: 316 GVAFIAASVWSSIRYR 331


>gi|93005600|ref|YP_580037.1| hypothetical protein Pcryo_0770 [Psychrobacter cryohalolentis K5]
 gi|93006611|ref|YP_581048.1| hypothetical protein Pcryo_1787 [Psychrobacter cryohalolentis K5]
 gi|92393278|gb|ABE74553.1| protein of unknown function DUF475 [Psychrobacter cryohalolentis
           K5]
 gi|92394289|gb|ABE75564.1| protein of unknown function DUF475 [Psychrobacter cryohalolentis
           K5]
          Length = 355

 Score =  229 bits (583), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 120/328 (36%), Positives = 203/328 (61%), Gaps = 15/328 (4%)

Query: 33  WQFTHT-LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAV 91
           W ++H  + G I+T+ I  ILAV+EISLSF+NA++NA  L+     W+K FLT GILIAV
Sbjct: 21  WGYSHGGMGGLITTLSITAILAVMEISLSFDNAVVNASVLKGWDEFWKKIFLTVGILIAV 80

Query: 92  FGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTF 151
           FGMR++FPI+IV + + +  ++ ++LA+  P++Y   +   H  IS FGG FL++V L F
Sbjct: 81  FGMRLVFPIVIVAVTADLGMMQVIDLALNDPKEYSARLMAHHAEISAFGGIFLLLVFLNF 140

Query: 152 FFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAII 211
            F+ + ++HW ++LE  ++ L K+  + +F+ L ++    +     +  + + +    I+
Sbjct: 141 IFDDK-EVHWFNWLESRLAKLGKVDAMSVFVALIVLMFAVSWASAEQASAVLIAGVWGIL 199

Query: 212 IFYGINFLESVLS-------------SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVIS 258
           ++ G+  +  +L              S ++      K G+  FLYLE++DAS S DGVI 
Sbjct: 200 VYLGVQVISGMLEGDLEEDLENEEKGSGAAATSAIMKGGIIGFLYLEVLDASFSFDGVIG 259

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
           +FAIT +  +I++GL IGA++VRSMT+ ++ +G L+++ YLEHG++Y+I  L++IM L  
Sbjct: 260 AFAITNDVIVIMLGLAIGAMFVRSMTIFLVDKGTLDEFIYLEHGAHYAIGALAIIMLLSV 319

Query: 319 IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
              +PEI TG      I  ++ +S+K++
Sbjct: 320 KFHVPEIITGLIGIAFIGWALLASLKHR 347


>gi|28198391|ref|NP_778705.1| integral membrane protein [Xylella fastidiosa Temecula1]
 gi|182681033|ref|YP_001829193.1| hypothetical protein XfasM23_0472 [Xylella fastidiosa M23]
 gi|28056461|gb|AAO28354.1| integral membrane protein [Xylella fastidiosa Temecula1]
 gi|182631143|gb|ACB91919.1| protein of unknown function DUF475 [Xylella fastidiosa M23]
 gi|307579501|gb|ADN63470.1| hypothetical protein XFLM_07800 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 345

 Score =  228 bits (582), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 123/340 (36%), Positives = 215/340 (63%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T   F   L   W ++  L G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFT--AFCLSLAAWWGYSTAL-GVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GI IAVFGMR++FPI+IV + + +  I  M LA+  P+ Y  ++
Sbjct: 58  ILKHMSEFWRKLFLTIGIFIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSLVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   + + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAMAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM + T+  +PE+ TG     LI  S++SS + +
Sbjct: 298 IGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYR 337


>gi|282861709|ref|ZP_06270773.1| protein of unknown function DUF475 [Streptomyces sp. ACTE]
 gi|282563525|gb|EFB69063.1| protein of unknown function DUF475 [Streptomyces sp. ACTE]
          Length = 383

 Score =  228 bits (582), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 207/353 (58%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V+        I  IL+++EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVFYGGWQAFGIVAILSILEISLSFDNAVINAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV I + + PIEA++L+  +P  Y ++++ AH  I+ FGG F
Sbjct: 67  TVGVLIAVFGMRLVFPVVIVAISAKLGPIEAVDLSFNNPDRYKELVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           LMM+ L F F  ++ + W+ ++E  ++ L K+  + + + L ++   S  + T+   +  
Sbjct: 127 LMMIFLDFIFEDRD-IQWLRWIERPLAKLGKVDMLSVCVALIVLLIASMTVATHAHQHGG 185

Query: 203 VSSSTAAIIIFYGINFLESVL------------------------------SSDSSNNVT 232
             +  A+ ++  GI  L + L                                 +S  + 
Sbjct: 186 GHADKASTVLLSGIAGLITYLVVGGLSGFFENKLEEEEEREQEAEEEAKKSGKPASAVLL 245

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FAIT    ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 246 AGKAAFFMFLYLEVLDASFSFDGVIGAFAITNEIVLMALGLGIGAMYVRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  LSVI+ +    +I EI TG    +LI  + +SS+++
Sbjct: 306 LDDYVYLEHGAHYAIGALSVILLITIQYEINEIITGLVGVVLIAWAFWSSVRH 358


>gi|71901122|ref|ZP_00683229.1| Protein of unknown function DUF475 [Xylella fastidiosa Ann-1]
 gi|71729127|gb|EAO31251.1| Protein of unknown function DUF475 [Xylella fastidiosa Ann-1]
          Length = 345

 Score =  228 bits (582), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 124/340 (36%), Positives = 215/340 (63%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T   F   L   W ++  L G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFT--AFCLSLAAWWGYSTAL-GVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GILIAVFGMR++FPI+IV + + +  I  M LA+  P+ Y  ++
Sbjct: 58  ILKHMSEFWRKLFLTIGILIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSLVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   + + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAMAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQGDGLMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II+ GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMFGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM + T+  +PE+ TG     LI  S++SS + +
Sbjct: 298 IGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYR 337


>gi|302545763|ref|ZP_07298105.1| integral membrane protein [Streptomyces hygroscopicus ATCC 53653]
 gi|302463381|gb|EFL26474.1| integral membrane protein [Streptomyces himastatinicus ATCC 53653]
          Length = 392

 Score =  228 bits (582), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 138/384 (35%), Positives = 210/384 (54%), Gaps = 60/384 (15%)

Query: 10  LIHHFRWAILVTVAGF-LCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           L+  F W+  VT  G  L G+  GW+           + I  IL+++EISLSF+NA++NA
Sbjct: 2   LLKTFGWSFAVTAGGLALAGVLWGWK----------GLAIVGILSILEISLSFDNAVINA 51

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + PIEA+NLAI   + Y  +
Sbjct: 52  GILRKMNAFWQKIFLTVGILIAVFGMRLVFPVVIVAITAKLGPIEAVNLAINDKEKYEHL 111

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+ FGG FL+M+ L F F  ++ + W+ +LE  +S L K+      I L+++ 
Sbjct: 112 VTGAHPAIAAFGGMFLLMIFLDFIFEERD-IRWLGWLEKPLSKLGKLDTFSAVIALAVLL 170

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGI-------------NFLESVL------------ 223
             +  + T+  +       +A ++  G+              F E  L            
Sbjct: 171 VTATTVATDVAHG--GGDKSATVLLSGVAGLMTYLIVNGISGFFEDKLEEDEDEEDGEGG 228

Query: 224 ---------SSDSSNNVTHGKHGLN-----------LFLYLEIIDASLSLDGVISSFAIT 263
                       + N    G  G             +FLYLE+IDAS S DGVI +FAIT
Sbjct: 229 ADGEDEADEKKPAENGGGRGSSGATVVGLAGKAAFFMFLYLEVIDASFSFDGVIGAFAIT 288

Query: 264 KNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIP 323
            + F + +GL IGA+Y+RS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+      +I 
Sbjct: 289 NDIFEMALGLGIGAMYIRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLATIKFEIN 348

Query: 324 EIFTGTSSTILIFLSIYSS-IKNK 346
           E+ TG+    LI  S +SS I+N+
Sbjct: 349 ELITGSVGIALIGASYWSSVIRNR 372


>gi|326570893|gb|EGE20917.1| hypothetical protein E9S_04142 [Moraxella catarrhalis BC7]
          Length = 358

 Score =  228 bits (582), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 136/360 (37%), Positives = 217/360 (60%), Gaps = 31/360 (8%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVYICI----ILAVVEISLSFENAI 65
           + HF + I+ T   F+C  +   W ++H   G IS +++ +    ILA++EISLSF+NA+
Sbjct: 1   MRHFLFDIIFT---FVCLVIAAWWGYSH---GGISEMFLALGITAILAIMEISLSFDNAV 54

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+  +  W+K FLT GILIAVFGMR+IFPI IV + + +   E ++LA+ +P  Y
Sbjct: 55  VNASILKGWNDFWKKIFLTVGILIAVFGMRLIFPIAIVAVTANLGMGEVIHLALNNPVQY 114

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + ++  H  IS FGG FL++V L F F  ++ +HW  +LE  +   SK+  + +F+ L 
Sbjct: 115 AEHLNAHHAEISAFGGMFLLLVFLNFMFGDKD-VHWFKWLESRLVKFSKVDAMSVFVALV 173

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV------------TH 233
           ++    + +   +    + +    I+++ G++ L ++L  D  + V            T 
Sbjct: 174 VLMISMSWVEEAKQGVVMVAGIWGILVYLGVSVLSALLEGDGDDKVAVYDAKGREITNTA 233

Query: 234 G------KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLM 287
           G      K G+  FLYLE++DAS S DGVI +FAIT +  +I+IGL IGA++VRSMT+ +
Sbjct: 234 GVSSTILKGGIAGFLYLEVLDASFSFDGVIGAFAITNDVIVIMIGLAIGAMFVRSMTIYL 293

Query: 288 LKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK-NK 346
           + +G L+ + YLEHG++Y+I  L++IM L T   +PEI TG      I LS+++SI+ NK
Sbjct: 294 VNKGTLSDFIYLEHGAHYAIGALAIIMLLSTRFHVPEIITGLIGVAFIVLSVFNSIQYNK 353


>gi|241762087|ref|ZP_04760170.1| protein of unknown function DUF475 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373337|gb|EER62937.1| protein of unknown function DUF475 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 339

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 124/340 (36%), Positives = 206/340 (60%), Gaps = 9/340 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGW--QFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
           ++ HF  + LVT+ G +     G+  Q  H +SG +   ++  +LA++E + SF+NA++N
Sbjct: 1   MLKHFWASFLVTILGLITAFIFGYYAQGHHLMSG-LDAAFLAFLLAILETAFSFDNAVVN 59

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+ ++  WQK FLTWG+++AVFGMRI+FP++IV   + ++P EA  +A+++   Y +
Sbjct: 60  ASILKNLTPKWQKCFLTWGMIVAVFGMRILFPLLIVSFSAWVDPWEATKIALFNHARYEE 119

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +++ AH  I+GFG  FLM+V L+FF   ++   WI ++E  +  L  I  I   +   I+
Sbjct: 120 VVTAAHASIAGFGSAFLMLVGLSFFVKEEHSPIWISWIEKPLMALRVIPFISYILTFLIM 179

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
            G +      + YSF  ++   +  ++ +   E  +        T GK GL  F+YLE +
Sbjct: 180 AGFAFWFDQKDGYSFSVAALFGMAAYFLLEQFERFMGKP-----TPGKAGLATFIYLEFL 234

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T +  +I IGL IGA++VRSMT+ +++ G L++Y YLE G++Y+I
Sbjct: 235 DASFSFDGVIGAFAVTNDIVLIAIGLGIGAMFVRSMTVALVQGGHLSQYPYLEAGAFYAI 294

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLS-IYSSIKNK 346
             L+ I  L   +++PEI +  S  + I  S +YS I+N+
Sbjct: 295 VTLAFITALNVRIEVPEIISCLSGLVWIGGSLVYSMIENR 334


>gi|297197254|ref|ZP_06914651.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|297146654|gb|EFH28266.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 376

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 134/364 (36%), Positives = 208/364 (57%), Gaps = 39/364 (10%)

Query: 10  LIHHFRWAILVTVAGFLCG-LGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           ++  FRWA  VT  G   G L  GW          +   I  ILAV+EISLSF+NA++NA
Sbjct: 5   ILKTFRWAFAVTALGLAAGVLYDGW----------AAFGIVAILAVLEISLSFDNAVVNA 54

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + +NP +A+ LA+     Y ++
Sbjct: 55  GILKKMNTFWQKIFLTVGVLIAVFGMRLVFPVVIVAITAKLNPYDAVQLALTDKDRYQQL 114

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+ FGG FL+M+ L F F  ++ + W+ +LE  ++ L K+  + + I L ++ 
Sbjct: 115 VTDAHPAIAAFGGMFLLMIFLDFIFEDRD-IKWLAWLERPLAKLGKVDMLSVCIALVVLL 173

Query: 189 GISNILPTN-EMYSFVSSSTAAIIIFYGINFLESVL------------------------ 223
             +    T+   +    +  A  ++  G+  L + L                        
Sbjct: 174 ITAFTFATHAHQHGGAHADKAQTVLISGVAGLITYLVVGGLSGYFENRLEDEEEREEEAQ 233

Query: 224 -SSDSSNNVT-HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
            S  + + V   G+    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVR
Sbjct: 234 QSGGTGSPVKLAGQAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVR 293

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYS 341
           S+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +     I EI TG    ILI  S +S
Sbjct: 294 SLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILMVTIQYQINEIITGLVGVILIGWSFWS 353

Query: 342 SIKN 345
           S++ 
Sbjct: 354 SVRR 357


>gi|93004828|ref|YP_579231.1| hypothetical protein Pcryo_2516 [Psychrobacter cryohalolentis K5]
 gi|92395390|gb|ABE76293.1| protein of unknown function DUF475 [Psychrobacter cryohalolentis
           K5]
          Length = 354

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 199/320 (62%), Gaps = 13/320 (4%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           + G I+T+ I  ILAV+EISLSF+NA++NA  L+     W+K FLT GILIAVFGMR++F
Sbjct: 28  MGGLIATLSITAILAVMEISLSFDNAVVNASVLKGWDEFWKKIFLTVGILIAVFGMRLVF 87

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNK 158
           PI+IV + + +  ++ ++LA+  P++Y   +   H  IS FGG FL++V L F F+ + +
Sbjct: 88  PIVIVAVTADLGMMQVIDLALNDPKEYSARLMAHHAEISAFGGIFLLLVFLNFIFDDK-E 146

Query: 159 LHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINF 218
           +HW  +LE  ++ L K+  + +F+ L ++    +     +  + + +    I+++ G+  
Sbjct: 147 VHWFDWLESRLAKLGKVDAMSVFVALIVLMIAVSFANPEQSAAVLIAGIWGILVYLGVQV 206

Query: 219 LESVLSS------DSSNNVTHG------KHGLNLFLYLEIIDASLSLDGVISSFAITKNF 266
           +  +L        D+  N T        K G+  FLYLE++DAS S DGVI +FAIT + 
Sbjct: 207 VSGMLEGDLEEELDAQGNSTGAATSAIMKGGIIGFLYLEVLDASFSFDGVIGAFAITNDV 266

Query: 267 FIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIF 326
            +I++GL IGA++VRSMT+ ++ +G L+++ YLEHG++Y+I  L++IM L     +PE+ 
Sbjct: 267 IVIMLGLAIGAMFVRSMTIFLVDKGTLDEFVYLEHGAHYAIGALAIIMLLSVKFHVPELI 326

Query: 327 TGTSSTILIFLSIYSSIKNK 346
           TG      I  ++ +S+K++
Sbjct: 327 TGLIGIAFIGWALLASLKHR 346


>gi|296113354|ref|YP_003627292.1| hypothetical protein MCR_1135 [Moraxella catarrhalis RH4]
 gi|295921048|gb|ADG61399.1| conserved hypothetical protein [Moraxella catarrhalis RH4]
 gi|326559695|gb|EGE10106.1| hypothetical protein E9M_08618 [Moraxella catarrhalis 46P47B1]
 gi|326560335|gb|EGE10723.1| hypothetical protein E9G_07104 [Moraxella catarrhalis 7169]
 gi|326562006|gb|EGE12336.1| hypothetical protein E9K_08302 [Moraxella catarrhalis 103P14B1]
 gi|326566345|gb|EGE16495.1| hypothetical protein E9Q_07959 [Moraxella catarrhalis BC1]
 gi|326570155|gb|EGE20200.1| hypothetical protein E9U_04630 [Moraxella catarrhalis BC8]
 gi|326574500|gb|EGE24442.1| hypothetical protein E9Y_06042 [Moraxella catarrhalis 101P30B1]
 gi|326575912|gb|EGE25835.1| hypothetical protein E9W_03090 [Moraxella catarrhalis CO72]
 gi|326576376|gb|EGE26285.1| hypothetical protein EA1_05452 [Moraxella catarrhalis O35E]
          Length = 358

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 135/360 (37%), Positives = 216/360 (60%), Gaps = 31/360 (8%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVYICI----ILAVVEISLSFENAI 65
           + HF + I+ T   F+C  +   W ++H   G IS +++ +    ILA++EISLSF+NA+
Sbjct: 1   MRHFLFDIIFT---FVCLVIAAWWGYSH---GGISEMFLALGITAILAIMEISLSFDNAV 54

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+  +  W+K FLT GILIAVFGMR+IFPI IV + + +   E ++LA+ +P  Y
Sbjct: 55  VNASILKGWNDFWKKIFLTVGILIAVFGMRLIFPIAIVAVTANLGMGEVIHLALNNPVQY 114

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + ++  H  IS FGG FL++V L F F  ++ +HW  +LE  +   SK+  + +F+ L 
Sbjct: 115 AEHLNAHHAEISAFGGMFLLLVFLNFMFGDKD-VHWFKWLESRLVKFSKVDAMSVFVALV 173

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV------------TH 233
           ++    + +   +    + +    I+++ G++ L ++L  D  +              T 
Sbjct: 174 VLMISMSWVEEAKQGVVMVAGIWGILVYLGVSVLSALLEGDGDDKAAVYDAKGREITNTA 233

Query: 234 G------KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLM 287
           G      K G+  FLYLE++DAS S DGVI +FAIT +  +I+IGL IGA++VRSMT+ +
Sbjct: 234 GVSSTILKGGIAGFLYLEVLDASFSFDGVIGAFAITNDVIVIMIGLAIGAMFVRSMTIYL 293

Query: 288 LKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK-NK 346
           + +G L+ + YLEHG++Y+I  L++IM L T   +PEI TG      I LS+++SI+ NK
Sbjct: 294 VNKGTLSDFIYLEHGAHYAIGALAIIMLLSTRFHVPEIITGLIGVAFIVLSVFNSIQYNK 353


>gi|326563549|gb|EGE13808.1| hypothetical protein E9O_08327 [Moraxella catarrhalis 12P80B1]
          Length = 344

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 129/337 (38%), Positives = 205/337 (60%), Gaps = 27/337 (8%)

Query: 33  WQFTHTLSGTISTVYICI----ILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGIL 88
           W ++H   G IS +++ +    ILA++EISLSF+NA++NA  L+  +  W+K FLT GIL
Sbjct: 7   WGYSH---GGISEMFLALGITAILAIMEISLSFDNAVVNASILKGWNDFWKKIFLTVGIL 63

Query: 89  IAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVS 148
           IAVFGMR+IFPI IV + + +   E ++LA+ +P  Y + ++  H  IS FGG FL++V 
Sbjct: 64  IAVFGMRLIFPIAIVAVTANLGMGEVIHLALNNPVQYAEHLNAHHAEISAFGGMFLLLVF 123

Query: 149 LTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTA 208
           L F F  ++ +HW  +LE  +   SK+  + +F+ L ++    + +   +    + +   
Sbjct: 124 LNFMFGDKD-VHWFKWLESRLVKFSKVDAMSVFVALVVLMISMSWVEEAKQGVVMVAGIW 182

Query: 209 AIIIFYGINFLESVLSSDSSNNV------------THG------KHGLNLFLYLEIIDAS 250
            I+++ G++ L ++L  D  +              T G      K G+  FLYLE++DAS
Sbjct: 183 GILVYLGVSVLSALLEGDGDDKAAVYDAKGREITNTAGVSSTILKGGIAGFLYLEVLDAS 242

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FAIT +  +I+IGL IGA++VRSMT+ ++ +G L+ + YLEHG++Y+I  L
Sbjct: 243 FSFDGVIGAFAITNDVIVIMIGLAIGAMFVRSMTIYLVNKGTLSDFIYLEHGAHYAIGAL 302

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK-NK 346
           ++IM L T   +PEI TG      I LS+++SI+ NK
Sbjct: 303 AIIMLLSTRFHVPEIITGLIGVAFIVLSVFNSIQYNK 339


>gi|315637371|ref|ZP_07892586.1| integral membrane protein [Arcobacter butzleri JV22]
 gi|315478345|gb|EFU69063.1| integral membrane protein [Arcobacter butzleri JV22]
          Length = 359

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 130/323 (40%), Positives = 199/323 (61%), Gaps = 15/323 (4%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           L G    VY   IL+V+E+SLSF+NA++NA  L  M+ +W+KRFL WG++IAVFG+R +F
Sbjct: 26  LYGGFFAVYQGTILSVLELSLSFDNAVVNATILATMALVWRKRFLIWGMIIAVFGVRFVF 85

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNK 158
           PI+IV   + +  I++ NLA+ +P +Y +II  +H  I  FGG FL+M+ L F F+    
Sbjct: 86  PILIVYFSTPMGFIDSFNLAVTNPDEYERIIESSHHVIMSFGGMFLLMLFLKFIFDENKD 145

Query: 159 LHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN----------EMYSFVSSSTA 208
           LHWI  +E   + +SKI  +KI  +L ++ GI+ I P                 ++    
Sbjct: 146 LHWIKSIENFATKISKIGDVKILFILFLMLGITYIAPNQVVMGDNMVNVNKIEILAPMII 205

Query: 209 AIIIFYGINFLESVL----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITK 264
            +I FY I FL+  +      +S + +T    G   F+YLE+ID S SLDGV+ +FAIT+
Sbjct: 206 GVIAFYMIEFLKGFIEHRNEEESDSKITQVSGGFISFMYLELIDMSFSLDGVLGAFAITQ 265

Query: 265 NFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPE 324
           N  II++GL IGA+ VRS+T+ M+++ +++KY YLEHG+ +SI +LS+ M +Q    +P 
Sbjct: 266 NIVIIMLGLGIGAMAVRSLTIYMVERDVVSKYIYLEHGAMWSIGLLSLSMLVQIFHHLPP 325

Query: 325 IFTGTSSTILIFLS-IYSSIKNK 346
           +   T + + I L+ I+S  KNK
Sbjct: 326 MLVTTFAIVPITLAFIHSIYKNK 348


>gi|157737609|ref|YP_001490292.1| hypothetical protein Abu_1367 [Arcobacter butzleri RM4018]
 gi|157699463|gb|ABV67623.1| conserved hypothetical protein (DUF475 domain protein) [Arcobacter
           butzleri RM4018]
          Length = 359

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 130/323 (40%), Positives = 199/323 (61%), Gaps = 15/323 (4%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           L G    VY   IL+V+E+SLSF+NA++NA  L  M+ +W+KRFL WG++IAVFG+R +F
Sbjct: 26  LYGGFFAVYQGTILSVLELSLSFDNAVVNATILATMALVWRKRFLIWGMIIAVFGVRFVF 85

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNK 158
           PI+IV   + +  I++ NLA+ +P +Y +II  +H  I  FGG FL+M+ L F F+    
Sbjct: 86  PILIVYFSTPMGFIDSFNLAVTNPDEYERIIESSHHVIMSFGGMFLLMLFLKFIFDENKD 145

Query: 159 LHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN----------EMYSFVSSSTA 208
           LHWI  +E   + +SKI  +KI  +L ++ GI+ I P                 ++    
Sbjct: 146 LHWIKSIENFATKISKIGDVKILFILFLMLGITYIAPNQVVMGDNMVNVNKIEILAPMII 205

Query: 209 AIIIFYGINFLESVL----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITK 264
            +I FY I FL+  +      +S + +T    G   F+YLE+ID S SLDGV+ +FAIT+
Sbjct: 206 GVIAFYMIEFLKGFIEHKNEEESDSKITQVSGGFISFMYLELIDMSFSLDGVLGAFAITQ 265

Query: 265 NFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPE 324
           N  II++GL IGA+ VRS+T+ M+++ +++KY YLEHG+ +SI +LS+ M +Q    +P 
Sbjct: 266 NIVIIMLGLGIGAMAVRSLTIYMVERDVVSKYIYLEHGAMWSIGLLSLSMLVQIFHHLPP 325

Query: 325 IFTGTSSTILIFLS-IYSSIKNK 346
           +   T + + I L+ I+S  KNK
Sbjct: 326 MLVTTFAIVPITLAFIHSIYKNK 348


>gi|297194579|ref|ZP_06911977.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197722494|gb|EDY66402.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 381

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 202/362 (55%), Gaps = 40/362 (11%)

Query: 14  FRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQK 73
           F W+  VT  G        WQ+     G      I +IL+++EISLSF+NA++NA  L+K
Sbjct: 6   FGWSFAVTALGLAFA---AWQWGWEAFG------IVLILSILEISLSFDNAVVNAGILKK 56

Query: 74  MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAH 133
           M++ WQK FLT GILIAVFGMR++FP++IV I + + PIEA+ LA+  P  Y  +++ AH
Sbjct: 57  MNAFWQKIFLTIGILIAVFGMRLVFPVVIVAISAKVGPIEAVQLAMDQPDRYEDLVTDAH 116

Query: 134 VPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNI 193
             I+ FGG FL+M+ L F F  +    W+ +LE  ++ L K+  + + I L ++   +  
Sbjct: 117 AAIAAFGGMFLLMIFLDFIFEEREH-KWLAWLERPLAKLGKVDMLSVCIALIVLLLTAIT 175

Query: 194 LPTNEMYSFVSSSTAAIIIFYGINFLESVL------------------------------ 223
             TN   S   +  +A ++  G+  L + L                              
Sbjct: 176 FATNAHTSTGHADKSATVLLSGVAGLITYLVVGGLSGYFEDKLEEEEEREHEEEEKAKRE 235

Query: 224 SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSM 283
               S     GK    LFLYLE++DAS S DGVI +FAIT + F + +GL IGA+YVRS+
Sbjct: 236 GKPVSAVGLAGKAAFFLFLYLEVLDASFSFDGVIGAFAITNHIFWMALGLGIGAMYVRSL 295

Query: 284 TLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S +SS+
Sbjct: 296 TVYLVRQGTLDDYVYLEHGAHYAIGALAVILLITIQHEISELITGFIGVVLIAASFWSSL 355

Query: 344 KN 345
           + 
Sbjct: 356 RR 357


>gi|320011014|gb|ADW05864.1| protein of unknown function DUF475 [Streptomyces flavogriseus ATCC
           33331]
          Length = 383

 Score =  226 bits (575), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 127/354 (35%), Positives = 204/354 (57%), Gaps = 40/354 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V+        +  IL+V+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVFYGGWQAFGVVAILSVLEISLSFDNAVINAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV I + + PIEA++L+   P  Y ++++ AH  I+ FGG F
Sbjct: 67  TVGVLIAVFGMRLVFPVVIVAISAQLGPIEAIDLSFNDPDRYKELVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           L+M+ L F F  ++ + W+ ++E  ++ L K+  + + + L ++   +    T+   +  
Sbjct: 127 LLMIFLDFIFEDRD-IQWLRWIERPLAKLGKVDMLSVCVALIVLLVSAMTFATHAHQHGG 185

Query: 203 VSSSTAAIIIFYGINFLESVL------------------------------SSDSSNNVT 232
             +  A+ ++  GI  L + L                                  S  + 
Sbjct: 186 GHADKASTVMLSGIAGLITYLVVGGLSGFFENKLEEEEEREQEAEEEAKKAGKPVSGVLL 245

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FAIT    ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 246 AGKAAFFMFLYLEVLDASFSFDGVIGAFAITNEIVLMALGLGIGAMYVRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+ Y YLEHG++Y+I  LSVI+ +    +I E+ TG+   ILI  S +SS++  
Sbjct: 306 LDDYVYLEHGAHYAIGALSVILLVTIQYEINELITGSVGVILIGWSFWSSVRRN 359


>gi|256788010|ref|ZP_05526441.1| hypothetical protein SlivT_26287 [Streptomyces lividans TK24]
 gi|289771898|ref|ZP_06531276.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289702097|gb|EFD69526.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 380

 Score =  225 bits (573), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 130/354 (36%), Positives = 202/354 (57%), Gaps = 42/354 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V+        I  IL+++EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVFYGGWTAFGIVAILSIMEISLSFDNAVVNAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T GILIAVFGMR++FP++IV I +++ PIEA++LA+     Y ++++ AH  I+ FGG F
Sbjct: 67  TIGILIAVFGMRLVFPVVIVAISASLGPIEAVDLALTDKDRYQELVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNIL--PTNEMYS 201
           L+M+ L F F  ++ + W+ +LE  ++ L K+  + + I L ++  +S I        + 
Sbjct: 127 LLMIFLDFIFEDRD-IKWLAWLERPLAKLGKVDMLSVCIALVVLL-VSAITFGAHAHQHG 184

Query: 202 FVSSSTAAIIIFYGI-------------NFLESVL-----------------SSDSSNNV 231
              +  A  ++  GI              + E  L                     S   
Sbjct: 185 GAHADKAETVLLAGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEEEAARTGKPKSAVR 244

Query: 232 THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
             GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG
Sbjct: 245 LAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQG 304

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            L+ Y YLEHG++Y+I  L+VI+ +    +I EI TG     LI  S +SS++ 
Sbjct: 305 TLDDYVYLEHGAHYAIGALAVILLVTIQYEIHEIITGLVGVALIGWSFFSSVRR 358


>gi|21220834|ref|NP_626613.1| hypothetical protein SCO2366 [Streptomyces coelicolor A3(2)]
 gi|8246807|emb|CAB92842.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 380

 Score =  225 bits (573), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 130/354 (36%), Positives = 202/354 (57%), Gaps = 42/354 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V+        I  IL+++EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVFYGGWTAFGIVAILSIMEISLSFDNAVVNAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T GILIAVFGMR++FP++IV I +++ PIEA++LA+     Y ++++ AH  I+ FGG F
Sbjct: 67  TVGILIAVFGMRLVFPVVIVAISASLGPIEAVDLALTDKDRYQELVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNIL--PTNEMYS 201
           L+M+ L F F  ++ + W+ +LE  ++ L K+  + + I L ++  +S I        + 
Sbjct: 127 LLMIFLDFIFEDRD-IKWLAWLERPLAKLGKVDMLSVCIALVVLL-VSAITFGAHAHQHG 184

Query: 202 FVSSSTAAIIIFYGI-------------NFLESVL-----------------SSDSSNNV 231
              +  A  ++  GI              + E  L                     S   
Sbjct: 185 GAHADKAETVLLAGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEEEAARTGKPKSAVR 244

Query: 232 THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
             GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG
Sbjct: 245 LAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQG 304

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            L+ Y YLEHG++Y+I  L+VI+ +    +I EI TG     LI  S +SS++ 
Sbjct: 305 TLDDYVYLEHGAHYAIGALAVILLVTIQYEIHEIITGLVGVALIGWSFFSSVRR 358


>gi|260550235|ref|ZP_05824448.1| major facilitator family transporter [Acinetobacter sp. RUH2624]
 gi|260406763|gb|EEX00243.1| major facilitator family transporter [Acinetobacter sp. RUH2624]
          Length = 360

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 212/354 (59%), Gaps = 23/354 (6%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           + HFR++I  TV   +C  L   W FTH     +ST++    I  ILAV+E+SLSF+NA+
Sbjct: 1   MKHFRFSIFFTV---VCLALAAYWGFTHGPEAGVSTMFKALTITAILAVMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y
Sbjct: 58  VNASVLRGWDHFWKMIFLTVGILIAVFGMRLIFPVLIVSMTADMGFIEVAKMALNDPKTY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + +   H  IS FGGTFL++V L FFF+ + + HW  +LE+ +S L+ +  + +FI L 
Sbjct: 118 SERLMAHHAEISAFGGTFLLLVFLNFFFDEEKETHWFRWLEVKLSDLANVPAMSVFIALI 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFL------ESVLSSDSSNNVTHG----- 234
            +  ++  +  +E  +   +    I+++ G+  L      E  +  D +  +  G     
Sbjct: 178 ALIVMAGYVEDHERLAVTMAGVWGIVVYIGVQVLSHLLGGEPEIDEDGNAVMQDGSGAAS 237

Query: 235 ---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
              K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGA++VRSMT+ ++++G
Sbjct: 238 GVIKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAMFVRSMTVYLVEKG 297

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
            L+ Y +LEHG++Y+I  L+ IM    T + IPE+ TG      I  ++ +SI+
Sbjct: 298 TLDAYVFLEHGAHYAIGALAFIMIASGTGLHIPEVVTGLIGVAFIAWAVIASIQ 351


>gi|302551108|ref|ZP_07303450.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302468726|gb|EFL31819.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 381

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 199/353 (56%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V         +  IL+V+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVLFGGWTALGVVAILSVLEISLSFDNAVVNAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T GILIAVFGMR++FP++IV I + + P+EA+NLA+   + Y ++++ AH  I+ FGG F
Sbjct: 67  TVGILIAVFGMRLVFPVVIVAISAQLGPLEAVNLALNDKEQYQQLVTDAHPAIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           L+M+ L F F  ++ + W+ +LE  ++ L K+  + + I L ++   +     N   +  
Sbjct: 127 LLMIFLDFIFEDRD-IKWLAWLERPLAKLGKVDMLSVCIALIVLLISALTFAANAHQHGG 185

Query: 203 VSSSTAAIIIFYGI-------------NFLESVL-----------------SSDSSNNVT 232
                A  ++  GI              + E  L                     S    
Sbjct: 186 AHVDKAETVLLSGIAGLITYMIVGGLSGYFEDKLEEEEEREQEAEEEAERTGKPRSAVAL 245

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 246 AGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L+V++ +     I EI TG    +LI  S +SS++ 
Sbjct: 306 LDDYVYLEHGAHYAIGALAVLLLVTIQYQINEIITGLIGVVLIAASFWSSVRR 358


>gi|29832348|ref|NP_826982.1| hypothetical protein SAV_5805 [Streptomyces avermitilis MA-4680]
 gi|29609467|dbj|BAC73517.1| putative integral membrane protein [Streptomyces avermitilis
           MA-4680]
          Length = 381

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 127/353 (35%), Positives = 202/353 (57%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V         I  IL+++EISLSF+NA++NA  L+KMS+ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVIYGGWTAFGIVAILSILEISLSFDNAVVNAGILKKMSAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV + +  +PIEA+NLA+     Y ++++ AH  I+ FGG F
Sbjct: 67  TVGVLIAVFGMRLVFPVVIVAVTAKKSPIEAVNLALTDKDQYQQLVTDAHPAIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILP-------- 195
           L+M+ L F F  ++ + W+ ++E  ++ L K+  + + I L ++   S            
Sbjct: 127 LLMIFLDFIFEERD-IQWLRWIERPLAKLGKVDMLSVCIALVVLLVSSMTFAVHAHQHGG 185

Query: 196 --TNEMYSFVSSSTAAIIIFYGI----NFLESVL-----------------SSDSSNNVT 232
              ++  + + S  A +I +  +     + E  L                        V 
Sbjct: 186 AHVDKAQTVLISGIAGLITYMVVGGLSGYFEDKLEEEEEREHEEEEEAARTGKKKPAVVL 245

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            G+    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 246 AGQAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    ILI  S +SS++ 
Sbjct: 306 LDDYVYLEHGAHYAIGALAVILLVTIQYEIHEVITGLVGVILIAWSFWSSVRR 358


>gi|307323185|ref|ZP_07602395.1| protein of unknown function DUF475 [Streptomyces violaceusniger Tu
           4113]
 gi|306890674|gb|EFN21650.1| protein of unknown function DUF475 [Streptomyces violaceusniger Tu
           4113]
          Length = 382

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 127/353 (35%), Positives = 203/353 (57%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V+        I  IL+++EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVFYGGWTGFGIVAILSILEISLSFDNAVVNAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV I + I PIEA+ LA+     Y ++++ AH  I+ FGG F
Sbjct: 67  TIGVLIAVFGMRLVFPVVIVAISAKIGPIEAVRLALDDKDKYQQLVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           L+M+ L F F  + ++ W+ +LE  ++ L K+  + + I L ++   +    TN   +  
Sbjct: 127 LLMIFLDFIFE-EREIKWLGWLERPLAKLGKVDMLSVCIALIVLLVSAMTFATNAHQHGG 185

Query: 203 VSSSTAAIIIFYGINFLESVL--------------------------SSDSSNNVTH--- 233
           + +     ++  G+  + + L                          +  S   V     
Sbjct: 186 IHTDKTETVLIAGVAGVITYLIVAGLSGYFENKLEEEEEREHEAEEEAKKSGKKVPAVVM 245

Query: 234 -GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 246 AGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S +SS++ 
Sbjct: 306 LDDYIYLEHGAHYAIGALAVILLVTIQYEIHEVITGLVGVVLIAWSFFSSVQR 358


>gi|302534235|ref|ZP_07286577.1| integral membrane protein [Streptomyces sp. C]
 gi|302443130|gb|EFL14946.1| integral membrane protein [Streptomyces sp. C]
          Length = 379

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 130/353 (36%), Positives = 204/353 (57%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V+        I  IL+++EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 9   GWSFAVTALGLVAAVFYGGWTAFGIVAILSILEISLSFDNAVVNAGILKKMNAFWQKIFL 68

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV I + I PIEA++LA+   + Y ++++ AH  I+ FGG F
Sbjct: 69  TVGVLIAVFGMRLVFPVVIVAISAKIGPIEAVDLAMTDKEMYKQLVTDAHPSIAAFGGMF 128

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           L+M+ L F F  ++ + W+ +LE  ++ L KI  +   I L ++   S     N   +  
Sbjct: 129 LLMIFLDFIFEDRD-IKWLAWLERPLAKLGKIDMLSACIALIVLVITSMTFAANAHQHGG 187

Query: 203 VSSSTAAIIIFYGI-------------NFLESVL-------------SSDSSNNVT---- 232
                A  ++  G+              + E+ L             +  S   V+    
Sbjct: 188 THVDKAQTVLVSGVLGLITYMIVGGLSGYFENKLEEEEEAEHEAEEAAKKSGKPVSAVAM 247

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 248 AGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGT 307

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S +SS++ 
Sbjct: 308 LDDYVYLEHGAHYAIGALAVILLVTIQYEINEVITGLVGVVLIAWSFWSSVRR 360


>gi|254382840|ref|ZP_04998196.1| integral membrane protein [Streptomyces sp. Mg1]
 gi|194341741|gb|EDX22707.1| integral membrane protein [Streptomyces sp. Mg1]
          Length = 373

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 132/353 (37%), Positives = 200/353 (56%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V+        I  IL V+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 9   GWSFAVTALGLVAAVFYGGWTAFGIVAILTVLEISLSFDNAVVNAGILKKMNAFWQKIFL 68

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV I + I PIEA++LA+     Y ++++ AH  I+ FGG F
Sbjct: 69  TVGVLIAVFGMRLVFPVVIVAISAKIGPIEAVDLALNDKNMYEQLVTDAHPSIAAFGGMF 128

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           L+M+ L F F  ++ + W+ +LE  ++ L KI  +   I L ++   S     N   +  
Sbjct: 129 LLMIFLDFIFEDRD-IKWLAWLERPLAKLGKIDMLSACIALIVLVITSMTFAANAHQHGG 187

Query: 203 VSSSTAAIIIFYGI-------------NFLESVL-----------------SSDSSNNVT 232
           V    A  ++  GI              + E+ L                     S    
Sbjct: 188 VHVDKAQTVLVSGILGLITYMVVGGLSGYFENKLEEEEEAEHEAEEEAKKTGKPVSAVAM 247

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 248 AGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGT 307

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S +SS++ 
Sbjct: 308 LDDYVYLEHGAHYAIGALAVILLVTIQYEINEVITGLVGVVLIGWSFWSSVRR 360


>gi|290960799|ref|YP_003491981.1| integral membrane protein [Streptomyces scabiei 87.22]
 gi|260650325|emb|CBG73441.1| putative integral membrane protein [Streptomyces scabiei 87.22]
          Length = 381

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 199/353 (56%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V         +  IL+V+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVLYDGWTAFGVVAILSVLEISLSFDNAVVNAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T GILIAVFGMR++FP++IV I + ++PIEA++LA+     Y + ++ AH  I+ FGG F
Sbjct: 67  TVGILIAVFGMRLVFPVVIVAISAKVSPIEAVDLALTDKDQYQQYVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           L+M+ L F F  ++ + W+ +LE  ++ L K+  +   I + ++   S    TN   +  
Sbjct: 127 LLMIFLDFIFEDRD-IKWLSWLERPLAKLGKVDMLSACIAMIVLLVTSMTFATNAHQHGG 185

Query: 203 VSSSTAAIIIFYGI-------------NFLESVL-----------------SSDSSNNVT 232
                A  ++  G+              F E+ L                     S    
Sbjct: 186 AHVDKAQTVLISGLAGLITYLIVGGLSGFFENKLEEEEEREHEEEEAAERAGKPRSAVAL 245

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 246 AGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L+ I+ +    +I E  TG+   ILI  S +SS++ 
Sbjct: 306 LDDYVYLEHGAHYAIGALAAILLVTIQYEINEFITGSIGVILIAWSFWSSVRR 358


>gi|257461093|ref|ZP_05626191.1| integral membrane protein [Campylobacter gracilis RM3268]
 gi|257441467|gb|EEV16612.1| integral membrane protein [Campylobacter gracilis RM3268]
          Length = 336

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 125/310 (40%), Positives = 190/310 (61%), Gaps = 11/310 (3%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G     YIC++L V+EISLSF+NA++NAK L+ M+ +WQ RF+ WGI IAVFGMR +FP+
Sbjct: 22  GGAGAAYICVLLCVLEISLSFDNAVVNAKVLKDMAPVWQSRFILWGIPIAVFGMRFLFPV 81

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV   + +   E + LA+  PQ Y +I+S+    I  FGG FL+MV   FFF++Q +LH
Sbjct: 82  LIVAASAHLGLWETLVLALKQPQRYHEILSENEAQIYVFGGAFLLMVFCDFFFDAQRELH 141

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLE 220
           W+  +E     +  +K I     L  +     +L      +  ++   AI+++  I+  +
Sbjct: 142 WLGIIE-NNGLVRFLKRIPNAPTLIALAAGLVLLAKTGSATLGAAYFGAILLYLLISCFD 200

Query: 221 SVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
            +  +D   N      GL  FLYLE +DAS S DGVI +FA++ N FII++GL  GA++V
Sbjct: 201 RLFGTDGVKN------GLAGFLYLETLDASFSFDGVIGAFALSDNIFIIMLGLGAGAMFV 254

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
           RS+TL ++ +G L+ + YLEHG++Y+I  L+ IMF +   ++ EI TGT   + I LS+ 
Sbjct: 255 RSITLYLIARGTLSHFAYLEHGAHYAIACLAFIMFAKLKFEVSEIITGTVGILFIALSLL 314

Query: 341 SSI----KNK 346
           SS+    +NK
Sbjct: 315 SSVLYNRRNK 324


>gi|329934789|ref|ZP_08284830.1| Integral membrane protein [Streptomyces griseoaurantiacus M045]
 gi|329305611|gb|EGG49467.1| Integral membrane protein [Streptomyces griseoaurantiacus M045]
          Length = 379

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 201/353 (56%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V+        I  ILAV+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAITALGLVAAVFYDGWTGFGIVAILAVLEISLSFDNAVVNAGVLKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV I + +NP +A++LA    + Y ++++ AH  I+ FGG F
Sbjct: 67  TIGVLIAVFGMRLVFPVVIVAITAKLNPWDAVDLAFSDKERYQQLVTDAHPAIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL-SIIFGISNILPTNEMYSF 202
           L+M+ L F F  ++ + W+ +LE  ++ L K+  + + I L +++     +      +  
Sbjct: 127 LLMIFLDFIFEDRD-IKWLAWLERPLAKLGKVDMLSVCIALIALLISSMTVAAHAHQHGG 185

Query: 203 VSSSTAAIIIFYGINFLESVL------------------------------SSDSSNNVT 232
           V       ++  GI  L + +                                  S  + 
Sbjct: 186 VHVDKGQTVLLSGIAGLITYMIVGGLSGYFEDRLEEQEEREHEEEEAAERSGRKKSPVLL 245

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            G+    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 246 AGQAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVMMALGLGIGAMYVRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S +SS++ 
Sbjct: 306 LDDYVYLEHGAHYAIGALAVILLVTIQYEINEVITGLVGVVLIAWSFWSSVRR 358


>gi|294629126|ref|ZP_06707686.1| integral membrane protein [Streptomyces sp. e14]
 gi|292832459|gb|EFF90808.1| integral membrane protein [Streptomyces sp. e14]
          Length = 379

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 126/353 (35%), Positives = 201/353 (56%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T+ G I+ V+        +  ILAV+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 5   GWSFAITVLGLIAAVFYGGWTAFGVVAILAVLEISLSFDNAVVNAGILKKMNAFWQKIFL 64

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV I + + PIEA++LA      Y ++++ AH  I+ FGG F
Sbjct: 65  TVGVLIAVFGMRLVFPVVIVAITAKMGPIEAVHLAFSDKDRYQQLVTDAHPAIAAFGGMF 124

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPT------- 196
           L+M+ L F F  ++ + W+ ++E  ++ L K+  + + I L ++   S    T       
Sbjct: 125 LLMIFLDFIFEDRD-IQWLRWIERPLAKLGKVDMLSVCIALIVLLITSFTFATHAHQHGG 183

Query: 197 ---NEMYSFVSSSTAAIIIFYGINFLESVL---------------------SSDSSNNVT 232
              ++  + + +  A +I +  +  L                                V 
Sbjct: 184 GHVDKAQTVLIAGIAGLITYMVVGGLSGFFEDRLEDEEEREHEEEEAAARSGKQKPAIVL 243

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            G+    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 244 AGQAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVMMALGLGIGAMYVRSLTVYLVRQGT 303

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L+VI+ +     I E+ TG    +LI  S +SS++ 
Sbjct: 304 LDDYVYLEHGAHYAIGALAVILMVTIQYQINEVITGLVGVVLIAWSFWSSVRR 356


>gi|117164786|emb|CAJ88335.1| putative integral membrane protein [Streptomyces ambofaciens ATCC
           23877]
          Length = 366

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 134/373 (35%), Positives = 212/373 (56%), Gaps = 53/373 (14%)

Query: 10  LIHHFRWAILVTVAGFLCG-LGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           L+  FRWA  VT  G   G L  GW    T  G ++      ILAV+E+SLSF+NA++NA
Sbjct: 2   LVKTFRWAFAVTALGLAAGVLYEGW----TAFGLVA------ILAVLEVSLSFDNAVINA 51

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+KMS+ WQK FLT GI+IAVFGMR++FP++IV + + ++P  A++LA+   + Y ++
Sbjct: 52  GILKKMSAFWQKIFLTVGIVIAVFGMRLVFPVVIVAVSARLSPWSAVHLALTDKERYQEL 111

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL---- 184
           ++ AH  I+ FGG FL+M+ L F    + ++ W+  LE A++ L K+  + + + L    
Sbjct: 112 VTDAHPSIAAFGGMFLLMIFLDFVLEDR-EIKWLGPLERALAKLGKVDMLSVCVALIVLL 170

Query: 185 --SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVL------------------- 223
             +I FG          +  + +  A  ++  GI  L + +                   
Sbjct: 171 VSAITFG-----AHAHQHGGIHADKAETVLLAGIGGLITYMVVGGLSGFFEDRLEREEER 225

Query: 224 -------SSDSSNNVTH----GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG 272
                  ++ S  N +     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +G
Sbjct: 226 ERDAETAAARSGGNRSAVALTGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALG 285

Query: 273 LTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSST 332
           L IGA+YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    
Sbjct: 286 LGIGAMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIEYEINEVVTGLIGV 345

Query: 333 ILIFLSIYSSIKN 345
           +LI  S +SS++ 
Sbjct: 346 VLIGASFWSSVRR 358


>gi|299768440|ref|YP_003730466.1| hypothetical protein AOLE_00950 [Acinetobacter sp. DR1]
 gi|298698528|gb|ADI89093.1| hypothetical protein AOLE_00950 [Acinetobacter sp. DR1]
          Length = 360

 Score =  222 bits (565), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 210/354 (59%), Gaps = 23/354 (6%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           + HFR++I  TV   +C  L   W FTH     +ST+     I  ILAV+E+SLSF+NA+
Sbjct: 1   MKHFRFSIFFTV---VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   LA+  P+ Y
Sbjct: 58  VNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKLALNDPKTY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  +S L+ +  + +FI L 
Sbjct: 118 SERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLSSLASVPAMSVFIALI 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-----SDSSNNVTHG------ 234
            +  ++  +  ++  +   +    I+++ G+  L  +L       ++ N V         
Sbjct: 178 ALIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAAS 237

Query: 235 ---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
              K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G
Sbjct: 238 GVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKG 297

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
            L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+
Sbjct: 298 TLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQ 351


>gi|302557720|ref|ZP_07310062.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302475338|gb|EFL38431.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 371

 Score =  222 bits (565), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 127/353 (35%), Positives = 200/353 (56%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V         I  IL+++EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVLFGGWTAFGIVAILSILEISLSFDNAVVNAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T GILIAVFGMR++FP++IV I + + PIEA++LA+     Y ++++ AH  I+ FGG F
Sbjct: 67  TIGILIAVFGMRLVFPVVIVAISAQLGPIEAVDLALSDKDRYQELVTDAHPAIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           L+M+ L F F  ++ + W+ +LE  ++ L K+  + + I L I+   +    TN   +  
Sbjct: 127 LLMIFLDFIFEDRD-IKWLAWLERPLAKLGKVDMLSVCIALVILLISAMTFATNAHQHGG 185

Query: 203 VSSSTAAIIIFYGINFLESVL------------------------------SSDSSNNVT 232
             +  A  ++  GI  L + +                                  +    
Sbjct: 186 GHADKAETVLLSGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEEKAERAGKPRTGVAL 245

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 246 AGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L++I+ +     I E+ TG    +LI  S +SS++ 
Sbjct: 306 LDDYVYLEHGAHYAIGALALILLVTIQYQIHELITGLIGVVLIGASFWSSVRR 358


>gi|302560847|ref|ZP_07313189.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302478465|gb|EFL41558.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 379

 Score =  222 bits (565), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 127/353 (35%), Positives = 200/353 (56%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V         I  IL+++EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVLFGGWTAFGIVAILSILEISLSFDNAVVNAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T GILIAVFGMR++FP++IV I + + PIEA++LA+     Y ++++ AH  I+ FGG F
Sbjct: 67  TIGILIAVFGMRLVFPVVIVAISAQLGPIEAVDLALSDKDRYQELVTDAHPAIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           L+M+ L F F  ++ + W+ +LE  ++ L K+  + + I L I+   +    TN   +  
Sbjct: 127 LLMIFLDFIFEDRD-IKWLAWLERPLAKLGKVDMLSVCIALVILLISAMTFATNAHQHGG 185

Query: 203 VSSSTAAIIIFYGINFLESVL------------------------------SSDSSNNVT 232
             +  A  ++  GI  L + +                                  +    
Sbjct: 186 GHADKAETVLLSGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEEKAERAGKPRTGVAL 245

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 246 AGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L++I+ +     I E+ TG    +LI  S +SS++ 
Sbjct: 306 LDDYVYLEHGAHYAIGALALILLVTIQYQIHELITGLIGVVLIGASFWSSVRR 358


>gi|152967254|ref|YP_001363038.1| hypothetical protein Krad_3310 [Kineococcus radiotolerans SRS30216]
 gi|151361771|gb|ABS04774.1| protein of unknown function DUF475 [Kineococcus radiotolerans
           SRS30216]
          Length = 380

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 126/361 (34%), Positives = 208/361 (57%), Gaps = 36/361 (9%)

Query: 14  FRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQK 73
           +RW+ +VT  G +      W       G    + + +IL+++EISLSF+NA++NA  L++
Sbjct: 6   YRWSFVVTALGLVLA---AWYGLSAHLGIGQAIALVLILSILEISLSFDNAVVNATILER 62

Query: 74  MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY-----SPQDYLKI 128
           MS  W+K FL+ GI+IAVFGMR++FPI++V + + + PIE + LA+      +P  Y   
Sbjct: 63  MSDFWRKIFLSVGIIIAVFGMRLVFPIVLVSVTAGLGPIEVIRLALEGGDPETPGTYGYE 122

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           + +AH  I+ FGG FL+M+ L F F  +   HW+  +E A+  + K+  +++ +  +++ 
Sbjct: 123 LHEAHPTIASFGGMFLLMLFLNFIFGEKEH-HWLGPIERALEKVGKLDYVQVIVAGAVLL 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH--------------- 233
            ++    T    + ++S  A I+ +  +N L  + + +  ++V H               
Sbjct: 182 VVAETFATEHGRTVLASGLAGIVTYLLVNGLGELFNVE--DHVEHEDPATTSAGTTASGV 239

Query: 234 ----------GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSM 283
                     GK    LFLYLE++DAS S DGVI +FAIT +  II IGL +GA+Y+RSM
Sbjct: 240 NGPSGAARATGKAAFFLFLYLEVLDASFSFDGVIGAFAITSDPVIIAIGLGVGAMYIRSM 299

Query: 284 TLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           T+ ++++G L +Y YLE+G+ ++I  L+VI+ L   V+IPE+ TG      I  S+ SSI
Sbjct: 300 TVHLVEEGTLAQYPYLENGALWAIGALAVILLLSIEVEIPEVVTGLIGLAFIVASLISSI 359

Query: 344 K 344
           +
Sbjct: 360 R 360


>gi|326780652|ref|ZP_08239917.1| protein of unknown function DUF475 [Streptomyces cf. griseus
           XylebKG-1]
 gi|326660985|gb|EGE45831.1| protein of unknown function DUF475 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 387

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 127/355 (35%), Positives = 206/355 (58%), Gaps = 42/355 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G +  V         +  IL+++EIS+SF+NA++NA  L+KM++ WQ+ FL
Sbjct: 12  GWSFAVTALGLVVAVLYGGWAAFGVVAILSILEISVSFDNAVVNAGILKKMNAFWQRIFL 71

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV I + + P+EA++LAI   + Y ++++ AH  I+ FGG F
Sbjct: 72  TIGVLIAVFGMRLVFPVVIVAISAKVGPVEAVDLAINDAERYEQLVTDAHPSIAAFGGMF 131

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFV 203
           L+M+ L F F  ++ + W+ +LE  ++   KI    + + L I+  IS +    + +   
Sbjct: 132 LLMIFLDFVFEDRD-IKWLGWLERPLAKFGKIDMASVCVAL-IVLAISAMTFATQAHQHG 189

Query: 204 SS--STAAIIIFYGI-------------NFLESVL-------------SSDSSNNVT--- 232
            +    A+ ++  G+              F E+ L             +  S  N     
Sbjct: 190 GTHVDKASTVLLSGVFGLITYLVVGGLSGFFENKLEEEEEREHEAEEEARRSGRNAPVVL 249

Query: 233 -HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
             GK    +FLYLE++DAS S DGVI++FAIT +  ++ +GL IGA+YVRS+T+ +++QG
Sbjct: 250 MAGKAAFFMFLYLEVLDASFSFDGVIAAFAITNDIVLMSLGLGIGAMYVRSLTVYLVRQG 309

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L+ Y YLEHG++Y+I  L+VI+ +     IPE+ TG    +LI  S +SS+++ 
Sbjct: 310 TLDDYIYLEHGAHYAIGALAVILMISIRYQIPEVVTGLIGVLLIAGSFWSSVRHN 364


>gi|182439985|ref|YP_001827704.1| hypothetical protein SGR_6192 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178468501|dbj|BAG23021.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
          Length = 382

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 127/355 (35%), Positives = 206/355 (58%), Gaps = 42/355 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G +  V         +  IL+++EIS+SF+NA++NA  L+KM++ WQ+ FL
Sbjct: 7   GWSFAVTALGLVVAVLYGGWAAFGVVAILSILEISVSFDNAVVNAGILKKMNAFWQRIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV I + + P+EA++LAI   + Y ++++ AH  I+ FGG F
Sbjct: 67  TIGVLIAVFGMRLVFPVVIVAISAKVGPVEAVDLAINDAERYEQLVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFV 203
           L+M+ L F F  ++ + W+ +LE  ++   KI    + + L I+  IS +    + +   
Sbjct: 127 LLMIFLDFVFEDRD-IKWLGWLERPLAKFGKIDMASVCVAL-IVLAISAMTFATQAHQHG 184

Query: 204 SS--STAAIIIFYGI-------------NFLESVL-------------SSDSSNNVT--- 232
            +    A+ ++  G+              F E+ L             +  S  N     
Sbjct: 185 GTHVDKASTVLLSGVFGLITYLVVGGLSGFFENKLEEEEEREHEAEEEARRSGRNAPVVL 244

Query: 233 -HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
             GK    +FLYLE++DAS S DGVI++FAIT +  ++ +GL IGA+YVRS+T+ +++QG
Sbjct: 245 MAGKAAFFMFLYLEVLDASFSFDGVIAAFAITNDIVLMSLGLGIGAMYVRSLTVYLVRQG 304

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L+ Y YLEHG++Y+I  L+VI+ +     IPE+ TG    +LI  S +SS+++ 
Sbjct: 305 TLDDYIYLEHGAHYAIGALAVILMISIRYQIPEVVTGLIGVLLIAGSFWSSVRHN 359


>gi|255320296|ref|ZP_05361481.1| integral membrane protein [Acinetobacter radioresistens SK82]
 gi|262380493|ref|ZP_06073647.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|255302735|gb|EET81967.1| integral membrane protein [Acinetobacter radioresistens SK82]
 gi|262297939|gb|EEY85854.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 360

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 135/356 (37%), Positives = 206/356 (57%), Gaps = 23/356 (6%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           + HFR++I  TV   +C  L   W +TH     I T++    I  ILAV+E+SLSF+NA+
Sbjct: 1   MKHFRFSIFFTV---VCLALSAYWGYTHGPQAGIETMFKALTITAILAVMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  +E + LA+  P  Y
Sbjct: 58  VNASVLRNWDHFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGLMEVVRLALNDPTAY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + +   H  I+ FGG FL++V L FF +     HW  +LE  ++ L+ +  + +FI L 
Sbjct: 118 SQRLMDHHAEIAAFGGAFLLLVFLNFFLDEGKDTHWFRWLERRLTSLASVPAMSVFIALI 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-----SDSSNNVTHG------ 234
            +  ++  +   +      +    I+I+ G+  L  +L       +  N VTH       
Sbjct: 178 ALLVVAANVDETKRLVVTMAGIWGIVIYIGVQVLSHLLGGEPEIDEEGNAVTHDSTGAAT 237

Query: 235 ---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
              K G   FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ ++++G
Sbjct: 238 GVVKAGFGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEKG 297

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L+ Y YLEHG++Y+I  L++IM    T V IPE+ TG      I  ++ +SI+ +
Sbjct: 298 TLDAYIYLEHGAHYAIGALAIIMLASGTGVHIPEVVTGLIGVAFIVWAVLASIQYR 353


>gi|262280447|ref|ZP_06058231.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258225|gb|EEY76959.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 360

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 209/354 (59%), Gaps = 23/354 (6%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           + HFR++I  TV   +C  L   W FTH     +ST+     I  ILAV+E+SLSF+NA+
Sbjct: 1   MKHFRFSIFFTV---VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GILIAVFGMR+IFP+ IV + + +  IE   LA+  P+ Y
Sbjct: 58  VNASVLRNWDPFWKMLFLTVGILIAVFGMRLIFPVAIVAVTADMGMIEVAKLALNDPKTY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  +S L+ +  + +FI L 
Sbjct: 118 SERLMAHHAEISAFGGTFLLLVFLNFFFDEEKETHWFRWLEAKLSSLASVPAMSVFIALI 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFL------ESVLSSDSSNNVTHG----- 234
            +  ++  +  ++      +    I+++ G+  L      E  +  D +  +  G     
Sbjct: 178 AMLIMAANVDESQRLVVTMAGIWGIVVYIGVEVLSHMLGGEPEIDEDGNAIMKDGSGAAS 237

Query: 235 ---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
              K G+  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G
Sbjct: 238 GVVKAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKG 297

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
            L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++++SI+
Sbjct: 298 TLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVFASIQ 351


>gi|297160887|gb|ADI10599.1| hypothetical protein SBI_07479 [Streptomyces bingchenggensis BCW-1]
          Length = 386

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 134/378 (35%), Positives = 212/378 (56%), Gaps = 54/378 (14%)

Query: 10  LIHHFRWAILVTVAGF-LCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           L+  F W+  VT AG  L G+  GW+           + I  IL+++EISLSF+NA++NA
Sbjct: 2   LLKTFGWSFAVTAAGLALAGVLWGWK----------GLAIVGILSILEISLSFDNAVINA 51

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + P+EA++LAI +   Y  +
Sbjct: 52  GVLRKMNAFWQKIFLTVGILIAVFGMRLVFPVIIVAITAKMGPLEAVDLAINNKDKYEHL 111

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+ FGG FL+M+ L F F  ++ + W+ +LE  ++ L K++ + I + L ++ 
Sbjct: 112 VTAAHPAIAAFGGMFLLMIFLDFIFEERD-IKWLGWLERPLAKLGKLETLSIVVALLVLL 170

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGI-------------NFLESVL------------ 223
             +    T+  +        A ++  G+              + E  L            
Sbjct: 171 VTAMTFATDVAHG--GGDKTATVLLAGVAGLLTYLIVGGISGYFEDKLEEEEEEVEEAEE 228

Query: 224 ----------SSDSSNNVT----HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFII 269
                     +   S   T     GK    LFLYLE+IDAS S DGVI +FAIT + F +
Sbjct: 229 AERAEKAASGAQKGSQGATVVGLAGKAAFFLFLYLEVIDASFSFDGVIGAFAITNDIFEM 288

Query: 270 VIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGT 329
            +GL IGA+Y+RS+T+ ++++G L+ Y YLEHG++Y+I  L+ I+ +    +I E+ TG 
Sbjct: 289 ALGLGIGAMYIRSLTVYLVRKGTLDDYVYLEHGAHYAIGALAAILLITIKYEIHEVITGL 348

Query: 330 SSTILIFLSIYSS-IKNK 346
              +LI  S +SS ++N+
Sbjct: 349 IGIVLIGASYWSSVVRNR 366


>gi|239933245|ref|ZP_04690198.1| hypothetical protein SghaA1_33788 [Streptomyces ghanaensis ATCC
           14672]
 gi|291441593|ref|ZP_06580983.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291344488|gb|EFE71444.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 363

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 129/368 (35%), Positives = 207/368 (56%), Gaps = 42/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCG-LGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           L+  FRW  +VT  G   G L  GW          + + +  ILAV+E+SLSF+NA++NA
Sbjct: 2   LLKTFRWTFVVTALGLAAGALYDGW----------TALGLVAILAVLEVSLSFDNAVINA 51

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++++  WQK FLT GILIAVFGMR++FPI+IV + + + P +A++LA+     Y ++
Sbjct: 52  GILKRLNVFWQKIFLTVGILIAVFGMRLLFPIVIVAVSARLTPSQAVHLALTDKARYQEL 111

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+ FGG FL+M+ L F F   ++  W+  +E  ++ L +I  + + I L+++ 
Sbjct: 112 VTDAHPSIAAFGGMFLLMIFLDFVFE-DHETKWLGPVERLLAKLGRIDMLSVCIALAVLL 170

Query: 189 GISNILPTN-EMYSFVSSSTAAIIIFYGI-------------NFLESVLSSDSSNNVTH- 233
             S     +   +  V +  A  ++  GI              F E  L++  + +    
Sbjct: 171 VTSMTFAAHAHQHGGVHADKAQTVLVSGIAGLITYLVVGGLSGFFEDRLAARENESRAEQ 230

Query: 234 ---------------GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                          GK     FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 231 RPEGVGGGRSAVALAGKAAFFTFLYLEVLDASFSFDGVIGAFAITNDIILMALGLGIGAM 290

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L++I+ +    +I +I TG     LI  S
Sbjct: 291 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALALILLVSIQYEINDIVTGLIGVTLICAS 350

Query: 339 IYSSIKNK 346
            YSS+++ 
Sbjct: 351 FYSSVRHN 358


>gi|313683193|ref|YP_004060931.1| hypothetical protein Sulku_2071 [Sulfuricurvum kujiense DSM 16994]
 gi|313156053|gb|ADR34731.1| protein of unknown function DUF475 [Sulfuricurvum kujiense DSM
           16994]
          Length = 326

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 200/309 (64%), Gaps = 13/309 (4%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G ++ +YI  +L V+EISLSF+NA++NAK L+ M  +WQKRF+ +GI IAVFGMR++FP+
Sbjct: 22  GGLTAIYITFLLIVLEISLSFDNAVVNAKVLETMDPVWQKRFIVFGIPIAVFGMRLVFPL 81

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
            IV IV+ +  +E + +A+  P +Y K++      I  FGG FL+MV L FFF  ++ + 
Sbjct: 82  AIVSIVTGMGLMETLQVAMNQPSEYEKVLKATESTIFAFGGAFLLMVFLDFFFEERD-IK 140

Query: 161 WIHFLEIA--MSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINF 218
           W+ F+E +  M   S +  I+  ++ +I+ GI+    T + +  V +    +++   +  
Sbjct: 141 WVTFVEGSKMMETFSGVANIE--LITAIMIGIALGHITQD-FGVVLAFMYGVLLHSLLGM 197

Query: 219 LESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
           L+  LSSD+       K G+  F+YLE++DAS S DGVI +FA+T N FII+IGL +GA+
Sbjct: 198 LDHFLSSDTV------KSGIAGFIYLEVLDASFSFDGVIGAFALTSNIFIIMIGLGVGAM 251

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           +VRS+TL  ++   L++++YLEHG++Y+I +L++IM ++    I E+ TGT    LI ++
Sbjct: 252 FVRSITLYFVEHKTLSEFRYLEHGAHYAIGILAIIMLMKITTHISEMVTGTIGIGLITIA 311

Query: 339 IYSSI-KNK 346
              SI +NK
Sbjct: 312 FLHSIWENK 320


>gi|297199370|ref|ZP_06916767.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|297147381|gb|EDY59331.2| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 382

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 204/353 (57%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V         +  IL+++EISLSF+NA++NA  L+KM++ WQ+ FL
Sbjct: 7   GWSFAVTALGLVAAVLYGGWEGFGVVAILSILEISLSFDNAVVNAGILKKMNAFWQRIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++FP++IV I + + PIEA++LA+ +   Y ++++ AH  I+ FGG F
Sbjct: 67  TVGVLIAVFGMRLVFPVVIVAISAKMGPIEAVDLALNNKDHYQELVTDAHPAIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPT------- 196
           L+M+ L F F  ++ + W+ ++E  ++ L K+  + + I L ++   +    T       
Sbjct: 127 LLMIFLDFIFEDRD-IQWLRWIERPLAKLGKVDMLSVCIALVVLLITAFTFATHAHQHGG 185

Query: 197 ---NEMYSFVSSSTAAIIIFYGI----NFLESVL-----------------SSDSSNNVT 232
              ++  + + S  A +I +  +     + E  L                     S  + 
Sbjct: 186 AHVDKAQTVLISGIAGLITYMVVGGLSGYFEDKLEEDEEREHEEEERAEREGKSKSAVLM 245

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 246 AGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L+VI+ +    +I EI TG    +LI  S  SS++ 
Sbjct: 306 LDDYVYLEHGAHYAIGALAVILMVTIQYEIHEIITGLVGVLLIGWSFLSSVRR 358


>gi|193078634|gb|ABO13678.2| putative integral membrane protein [Acinetobacter baumannii ATCC
           17978]
          Length = 360

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 133/354 (37%), Positives = 210/354 (59%), Gaps = 23/354 (6%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           + HFR++I  TV   +C  L   W FTH     +ST+     I  ILAV+E+SLSF+NA+
Sbjct: 1   MKHFRFSIFFTV---VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y
Sbjct: 58  VNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKMALNDPKTY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L 
Sbjct: 118 SERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALI 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-----SDSSNNVTHG------ 234
            +  ++  +  ++  +   +    I+++ G+  L  +L       ++ N V         
Sbjct: 178 ALIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGTGAAS 237

Query: 235 ---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
              K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G
Sbjct: 238 GVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKG 297

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
            L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+
Sbjct: 298 TLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQ 351


>gi|21219096|ref|NP_624875.1| hypothetical protein SCO0562 [Streptomyces coelicolor A3(2)]
 gi|6013085|emb|CAB57414.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 370

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 208/372 (55%), Gaps = 47/372 (12%)

Query: 10  LIHHFRWAILVTVAGFLCG-LGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           L+  FRWA  VT  G   G L  GW          + + I  IL+V+EISLSF+NA++NA
Sbjct: 2   LLKTFRWAFAVTALGLAAGVLYDGW----------TALGIVAILSVLEISLSFDNAVINA 51

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+KM++ WQ+ FLT GI+IAVFGMR++FP++IV + + ++P  A++LA+     Y ++
Sbjct: 52  GILKKMNAFWQRIFLTVGIVIAVFGMRLVFPVVIVAVSARLSPWSAVHLALTDKDRYQEL 111

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+ FGG FLMM+ L F F  ++ + W+ +LE  ++ L ++  + + I L ++ 
Sbjct: 112 VTDAHPSIAAFGGMFLMMIFLDFVFEDRD-IKWLGWLERPLAKLGRVDMLSVCIALVVLL 170

Query: 189 GISNILPTN-EMYSFVSSSTAAIIIFYGINFL---------------------------- 219
             +     +   +    +  A  ++  G+  L                            
Sbjct: 171 VSATTFGAHAHQHGGAHADKAETVLLAGVAGLITYMVVGGLSGFFEQRLEDEEEREQEAE 230

Query: 220 -----ESVLSSDSSNNVT-HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
                ++  +    + V   GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL
Sbjct: 231 KRAEKDAERAGRPGSPVKLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGL 290

Query: 274 TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTI 333
            IGA+YVRS+T+ +++QG L+ Y YLEHG++Y+I  LS+I+ +    +I EI TG    +
Sbjct: 291 GIGAMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSLILLVTIQYEINEIVTGLVGVV 350

Query: 334 LIFLSIYSSIKN 345
           LI  S +SS++ 
Sbjct: 351 LIGASFWSSVRR 362


>gi|289773769|ref|ZP_06533147.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289703968|gb|EFD71397.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 370

 Score =  219 bits (558), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 208/372 (55%), Gaps = 47/372 (12%)

Query: 10  LIHHFRWAILVTVAGFLCG-LGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           L+  FRWA  VT  G   G L  GW          + + I  IL+V+EISLSF+NA++NA
Sbjct: 2   LLKTFRWAFAVTALGLAAGVLYDGW----------TALGIVAILSVLEISLSFDNAVINA 51

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+KM++ WQ+ FLT GI+IAVFGMR++FP++IV + + ++P  A++LA+     Y ++
Sbjct: 52  GILKKMNAFWQRIFLTVGIVIAVFGMRLVFPVVIVAVSARLSPWSAVHLALTDKDRYQEL 111

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+ FGG FLMM+ L F F  ++ + W+ +LE  ++ L ++  + + I L ++ 
Sbjct: 112 VTDAHPSIAAFGGMFLMMIFLDFVFEERD-IKWLGWLERPLAKLGRVDMLSVCIALVVLL 170

Query: 189 GISNILPTN-EMYSFVSSSTAAIIIFYGINFL---------------------------- 219
             +     +   +    +  A  ++  G+  L                            
Sbjct: 171 VSATTFGAHAHQHGGTHADKAETVLLAGVAGLITYMVVGGLSGFFEQRLEDEEEREQEAE 230

Query: 220 -----ESVLSSDSSNNVT-HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
                ++  +    + V   GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL
Sbjct: 231 KRAEKDAERAGRPGSPVKLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGL 290

Query: 274 TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTI 333
            IGA+YVRS+T+ +++QG L+ Y YLEHG++Y+I  LS+I+ +    +I EI TG    +
Sbjct: 291 GIGAMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSLILLVTIQYEINEIVTGLVGVV 350

Query: 334 LIFLSIYSSIKN 345
           LI  S +SS++ 
Sbjct: 351 LIGASFWSSVRR 362


>gi|239503872|ref|ZP_04663182.1| hypothetical protein AbauAB_16296 [Acinetobacter baumannii AB900]
 gi|260557949|ref|ZP_05830162.1| major facilitator family transporter [Acinetobacter baumannii ATCC
           19606]
 gi|260408740|gb|EEX02045.1| major facilitator family transporter [Acinetobacter baumannii ATCC
           19606]
          Length = 360

 Score =  219 bits (558), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 133/354 (37%), Positives = 210/354 (59%), Gaps = 23/354 (6%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           + HFR++I  TV   +C  L   W FTH     +ST+     I  ILAV+E+SLSF+NA+
Sbjct: 1   MKHFRFSIFFTV---VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y
Sbjct: 58  VNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKMALNDPKTY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L 
Sbjct: 118 SERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALI 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-----SDSSNNVTHG------ 234
            +  ++  +  ++  +   +    I+++ G+  L  +L       ++ N V         
Sbjct: 178 ALIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAAS 237

Query: 235 ---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
              K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G
Sbjct: 238 GVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKG 297

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
            L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+
Sbjct: 298 TLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQ 351


>gi|169634711|ref|YP_001708447.1| hypothetical protein ABSDF3394 [Acinetobacter baumannii SDF]
 gi|169153503|emb|CAP02662.1| putative integral membrane protein [Acinetobacter baumannii]
          Length = 360

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 209/354 (59%), Gaps = 23/354 (6%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           + HFR++I  TV   +C  L   W FTH     +ST+     I  ILAV+E+SLSF+NA+
Sbjct: 1   MKHFRFSIFFTV---VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GILIAVFGMR++FP++IV + + +  IE   LA+  P+ Y
Sbjct: 58  VNASVLRNWDPFWKMIFLTVGILIAVFGMRLVFPVVIVAVTADMGVIEVAKLALNDPKTY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +FI L 
Sbjct: 118 SERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFIALI 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-----SDSSNNVTHG------ 234
            +  ++  +      + V +    I+++ G+  L  +L       ++ N V         
Sbjct: 178 ALIVMAAYVDEVHRLAVVMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAAS 237

Query: 235 ---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
              K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G
Sbjct: 238 GVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKG 297

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
            L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+
Sbjct: 298 TLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQ 351


>gi|169794396|ref|YP_001712189.1| hypothetical protein ABAYE0201 [Acinetobacter baumannii AYE]
 gi|215481951|ref|YP_002324133.1| hypothetical protein ABBFA_000192 [Acinetobacter baumannii
           AB307-0294]
 gi|294838231|ref|ZP_06782914.1| hypothetical protein A60131_09868 [Acinetobacter sp. 6013113]
 gi|294860311|ref|ZP_06798080.1| hypothetical protein A6013_17096 [Acinetobacter sp. 6013150]
 gi|301345191|ref|ZP_07225932.1| hypothetical protein AbauAB0_03084 [Acinetobacter baumannii AB056]
 gi|301510682|ref|ZP_07235919.1| hypothetical protein AbauAB05_03864 [Acinetobacter baumannii AB058]
 gi|301595810|ref|ZP_07240818.1| hypothetical protein AbauAB059_08357 [Acinetobacter baumannii
           AB059]
 gi|169147323|emb|CAM85184.1| putative integral membrane protein [Acinetobacter baumannii AYE]
 gi|213987743|gb|ACJ58042.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
 gi|322509715|gb|ADX05169.1| Putative integral membrane protein [Acinetobacter baumannii 1656-2]
          Length = 360

 Score =  219 bits (557), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 132/354 (37%), Positives = 210/354 (59%), Gaps = 23/354 (6%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           + HFR++I  TV   +C  L   W FTH     +ST+     I  ILAV+E+SLSF+NA+
Sbjct: 1   MKHFRFSIFFTV---VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  +E   +A+  P+ Y
Sbjct: 58  VNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVVEVAKMALNDPKTY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L 
Sbjct: 118 SERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALI 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-----SDSSNNVTHG------ 234
            +  ++  +  ++  +   +    I+++ G+  L  +L       ++ N V         
Sbjct: 178 ALIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAAS 237

Query: 235 ---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
              K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G
Sbjct: 238 GVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKG 297

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
            L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+
Sbjct: 298 TLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQ 351


>gi|148651893|ref|YP_001278986.1| hypothetical protein PsycPRwf_0076 [Psychrobacter sp. PRwf-1]
 gi|148570977|gb|ABQ93036.1| protein of unknown function DUF475 [Psychrobacter sp. PRwf-1]
          Length = 362

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 127/335 (37%), Positives = 205/335 (61%), Gaps = 22/335 (6%)

Query: 33  WQFTHT-LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAV 91
           W ++H  + G IS + I  ILAV+EISLSF+NA++NA  L+     W+  FLT GILIAV
Sbjct: 21  WGYSHGGMGGLISALSITAILAVMEISLSFDNAVVNASVLKHWDKFWKMIFLTVGILIAV 80

Query: 92  FGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTF 151
           FGMR++FPI+IV + + +  ++ +NLA+Y+P +Y   +   H  IS FGG FL++V L F
Sbjct: 81  FGMRLVFPIVIVAVTADMGMMDVINLALYNPTEYSAKLMAHHAEISAFGGMFLLLVFLNF 140

Query: 152 FFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAII 211
            F+ ++ +HW  +LE  ++   ++  + +F+ L+I+    + +   +  + + +    I+
Sbjct: 141 LFDDKD-VHWFDWLERRLAKFGEVDAMSVFVALAILMISLSWVHEEQTLAVLIAGVWGIL 199

Query: 212 IFYGINFLESVL------------------SSDSSNNVTHG--KHGLNLFLYLEIIDASL 251
           ++ G+  +  +L                  SS+ S NV     K G+  FLYLE++DAS 
Sbjct: 200 VYLGVQVVSGMLEGDLEEAEEALEDGTVANSSNGSGNVGSAVMKGGIAGFLYLEVLDASF 259

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FAIT +  II++GL IGA++VRSMT+ ++++G L+++ YLEHG++Y+I  L+
Sbjct: 260 SFDGVIGAFAITNDVIIIMLGLAIGAMFVRSMTIFLVEKGTLDEFVYLEHGAHYAIGALA 319

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VIM L     +PEI TG      I  ++ +SI+ K
Sbjct: 320 VIMLLSMKFHVPEIVTGLIGIAFIAWAVVASIRFK 354


>gi|256789886|ref|ZP_05528317.1| hypothetical protein SlivT_35853 [Streptomyces lividans TK24]
          Length = 368

 Score =  218 bits (556), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 127/368 (34%), Positives = 206/368 (55%), Gaps = 47/368 (12%)

Query: 14  FRWAILVTVAGFLCG-LGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQ 72
           FRWA  VT  G   G L  GW          + + I  IL+V+EISLSF+NA++NA  L+
Sbjct: 4   FRWAFAVTALGLAAGVLYDGW----------TALGIVAILSVLEISLSFDNAVINAGILK 53

Query: 73  KMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQA 132
           KM++ WQ+ FLT GI+IAVFGMR++FP++IV + + ++P  A++LA+     Y ++++ A
Sbjct: 54  KMNAFWQRIFLTVGIVIAVFGMRLVFPVVIVAVSARLSPWSAVHLALTDKDRYQELVTDA 113

Query: 133 HVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISN 192
           H  I+ FGG FLMM+ L F F  ++ + W+ +LE  ++ L ++  + + I L ++   + 
Sbjct: 114 HPSIAAFGGMFLMMIFLDFVFEERD-IKWLGWLERPLAKLGRVDMLSVCIALVVLLVSAT 172

Query: 193 ILPTN-EMYSFVSSSTAAIIIFYGINFL-------------------------------- 219
               +   +    +  A  ++  G+  L                                
Sbjct: 173 TFGAHAHQHGGTHADKAETVLLAGVAGLITYMVVGGLSGFFEQRLEDEEEREQEAEKRAE 232

Query: 220 -ESVLSSDSSNNVT-HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGA 277
            ++  +    + V   GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA
Sbjct: 233 KDAERAGRPGSPVKLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGA 292

Query: 278 IYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFL 337
           +YVRS+T+ +++QG L+ Y YLEHG++Y+I  LS+I+ +    +I EI TG    +LI  
Sbjct: 293 MYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSLILLVTIQYEINEIVTGLVGVVLIGA 352

Query: 338 SIYSSIKN 345
           S +SS++ 
Sbjct: 353 SFWSSVRR 360


>gi|239979237|ref|ZP_04701761.1| hypothetical protein SalbJ_07364 [Streptomyces albus J1074]
 gi|291451115|ref|ZP_06590505.1| integral membrane protein [Streptomyces albus J1074]
 gi|291354064|gb|EFE80966.1| integral membrane protein [Streptomyces albus J1074]
          Length = 380

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 127/354 (35%), Positives = 205/354 (57%), Gaps = 42/354 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V         +  IL+++EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVLYGGWAGFGVVAILSILEISLSFDNAVVNAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T GILIAVFGMR++FP++IV I + I PIEA++LA+     Y ++++ AH  I+ FGG F
Sbjct: 67  TIGILIAVFGMRLVFPVVIVAISAKIGPIEAVDLAMTDKDHYQELVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSF- 202
           L+M+ L F F  + ++ W+ ++E  ++ L ++  + + I L I+  IS +   ++ +   
Sbjct: 127 LLMIFLNFLFEDR-EIKWLTWIERPLAKLGRVDMLSVCIAL-IVLLISAMTFGSQAHQHG 184

Query: 203 -VSSSTAAIIIFYGI-------------NFLESVL-------------SSDSSNNVT--- 232
              +  A  ++  GI             +F E  L             +      V+   
Sbjct: 185 GTHADKAETVLLAGIAGLITYLIVGGLSSFFEDKLEEGEEREHEAEEEAKRQGKPVSAVK 244

Query: 233 -HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
             GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ ++++G
Sbjct: 245 LAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVREG 304

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            L+ Y YLEHG++Y+I  L+ I+ +     I E+ TG    +LI +S +SS++ 
Sbjct: 305 TLDDYVYLEHGAHYAIGALAAILLVTIRFQISEMITGLIGVVLIGVSFWSSVRR 358


>gi|294841470|ref|ZP_06786153.1| hypothetical protein A6014_06386 [Acinetobacter sp. 6014059]
          Length = 360

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 134/354 (37%), Positives = 209/354 (59%), Gaps = 23/354 (6%)

Query: 11  IHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           + HFR++I  TV   +C  L   W FTH     +ST+     I  ILAV+E+SLSF+NA+
Sbjct: 1   MKHFRFSIFFTV---VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAV 57

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y
Sbjct: 58  VNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKMALNDPKTY 117

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L 
Sbjct: 118 SERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALI 177

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-----SDSSNNVTHG------ 234
            +  ++  +      + V +    I+++ G+  L  +L       ++ N V         
Sbjct: 178 ALIVMAAYVDEVHRLAVVMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAAS 237

Query: 235 ---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
              K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G
Sbjct: 238 GVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKG 297

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
            L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+
Sbjct: 298 TLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQ 351


>gi|302562519|ref|ZP_07314861.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302480137|gb|EFL43230.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 366

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 127/368 (34%), Positives = 202/368 (54%), Gaps = 42/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCG-LGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           L+  FRWA  VT  G + G L  GW          + + +  ILAV+E+SLSF+NA++NA
Sbjct: 2   LLKTFRWAFAVTALGLVAGVLYDGW----------TALGLVAILAVLEVSLSFDNAVINA 51

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+++++ WQ+ FLT GILIAVFGMR++FPI+IV + + + P +A++LA+     Y ++
Sbjct: 52  GILKRLNAFWQRMFLTIGILIAVFGMRLLFPIVIVTVSARLAPSQAVHLALTDKDRYQQL 111

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+ FGG FL+M+ L F F  +    W+  LE  ++ L +I  + + + L ++ 
Sbjct: 112 VTDAHPAIAAFGGMFLLMIFLDFIFEDRET-KWLGPLERPLARLGRIDMLSVCLALCVLL 170

Query: 189 GISNILPTN-EMYSFVSSSTAAIIIFYGI-------------NFLESVLSS--------- 225
             S     +   +    +  A  ++  GI              F E  L+          
Sbjct: 171 VTSLTFAAHAHQHGGTHADKAQTVLVSGIAGLITYLVVGGLSGFFEGRLADEESRRQREE 230

Query: 226 -------DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     G+     FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 231 RSGGAGGGGSTLALSGRAAFFTFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 290

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L++I+ +     I ++ TG     LI  S
Sbjct: 291 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALALILLVSIQYQINDVVTGLIGVTLIGAS 350

Query: 339 IYSSIKNK 346
            YSS++  
Sbjct: 351 FYSSVRRN 358


>gi|294812440|ref|ZP_06771083.1| Putative integral membrane protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294325039|gb|EFG06682.1| Putative integral membrane protein [Streptomyces clavuligerus ATCC
           27064]
          Length = 383

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 202/353 (57%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V         +  IL+V+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 9   GWSFAVTALGLVAAVLYGGWTAFGVVAILSVLEISLSFDNAVVNAGILKKMNAFWQKIFL 68

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T GILIAVFGMR++FP++IV + + +  IEA++LA+     Y ++++ AH  I+ FGG F
Sbjct: 69  TIGILIAVFGMRLVFPVVIVAVSANLGLIEAVDLALNDKDKYQQLVTDAHPSIAAFGGMF 128

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           L+M+ L F F  + ++ W+ +LE  ++ L K+  + + I L I+   S     N   +  
Sbjct: 129 LLMIFLDFVFEDR-EIKWLGWLERPLAKLGKVDMLSVCIALVILLISSMTFAKNAHQHGG 187

Query: 203 VSSSTAAIIIFYGINFLESVL--------------------------SSDSSNNVTH--- 233
             +  A  ++  G+  L + L                          +  S   V+    
Sbjct: 188 GHADKAETVLLSGVAGLITYLIVGGLSGFFEGRLEAEEEREHEAEENARRSGKKVSAVAI 247

Query: 234 -GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 248 GGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGT 307

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L++Y YLEHG++Y+I  LS+I+ +    +I E+ TG     LI  S +SS++ 
Sbjct: 308 LDEYVYLEHGAHYAIGALSIILLITIQYEIHELITGFIGVALIGWSFWSSVRR 360


>gi|254389103|ref|ZP_05004333.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|326440736|ref|ZP_08215470.1| hypothetical protein SclaA2_06698 [Streptomyces clavuligerus ATCC
           27064]
 gi|197702820|gb|EDY48632.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
          Length = 381

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 202/353 (57%), Gaps = 40/353 (11%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ V         +  IL+V+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAVLYGGWTAFGVVAILSVLEISLSFDNAVVNAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T GILIAVFGMR++FP++IV + + +  IEA++LA+     Y ++++ AH  I+ FGG F
Sbjct: 67  TIGILIAVFGMRLVFPVVIVAVSANLGLIEAVDLALNDKDKYQQLVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSF 202
           L+M+ L F F  + ++ W+ +LE  ++ L K+  + + I L I+   S     N   +  
Sbjct: 127 LLMIFLDFVFEDR-EIKWLGWLERPLAKLGKVDMLSVCIALVILLISSMTFAKNAHQHGG 185

Query: 203 VSSSTAAIIIFYGINFLESVL--------------------------SSDSSNNVTH--- 233
             +  A  ++  G+  L + L                          +  S   V+    
Sbjct: 186 GHADKAETVLLSGVAGLITYLIVGGLSGFFEGRLEAEEEREHEAEENARRSGKKVSAVAI 245

Query: 234 -GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG 
Sbjct: 246 GGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGT 305

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L++Y YLEHG++Y+I  LS+I+ +    +I E+ TG     LI  S +SS++ 
Sbjct: 306 LDEYVYLEHGAHYAIGALSIILLITIQYEIHELITGFIGVALIGWSFWSSVRR 358


>gi|86742357|ref|YP_482757.1| hypothetical protein Francci3_3676 [Frankia sp. CcI3]
 gi|86569219|gb|ABD13028.1| protein of unknown function DUF475 [Frankia sp. CcI3]
          Length = 390

 Score =  216 bits (549), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 128/362 (35%), Positives = 199/362 (54%), Gaps = 38/362 (10%)

Query: 14  FRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQK 73
           F W++ +TV        IG      + G  +   + I LAV+EISLSF+NA++NA  L +
Sbjct: 7   FGWSLAITV--------IGVAAAGVIGGPRNAALVAI-LAVLEISLSFDNAVINATILGR 57

Query: 74  MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAH 133
           MS  WQ+ FLT GILIAVFGMR+IFPI IV + + + P+E  +LA+     Y + +  AH
Sbjct: 58  MSQFWQRIFLTLGILIAVFGMRLIFPIAIVALTAHLGPLEVFDLALNDGARYAEKLGDAH 117

Query: 134 VPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNI 193
             I+ FGG FL M+ L F F+ + ++ WI  LE  +    ++  + I + L  +  +   
Sbjct: 118 PAIAAFGGIFLFMLFLDFLFDPEREIQWIKKLEEPLRRAGQLDVVPIVLGLIALLVVGQA 177

Query: 194 LPTNEMYSFVSSSTAAIIIFYGINFL------ESVLSSDSSNN----------------- 230
              +     + S  A +  + G+  L        V + D  ++                 
Sbjct: 178 FAGDHQQQVLLSGVAGLATYLGVRGLGEFFEARGVGAEDDDDDSVAESAGLAPVRSNGTG 237

Query: 231 ------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMT 284
                 +  GK    LFLYLE+IDAS S DGV+ +FAI++N F+I  GL IGA+Y+RS+T
Sbjct: 238 GPPKLVLATGKAAAFLFLYLEVIDASFSFDGVVGAFAISQNIFVIAAGLGIGAMYIRSLT 297

Query: 285 LLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           + ++++G L +Y YLEHG++Y+I  L++I+ +    ++PEI TG      I LS+ SSI+
Sbjct: 298 VYLVRRGTLGEYIYLEHGAHYAIGALAIILAISIETEVPEIVTGLIGVAFIGLSLLSSIR 357

Query: 345 NK 346
           ++
Sbjct: 358 HR 359


>gi|262370905|ref|ZP_06064229.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262314267|gb|EEY95310.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 359

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 128/357 (35%), Positives = 209/357 (58%), Gaps = 23/357 (6%)

Query: 10  LIHHFRWAILVTVAGFLC-GLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENA 64
           ++ HF ++I+ T+   +C  L   W FTH     + T++    I  ILAV+E+SLSF+NA
Sbjct: 1   MMKHFGFSIIFTI---VCLALSAYWGFTHGPEAGLKTMFTALTITAILAVMEVSLSFDNA 57

Query: 65  ILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD 124
           ++NA  L+     W+  FLT GIL+AVFGMR+IFP+ IV + + +  +E + LA+  P+ 
Sbjct: 58  VVNASVLRGWDHFWKTLFLTVGILVAVFGMRLIFPVAIVAVTADMGFVEVVQLALNDPKT 117

Query: 125 YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL 184
           Y + +   H  I+ FGG FL++V L FF + +   HW  +LE  +++L+ +  + +F+ L
Sbjct: 118 YSQRLMDHHPEIAAFGGAFLLLVFLNFFLDEEKDTHWFRWLERRLANLANVPAMSVFLAL 177

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-----SDSSNNVTHG----- 234
             +  ++  +   +      +    I+++ G+  L  +L       +  N VTH      
Sbjct: 178 IALLVMAANVDEAKRLVVTMAGIWGIVVYIGVQVLSHLLGGEPEVDEDGNAVTHDANGAT 237

Query: 235 ----KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQ 290
               K G+  FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ ++++
Sbjct: 238 TGVVKAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEK 297

Query: 291 GILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           G L+ Y +LEHG++Y+I  L+ IM    T + +PE+ TG      I  ++ +SI+ K
Sbjct: 298 GTLDAYVFLEHGAHYAIGALAFIMLASGTGLHVPEVVTGLIGVAFIVWAVIASIQYK 354


>gi|261886382|ref|ZP_06010421.1| hypothetical protein CfetvA_15863 [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 325

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 192/313 (61%), Gaps = 21/313 (6%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G    VYIC +L ++E+SLSF+NA++NAK L  M+  WQ RF+ +GI IAVFGMR +FPI
Sbjct: 22  GGFLAVYICFLLGILEVSLSFDNAVVNAKILSGMNKKWQDRFIIFGIPIAVFGMRFLFPI 81

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV + + +   E  +LA+  P  Y   +S     I  FGG FL+MV L+FFF  ++ + 
Sbjct: 82  LIVSVAANLGMWETFSLALNDPDAYHNALSANKNQIYIFGGAFLLMVFLSFFFEEKD-VK 140

Query: 161 WIHFLEIA-MSH-LSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINF 218
           WI F+E   + H LSK   I +FI           + T  +  F++ +T+  + ++G   
Sbjct: 141 WIRFIEDNYLVHILSKTNSIALFIA----------ILTGMIIVFLTQNTSYALSYFGAVL 190

Query: 219 LESVLS--SD--SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT 274
           L   LS   D  S+N V  G  G   FLYLE++DAS S DGVI +FA+++N FII+IGL 
Sbjct: 191 LHMALSLFDDIFSANGVKSGFMG---FLYLEVLDASFSFDGVIGAFAMSENIFIIMIGLG 247

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA++VRS+T+ M+ +  L  + YLEHG++Y+I  L++IMF+    ++ E  TGT    L
Sbjct: 248 IGAMFVRSLTIYMVHKKTLESFIYLEHGAHYAILALAIIMFINVFHEVGEAITGTIGFGL 307

Query: 335 IFLSIYSSI-KNK 346
           I ++  SSI KNK
Sbjct: 308 IVIAFLSSIYKNK 320


>gi|293610616|ref|ZP_06692916.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826960|gb|EFF85325.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 349

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 127/331 (38%), Positives = 196/331 (59%), Gaps = 19/331 (5%)

Query: 33  WQFTHTLSGTISTVY----ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGIL 88
           W FTH     +ST+     I  ILAV+E+SLSF+NA++NA  L+     W+  FLT GIL
Sbjct: 10  WGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKMLFLTVGIL 69

Query: 89  IAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVS 148
           IAVFGMR+IFP+ IV + + +  IE   LA+  P+ Y + +   H  IS FGGTFL++V 
Sbjct: 70  IAVFGMRLIFPVAIVAVTADMGMIEVAKLALNDPKTYSERLMAHHAEISAFGGTFLLLVF 129

Query: 149 LTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTA 208
           L FFF+ + + HW  +LE  +S L+ +  + +FI L  +  ++  +  ++      +   
Sbjct: 130 LNFFFDEEKETHWFRWLEAKLSSLASVPAMSVFIALIAMLIMAANVDESQRLVVTMAGIW 189

Query: 209 AIIIFYGINFL------ESVLSSDSSNNVTHG--------KHGLNLFLYLEIIDASLSLD 254
            I+++ G+  L      E  +  D +  +  G        K G+  FLYLE++DAS S D
Sbjct: 190 GIVVYIGVEVLSHMLGGEPEIDEDGNAIMKDGSGAASGVVKAGIGGFLYLEVLDASFSFD 249

Query: 255 GVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIM 314
           GVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+I  L+ IM
Sbjct: 250 GVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIM 309

Query: 315 FLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
               T V +PE+ TG      I  ++ +SI+
Sbjct: 310 IASGTGVHVPEVVTGLIGVAFIVWAVIASIQ 340


>gi|184159802|ref|YP_001848141.1| hypothetical protein ACICU_03485 [Acinetobacter baumannii ACICU]
 gi|183211396|gb|ACC58794.1| uncharacterized protein conserved in bacteria [Acinetobacter
           baumannii ACICU]
          Length = 349

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 124/331 (37%), Positives = 198/331 (59%), Gaps = 19/331 (5%)

Query: 33  WQFTHTLSGTISTVY----ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGIL 88
           W FTH     +ST+     I  ILAV+E+SLSF+NA++NA  L+     W+  FLT GIL
Sbjct: 10  WGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKMIFLTVGIL 69

Query: 89  IAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVS 148
           IAVFGMR+IFP++IV + + +  +E   +A+  P+ Y + +   H  IS FGGTFL++V 
Sbjct: 70  IAVFGMRLIFPVVIVAVTADMGVVEVAKMALNDPKTYSERLMAHHAEISAFGGTFLLLVF 129

Query: 149 LTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTA 208
           L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  +  ++  +  ++  +   +   
Sbjct: 130 LNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIALIVMAGYVDDHQRLAVTMAGIW 189

Query: 209 AIIIFYGINFLESVLS-----SDSSNNVTHG---------KHGLNLFLYLEIIDASLSLD 254
            I+++ G+  L  +L       ++ N V            K GL  FLYLE++DAS S D
Sbjct: 190 GIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASGVVKAGLGGFLYLEVLDASFSFD 249

Query: 255 GVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIM 314
           GVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+I  L+ IM
Sbjct: 250 GVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIM 309

Query: 315 FLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
               T V +PE+ TG      I  ++ +SI+
Sbjct: 310 IASGTGVHVPEVVTGLIGVAFIVWAVIASIQ 340


>gi|21224631|ref|NP_630410.1| hypothetical protein SCO6313 [Streptomyces coelicolor A3(2)]
 gi|13872777|emb|CAC37534.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 363

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 122/329 (37%), Positives = 190/329 (57%), Gaps = 34/329 (10%)

Query: 48  ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVS 107
           I  IL+V+EISLSF+NA++NA  L+KM++ WQK FLT GILIAVFGMR++FP++IV I  
Sbjct: 16  IVAILSVMEISLSFDNAVVNAGILKKMNAFWQKIFLTVGILIAVFGMRLVFPVVIVAI-- 73

Query: 108 TINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEI 167
           ++ PIEA++LA+     Y ++++ AH  I+ FGG FL+M+ L F F  +  + W+ +LE 
Sbjct: 74  SLGPIEAVDLALTDKDRYQELVTDAHPSIAAFGGMFLLMIFLDFVFEDRG-IKWLAWLER 132

Query: 168 AMSHLSKIKGIKIFIVLSIIFGISNILPTN-EMYSFVSSSTAAIIIFYGI---------- 216
            ++ L ++  + + I L ++   +     +   +    +  A  ++  GI          
Sbjct: 133 PLAKLGRVDMLSVCIALVVLLVSATTFGAHAHQHGGAHADKAETVLLAGIAGLITYMIVG 192

Query: 217 ---NFLESVL-----------------SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGV 256
               + E  L                     S     GK    +FLYLE++DAS S DGV
Sbjct: 193 GLSGYFEDKLEEEEEREHEEEEEAARTGKPKSAVRLAGKAAFFMFLYLEVLDASFSFDGV 252

Query: 257 ISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFL 316
           I +FAIT +  ++ +GL IGA+YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +
Sbjct: 253 IGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLV 312

Query: 317 QTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
               +I EI TG     LI  S +SS++ 
Sbjct: 313 TIQYEIHEIITGLVGVALIGWSFFSSVRR 341


>gi|312194852|ref|YP_004014913.1| hypothetical protein FraEuI1c_0970 [Frankia sp. EuI1c]
 gi|311226188|gb|ADP79043.1| protein of unknown function DUF475 [Frankia sp. EuI1c]
          Length = 373

 Score =  213 bits (542), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 181/311 (58%), Gaps = 20/311 (6%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           EISLSF+NA++NA  L +MS+ WQ+ FLT G+LIAVFGMR+IFPI++V + + ++P +  
Sbjct: 40  EISLSFDNAVINATILGRMSAAWQRIFLTVGVLIAVFGMRLIFPIVVVALTAHLSPYDVF 99

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
           +LA+     Y   +  AH  I+ FGG FL M+ L F F+++  + W+ +LE  +     +
Sbjct: 100 DLAVNHSDQYADKLHAAHPAIAAFGGIFLFMIFLDFMFDNERDVQWLRWLEEPLRKAGAL 159

Query: 176 KGIKIF--------------------IVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYG 215
             I +                     + ++ + G++  L  + +  F  S         G
Sbjct: 160 DVIPVVLGLVALLVVGEWFSGGHTEQVFVAGVAGLATYLAVSGLGEFFESRGLGAEEDDG 219

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
                +     SS  +  GK    LFLYLE++DAS S DGV+ +FAI++N FII  GL I
Sbjct: 220 DEPATAGTGGASSTALATGKAAFFLFLYLEVLDASFSFDGVVGAFAISQNIFIIAAGLGI 279

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA+Y+RS+T+ +++QG L++Y +LEHG++Y+I  L+VI+ +    D+PEI TG      I
Sbjct: 280 GAMYIRSLTVFLVRQGTLSEYVFLEHGAHYAIGALAVILAVSIENDVPEIVTGLIGVAFI 339

Query: 336 FLSIYSSIKNK 346
            L++ +SI+++
Sbjct: 340 GLALLTSIRHR 350


>gi|309811360|ref|ZP_07705147.1| putative membrane protein [Dermacoccus sp. Ellin185]
 gi|308434667|gb|EFP58512.1| putative membrane protein [Dermacoccus sp. Ellin185]
          Length = 379

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 127/374 (33%), Positives = 205/374 (54%), Gaps = 47/374 (12%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +T+AG + G          L G  S + I  IL V+E+SLSF+NA++NA 
Sbjct: 2   LLKTFGWSAAITIAGLVGGF---------LIGGPSGLAIVAILIVLEVSLSFDNAVVNAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQD 124
            L++M++ WQK FLT GILIAVFGMR++FP++IVC+   + P+EA++LAI      +P  
Sbjct: 53  ILKRMNAFWQKIFLTVGILIAVFGMRLVFPLLIVCLTGHVGPMEAIDLAIKGGDQETPGT 112

Query: 125 YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIF--- 181
           Y  ++  AH  I+ FGG FL+M+ L F F  ++ L W+  +E  ++ + K+  + +    
Sbjct: 113 YAHMLHDAHPSIAAFGGMFLLMLFLDFVFEKRD-LQWLRPIERPLAKIGKLDQLSVVVAL 171

Query: 182 ----------------IVLSIIFGISNILPTNEMYSFVSSSTAAIIIFY----------G 215
                           ++ S I G+   L    +     S                    
Sbjct: 172 LVLAVVSQTLAKEPGTVLFSGILGLMTYLLVGGLGDLFESQGEDDDDAAAGDDDAERSVA 231

Query: 216 INFLESVLSSDSSNNV--THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
               ++   + +S  V  T GK    LF+YLE++DAS S DGVI +FAI+++ FII +GL
Sbjct: 232 TKAGDTAAQAPASKGVGTTAGKAAFFLFMYLEVLDASFSFDGVIGAFAISQDIFIIALGL 291

Query: 274 TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTI 333
            +GA+++RS+T+ +++QG L+ Y YLEHG+ ++I  L+ I+ +    ++PE+ TG     
Sbjct: 292 GVGAMWIRSLTVYLVRQGTLDDYAYLEHGAMWAIGALAAILLISIKHEVPEVVTGLIGVG 351

Query: 334 LIFLSIYSS-IKNK 346
            I  +  SS ++NK
Sbjct: 352 FIGAAYLSSLVRNK 365


>gi|323519729|gb|ADX94110.1| hypothetical protein ABTW07_3693 [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 349

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 126/331 (38%), Positives = 197/331 (59%), Gaps = 19/331 (5%)

Query: 33  WQFTHTLSGTISTVY----ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGIL 88
           W FTH     +ST+     I  ILAV+E+SLSF+NA++NA  L+     W+  FLT GIL
Sbjct: 10  WGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKMIFLTVGIL 69

Query: 89  IAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVS 148
           IAVFGMR+IFP++IV + + +  IE   +A+  P+ Y + +   H  IS FGGTFL++V 
Sbjct: 70  IAVFGMRLIFPVVIVAVTADMGVIEVAKMALNDPKTYSERLMAHHAEISAFGGTFLLLVF 129

Query: 149 LTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTA 208
           L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  +  ++  +      + V +   
Sbjct: 130 LNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIALIVMAAYVDEVHRLAVVMAGIW 189

Query: 209 AIIIFYGINFLESVLS-----SDSSNNVTHG---------KHGLNLFLYLEIIDASLSLD 254
            I+++ G+  L  +L       ++ N V            K GL  FLYLE++DAS S D
Sbjct: 190 GIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASGVVKAGLGGFLYLEVLDASFSFD 249

Query: 255 GVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIM 314
           GVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+I  L+ IM
Sbjct: 250 GVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIM 309

Query: 315 FLQ-TIVDIPEIFTGTSSTILIFLSIYSSIK 344
               T V +PE+ TG      I  ++ +SI+
Sbjct: 310 IASGTGVHVPEVVTGLIGVAFIVWAVIASIQ 340


>gi|325294438|ref|YP_004280952.1| hypothetical protein Dester_0236 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064886|gb|ADY72893.1| protein of unknown function DUF475 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 329

 Score =  213 bits (541), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 189/294 (64%), Gaps = 5/294 (1%)

Query: 52  LAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINP 111
           L+++EISLSF+NA++NA  L  MS IW++RFLTWG++IAVFGMR +FP++IV + + I  
Sbjct: 36  LSLLEISLSFDNAVMNAVVLSGMSYIWRRRFLTWGMIIAVFGMRFLFPVLIVSLTAGIGI 95

Query: 112 IEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSH 171
            +   +A  +P++Y   +  A   I  FGG+FL+MV + + F++  +L+WI FLE   + 
Sbjct: 96  EKVTEMAFSNPEEYAHYLEIAEPLILSFGGSFLLMVFINWLFDAGKELYWIRFLEEKAAK 155

Query: 172 LSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV 231
           L+K+  IK+ + L+++F I   L  +   + + +    I++F  ++F++  +     N++
Sbjct: 156 LAKVGEIKLIVALTVVF-IVGFLKKDS--NILLAMILGILLFELVHFIKGAIEYFKRNSI 212

Query: 232 THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
           + G  GL  F+YLE++DAS SLDG + +FAI++N  II +GL++GA  +RS+T+  ++ G
Sbjct: 213 SSG--GLANFIYLELLDASCSLDGAVGAFAISQNLIIITLGLSVGAFILRSLTVYFVESG 270

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            L +  YLEHG+++ I  L ++M  Q    IPE    T + + I  S+Y+SI+ 
Sbjct: 271 KLRELPYLEHGAHWGIGGLGIMMLAQLFHHIPEPVISTVALVFILSSLYTSIRK 324


>gi|118475138|ref|YP_891227.1| hypothetical protein CFF8240_0017 [Campylobacter fetus subsp. fetus
           82-40]
 gi|118414364|gb|ABK82784.1| integral membrane protein [Campylobacter fetus subsp. fetus 82-40]
          Length = 325

 Score =  212 bits (540), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 131/313 (41%), Positives = 192/313 (61%), Gaps = 21/313 (6%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G    VYIC +L ++E+SLSF+NA++NAK L  M+  WQ RF+ +GI IAVFGMR +FPI
Sbjct: 22  GGFLAVYICFLLGILEVSLSFDNAVVNAKILSGMNKKWQDRFIIFGIPIAVFGMRFLFPI 81

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV + + +   E  +LA+  P  Y   +S     I  FGG FL+MV L+FFF  ++ + 
Sbjct: 82  LIVSVAANLGMWETFSLALNDPDAYHNALSANKNQIYIFGGAFLLMVFLSFFFEEKD-VK 140

Query: 161 WIHFLEIA-MSH-LSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINF 218
           WI F+E   + H LSK   I +FI           + T  +  F++ +T+  + ++G   
Sbjct: 141 WIRFIEDNYLVHILSKTNSIALFIA----------ILTGMIIVFLTQNTSYALSYFGAVL 190

Query: 219 LESVLS--SD--SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT 274
           L   LS   D  S+N V  G  G   FL+LE++DAS S DGVI +FA+++N FII+IGL 
Sbjct: 191 LHMALSLFDDIFSANGVKSGFMG---FLHLEVLDASFSFDGVIGAFAMSENIFIIMIGLG 247

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA++VRS+T+ M+ +  L  + YLEHG++Y+I  L++IMF+    ++ E  TGT    L
Sbjct: 248 IGAMFVRSLTIYMVHKKTLESFIYLEHGAHYAILALAIIMFINVFHEVGEAITGTIGFGL 307

Query: 335 IFLSIYSSI-KNK 346
           I ++  SSI KNK
Sbjct: 308 IVIAFLSSIYKNK 320


>gi|91774403|ref|YP_544159.1| hypothetical protein Mfla_0047 [Methylobacillus flagellatus KT]
 gi|91708390|gb|ABE48318.1| protein of unknown function DUF475 [Methylobacillus flagellatus KT]
          Length = 348

 Score =  212 bits (540), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 130/342 (38%), Positives = 212/342 (61%), Gaps = 13/342 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGI----GWQFTHTLSGTISTVYICIILAVVEISLSFENAIL 66
           +  FR++  VT   FLC LG+    G+Q    L G    + + +IL ++E+SLSF+NA++
Sbjct: 1   MRDFRYSFFVT---FLC-LGLAALWGYQSKGGLVGIWPALSVALILGIMEVSLSFDNAVV 56

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L++M   W+  FLT GILIAVFG+R++FP+++V   +    ++  ++AI +P  Y 
Sbjct: 57  NASILKEMDEKWRHIFLTVGILIAVFGVRLLFPLLLVAAATDQGLLDVADMAINNPVLYA 116

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
             +   H  I+ FGG+FL +V L+F  + + +LHW+  LE A   L  ++ IKI ++L I
Sbjct: 117 DYLDDGHTAIAAFGGSFLFLVFLSFLLDPEKELHWLGRLEAAFGKLGSLESIKIILILLI 176

Query: 187 IFGISNILPTN--EMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV---THGKHGLNLF 241
           +  + N LP +  E  + + +  + ++++  I+ L    SS +  +    T  ++G   F
Sbjct: 177 LLSLQNFLPISQAERLTILLAGLSGVVLYVFIDSLSGFFSSQAEGDAFAKTAKRNGAMGF 236

Query: 242 LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEH 301
           LYLEI+DAS S DGVI +FAIT++  II++GLTIGA++VRSMT+ ++ +G L+ Y YLEH
Sbjct: 237 LYLEILDASFSFDGVIGAFAITRDVVIIMLGLTIGAMFVRSMTVRLVYKGTLDNYVYLEH 296

Query: 302 GSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           G++Y+I VL ++MF      +PE+ +G    + I  ++ SSI
Sbjct: 297 GAHYAIGVLGLVMFYTIYRPVPEVVSGLIGVVFIIAALLSSI 338


>gi|34498819|ref|NP_903034.1| hypothetical protein CV_3364 [Chromobacterium violaceum ATCC 12472]
 gi|34104671|gb|AAQ61028.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 370

 Score =  212 bits (539), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 105/297 (35%), Positives = 190/297 (63%), Gaps = 2/297 (0%)

Query: 51  ILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTIN 110
           +LAV+E S+SF+NA++NA  L+ MS  W++ F+T GI +AVFGMR++FP++IV     ++
Sbjct: 72  VLAVLETSVSFDNAVVNATVLKAMSHRWRQVFMTVGIAVAVFGMRVLFPLLIVSTAGGVS 131

Query: 111 PIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMS 170
             EA  +A   P+ Y +I+  +H+ I GFG TFL+MV + +F   +   HW+  +E  ++
Sbjct: 132 LAEAFAVATRQPERYQQIMHDSHLMIMGFGATFLLMVVIEYFVQHEKDEHWLPGIEPLLA 191

Query: 171 HLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN 230
            L  ++  +  + + ++  I+ +LP  +  +F+SS     ++F  ++  + +        
Sbjct: 192 KLGSVENAQSLVTILVVAAIAALLPAGQKMAFISSCFWGYVVFMVLHMFKQLFGGVDIQT 251

Query: 231 VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQ 290
               K+GL  F+YLE++DAS S+DGVI++FAIT +F++I  GL IGA++VRS+TL ++++
Sbjct: 252 AA-AKNGLIGFVYLEVLDASFSMDGVIAAFAITNDFWLIAAGLGIGAMFVRSLTLYLVER 310

Query: 291 GILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIKNK 346
            +++++KYLE  ++++I  L  IMF   + V++ E+ TG  S  +I L + +S+ ++
Sbjct: 311 DVMSQFKYLEVSAFWAIAALVAIMFAAALHVELGEVATGLISVAIIGLGVLTSLPSR 367


>gi|71901998|ref|ZP_00684045.1| Protein of unknown function DUF475 [Xylella fastidiosa Ann-1]
 gi|71728243|gb|EAO30427.1| Protein of unknown function DUF475 [Xylella fastidiosa Ann-1]
          Length = 311

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 198/308 (64%), Gaps = 6/308 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T   F   L   W ++  L G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFT--AFCLSLAAWWGYSTAL-GVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GILIAVFGMR++FPI+IV + + +  I  M LA+  P+ Y  ++
Sbjct: 58  ILKHMSEFWRKLFLTIGILIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSLVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   + + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAMAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIM 314
           I VL+VIM
Sbjct: 298 IGVLAVIM 305


>gi|229489797|ref|ZP_04383654.1| integral membrane protein [Rhodococcus erythropolis SK121]
 gi|229323307|gb|EEN89071.1| integral membrane protein [Rhodococcus erythropolis SK121]
          Length = 373

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/335 (37%), Positives = 202/335 (60%), Gaps = 31/335 (9%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G    +++ IIL+++EISLSF+NA++NA  LQ+MS  WQK FLT G++IAVFGMR++FP+
Sbjct: 24  GGPEALFLVIILSILEISLSFDNAVINATVLQRMSEFWQKIFLTIGVIIAVFGMRLVFPL 83

Query: 101 MIVCIVSTINPIEAMNLAIYSPQD-----------YLKIISQAHVPISGFGGTFLMMVSL 149
           +IV   S + P+ A++LA+  P D           Y  I++ AH  I+ FGG FL+M+ L
Sbjct: 84  VIVWAASGLGPVAALDLALNPPADDAAYFANGEPSYETILTDAHPQIAAFGGMFLLMLFL 143

Query: 150 TFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISN--ILPTNEMYSFVSSST 207
            F F  + ++ W+ +LE  ++ + K+  + + +V  I+  +S   +   +++ + + S  
Sbjct: 144 GFIFE-EREITWLSWLEKPLARIGKLDQLSV-VVAGIVLVLSGSFLAADDKVSTVMISGV 201

Query: 208 AAIIIFYGINFLESVLS---------SDSSNNVTH-----GKHGLNLFLYLEIIDASLSL 253
             +I +  +N L  + +         +  S   T      GK G  LFLYLE++DAS S 
Sbjct: 202 LGMITYIAVNGLGELFNLPEEGEEEETAKSGGPTQLAKATGKAGFFLFLYLEVLDASFSF 261

Query: 254 DGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSV 312
           DGVI +FAIT +  II +GL  +GA++VRS+T+ ++++G L+ Y YLEHG++++I  L+V
Sbjct: 262 DGVIGAFAITADPIIIALGLGFVGAMFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALAV 321

Query: 313 IMFLQTIVDIPEIFTGTSSTILIFLSIYSS-IKNK 346
           I+ +   V I EI TG     LI  +  SS I+NK
Sbjct: 322 ILMVSIGVHINEIITGLVGVFLIGAAFISSLIRNK 356


>gi|54027543|ref|YP_121785.1| hypothetical protein nfa55690 [Nocardia farcinica IFM 10152]
 gi|54019051|dbj|BAD60421.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 373

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 120/333 (36%), Positives = 198/333 (59%), Gaps = 26/333 (7%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           L G  + +++C IL ++E+SLSF+NA++NA  L++MS  WQK FLT GILIAVFGMR++F
Sbjct: 22  LYGGPTALFLCAILGILEVSLSFDNAVINATVLRRMSEFWQKIFLTIGILIAVFGMRLVF 81

Query: 99  PIMIVCIVSTINPIEAMNLAIYSP-----------QDYLKIISQAHVPISGFGGTFLMMV 147
           P+ IV + + +NP++A++LA+  P             Y  +++ AH  I+ FGG FL M+
Sbjct: 82  PLAIVWVTAGLNPVDALDLALNPPAGDAPYFPDGSPSYETLLTDAHPQIAAFGGMFLAML 141

Query: 148 SLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNIL-PTNEMYSFVSSS 206
            L F F  + ++ W+ +LE  ++   K+  + + +    +   +  L P ++  + + + 
Sbjct: 142 FLNFIFEDR-EITWLSWLERPLARAGKLDMLAVVVSGVGLVLTAEFLAPDDKRATVLMAG 200

Query: 207 TAAIIIFYGINFLESVL-----------SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDG 255
              +II+  ++ L S+            S  S      GK G  LFLYLE++DAS S DG
Sbjct: 201 LLGMIIYIAVDGLGSMFHTEELEEEAEKSGPSDLAKATGKAGFFLFLYLEVLDASFSFDG 260

Query: 256 VISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIM 314
           VI +FAIT +  +I +GL  IGA++VRS+T+ ++++G L++Y YLEHG++++I  L+ I+
Sbjct: 261 VIGAFAITSDPILIALGLGLIGAMFVRSITVYLVRKGTLSEYVYLEHGAHWAIGALAAIL 320

Query: 315 FLQTIVDIPEIFTGTSSTILIFLSIYSSI-KNK 346
            +   V I EI TG      I  +  SS+ +N+
Sbjct: 321 LVSIGVHINEIITGLVGVAFIGAAFISSVLRNR 353


>gi|226304083|ref|YP_002764041.1| hypothetical protein RER_05940 [Rhodococcus erythropolis PR4]
 gi|226183198|dbj|BAH31302.1| conserved hypothetical membrane protein [Rhodococcus erythropolis
           PR4]
          Length = 373

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 126/335 (37%), Positives = 202/335 (60%), Gaps = 31/335 (9%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G    +++ IIL+++EISLSF+NA++NA  L++MS  WQK FLT GI+IAVFGMR++FP+
Sbjct: 24  GGPEALFLVIILSILEISLSFDNAVINATVLRRMSDFWQKIFLTIGIVIAVFGMRLVFPL 83

Query: 101 MIVCIVSTINPIEAMNLAIYSPQD-----------YLKIISQAHVPISGFGGTFLMMVSL 149
           +IV   S + P+ A++LA+  P D           Y  I++ AH  I+ FGG FL+M+ L
Sbjct: 84  VIVWAASGLGPVAALDLALNPPADDAAYFANGEPSYETILTDAHPQIAAFGGMFLLMLFL 143

Query: 150 TFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISN--ILPTNEMYSFVSSST 207
            F F  + ++ W+ +LE  ++ + K+  + + +V  I+  +S   +   +++ + + S  
Sbjct: 144 GFIFE-EREITWLSWLEKPLARIGKLDQLSV-VVAGIVLVLSGSFLAADDKVSTVMISGV 201

Query: 208 AAIIIFYGINFLESVLS---------SDSSNNVTH-----GKHGLNLFLYLEIIDASLSL 253
             +I +  +N L  + +         +  S   T      GK G  LFLYLE++DAS S 
Sbjct: 202 LGMITYIAVNGLGELFNLPEEGEEEETTKSGGPTEFAKATGKAGFFLFLYLEVLDASFSF 261

Query: 254 DGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSV 312
           DGVI +FAIT +  II +GL  +GA++VRS+T+ ++++G L+ Y YLEHG++++I  L+V
Sbjct: 262 DGVIGAFAITADPIIIALGLGFVGAMFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALAV 321

Query: 313 IMFLQTIVDIPEIFTGTSSTILIFLSIYSS-IKNK 346
           I+ +   V I EI TG     LI  +  SS I+NK
Sbjct: 322 ILMVSIGVHINEIITGLVGVFLIGAAFISSLIRNK 356


>gi|269127400|ref|YP_003300770.1| hypothetical protein Tcur_3191 [Thermomonospora curvata DSM 43183]
 gi|268312358|gb|ACY98732.1| protein of unknown function DUF475 [Thermomonospora curvata DSM
           43183]
          Length = 383

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 115/313 (36%), Positives = 185/313 (59%), Gaps = 23/313 (7%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           EISLSF+NA++NAK L++MS+ WQK FLT GI IAVFGMR++FP++IV I + + PIEA 
Sbjct: 39  EISLSFDNAVVNAKVLERMSTFWQKIFLTIGIAIAVFGMRLLFPLLIVGITAQMTPIEAF 98

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
           +LA   P++Y   + +A+  I+ FGG FLMM+ L F F  +    W+ +LE  ++ + K+
Sbjct: 99  DLAFNDPKEYAHRMHEAYPTIAAFGGMFLMMLFLDFVFEERAD-KWLPWLERPLARIGKL 157

Query: 176 KGIKIF-------------------IVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGI 216
             + +                    ++++ + G+   +  N +    S            
Sbjct: 158 DQLSVVVAAGALALVAGLFAEDTGQVMIAGVLGMVTYILVNGLGELFSQGGEDDGDGEEE 217

Query: 217 NFLESVLSSDSSNN--VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT 274
             + +V  +   N   +  GK G  LFLYLE++DAS S DGVI +FAI+ +  +I++GL 
Sbjct: 218 VKVPAVKGTTGPNGLVLATGKAGFFLFLYLEVLDASFSFDGVIGAFAISTDPVVIMLGLG 277

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA+Y+RS+T+ ++++G L++Y YLEHG++++I  L+V M +   V +PE  TG     L
Sbjct: 278 IGAMYIRSLTVFLVRKGTLHEYVYLEHGAHWAIGALAVCMLISIAVHVPEAITGGLGAGL 337

Query: 335 IFLSIYSSI-KNK 346
           I  +  SS+ +N+
Sbjct: 338 IIAAFLSSVLRNR 350


>gi|116511931|ref|YP_809147.1| hypothetical protein LACR_1193 [Lactococcus lactis subsp. cremoris
           SK11]
 gi|116107585|gb|ABJ72725.1| hypothetical protein LACR_1193 [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 339

 Score =  208 bits (530), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 125/315 (39%), Positives = 194/315 (61%), Gaps = 15/315 (4%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G  + ++I +ILAV+EISLS +NAI+NA+ L++MS  WQK FLT G+LIAV GMR++FP+
Sbjct: 22  GGWNGLFITLILAVLEISLSMDNAIVNARILERMSPAWQKTFLTLGVLIAVVGMRLVFPL 81

Query: 101 MIVCIVSTINPIEAMNLAIY-----SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNS 155
           +IV + + I+PI A+ LA+      +   Y  I+  AH  I+ FGG FL+M++L FFF+ 
Sbjct: 82  LIVGVSAQIDPISALRLALEKGNPSTAGTYGYILHHAHPQIAAFGGMFLLMLALGFFFD- 140

Query: 156 QNKLH-WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFY 214
            ++ H W+   E  +  +         I + I+   S  +  +  ++ + +    I+ F 
Sbjct: 141 -DRAHTWLKLPEKFLQKIGHFPAANAIISIIILLITSEFIAKDS-HAVLFAGILGILTFM 198

Query: 215 GINFLESVLSSDSSNNVTH-----GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFII 269
            ++     +S   +   TH     GK GL LFLYLE+IDAS S DGVI +FAIT +  II
Sbjct: 199 LVDGFGETMSHSKAATSTHFVVATGKAGLALFLYLEVIDASFSFDGVIGAFAITADPIII 258

Query: 270 VIGL-TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTG 328
           ++GL  IGA++VRS+TL ++++G LN   YLEHG++++I  L+ ++ +    +I E+ TG
Sbjct: 259 LLGLGVIGAMFVRSLTLYLVQKGTLNDLVYLEHGAHWAILTLAFLILVSIKWEIGEVVTG 318

Query: 329 TSSTILIFLSIYSSI 343
            +  ILI LS  SS+
Sbjct: 319 LTGAILIILSFVSSV 333


>gi|111225246|ref|YP_716040.1| hypothetical protein FRAAL5896 [Frankia alni ACN14a]
 gi|111152778|emb|CAJ64521.1| putative integral membrane protein [Frankia alni ACN14a]
          Length = 371

 Score =  208 bits (530), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 119/338 (35%), Positives = 189/338 (55%), Gaps = 32/338 (9%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           GT     I  ILAV+EISLSF+NA++NA  L++MS  WQK FLT G++IAVFGMR++FPI
Sbjct: 3   GTPRDAAIVAILAVLEISLSFDNAVINATILRRMSPFWQKLFLTLGVVIAVFGMRLLFPI 62

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV + + + P++  +LA+     Y + +  AH  I+ FGG FL M+ L F F+ +  + 
Sbjct: 63  IIVALTAHLGPVKVFDLALNDSAQYAEKLGDAHPAIAAFGGIFLFMLFLDFLFDPERDVQ 122

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLE 220
           WI  LE  +    ++  I   + L  +  +      +     +++  A +  + G+  L 
Sbjct: 123 WIKKLEEPLRRAGQLDVIPTVVGLVALLVVGEAFSGDHTQQVLTAGVAGLATYLGVRGLG 182

Query: 221 SVLSS------------------DSSNNVTH--------------GKHGLNLFLYLEIID 248
               S                  D +   T               G+    LFLYLE+ID
Sbjct: 183 EFFESRGVGAEDDDAADSDGVAVDGAGKTTAAPRSSGQPKLVLATGRAAAFLFLYLEVID 242

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+ +FAI++N F+I  GL IGA+Y+RS+T+ ++++G L++Y YLEHG++Y+I 
Sbjct: 243 ASFSFDGVVGAFAISQNIFVIATGLGIGAMYIRSLTVYLVRRGTLSEYIYLEHGAHYAIG 302

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L++I+ +    ++PEI TG      I L++ SSI+++
Sbjct: 303 ALAIILAISIETEVPEIVTGLVGVAFIGLALVSSIRHR 340


>gi|319789385|ref|YP_004151018.1| protein of unknown function DUF475 [Thermovibrio ammonificans HB-1]
 gi|317113887|gb|ADU96377.1| protein of unknown function DUF475 [Thermovibrio ammonificans HB-1]
          Length = 332

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 118/327 (36%), Positives = 192/327 (58%), Gaps = 11/327 (3%)

Query: 22  VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR 81
           +A FL    + W       G I  V+    L+++EISLSF+NA++NA  L  MS +W++R
Sbjct: 7   LAEFLVIFAVSWVIEFAYMG-IKGVFEGTTLSLLEISLSFDNAVMNAVILAGMSQLWRRR 65

Query: 82  FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGG 141
           FLTWG++IAVFGMR +FP++IV + + +   + + LA   P+ Y   +  A   I  FGG
Sbjct: 66  FLTWGMVIAVFGMRFLFPVLIVAVTAGLPVTKVVELAFKEPEKYAHHLEHAEPLILAFGG 125

Query: 142 TFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYS 201
            FL+MV + + F++  +L WI  LE   S  +K+  +K+ I LS+IF +  +       +
Sbjct: 126 AFLLMVFINWLFDAGKELFWIRKLEEMASKAAKMGEVKLIIALSVIFTVGYL---KREPN 182

Query: 202 FVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEIIDASLSLDGVIS 258
            + +    I++F  ++F++  +         HG     GL  F+YLE++DAS SLDG + 
Sbjct: 183 IILALILGILLFEVVHFIKGAIEYFKE----HGGAVDAGLGSFIYLELLDASCSLDGTVG 238

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
           +FAI+KN  II +GL++GA  +R++TL  ++ G L +  YLEHG+++ I  L ++M L+ 
Sbjct: 239 AFAISKNLIIITVGLSVGAFILRTLTLYFVESGKLKELPYLEHGAHWGIGGLGIMMLLEL 298

Query: 319 IVDIPEIFTGTSSTILIFLSIYSSIKN 345
            + IPE    + + + I  S+YSS+K 
Sbjct: 299 FIHIPEPVISSVALLFILSSLYSSVKR 325


>gi|125624286|ref|YP_001032769.1| hypothetical protein llmg_1480 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|124493094|emb|CAL98058.1| putative membrane protein [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300071068|gb|ADJ60468.1| hypothetical protein LLNZ_07620 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 339

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 126/314 (40%), Positives = 196/314 (62%), Gaps = 13/314 (4%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G  + ++I +ILAV+EISLS +NAI+NA+ L++MS  WQK FLT G+LIAV GMR++FP+
Sbjct: 22  GGWNGLFITLILAVLEISLSMDNAIVNARILERMSPAWQKTFLTLGVLIAVVGMRLVFPL 81

Query: 101 MIVCIVSTINPIEAMNLAIY-----SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNS 155
           +IV + + I+PI A+ LA+      +   Y  I+  AH  I+ FGG FL+M++L FFF+ 
Sbjct: 82  LIVGVSAQIDPISALRLALEKGNPSTAGTYGYILHHAHPQIAAFGGMFLLMLALGFFFDE 141

Query: 156 QNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYG 215
           +    W+   E  +  +         I + I+   S  +   E ++ + +    I+ F  
Sbjct: 142 RAHT-WLKLPEKFLQKIGHFPAANAIISIIILLITSEFI-AKESHAVLFAGILGILTFML 199

Query: 216 IN-FLESVLSSDSSNN----VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIV 270
           ++ F E++  S ++ +    V  GK GL LFLYLE+IDAS S DGVI +FAIT +  II+
Sbjct: 200 VDGFGETMSHSKAATSTDFVVATGKAGLALFLYLEVIDASFSFDGVIGAFAITADPIIIL 259

Query: 271 IGL-TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGT 329
           +GL  IGA++VRS+TL ++++G LN   YLEHG++++I  L+ ++ +    +I E+ TG 
Sbjct: 260 LGLGVIGAMFVRSLTLYLVQKGTLNDLVYLEHGAHWAILTLAFLILVSIKWEIGEVVTGL 319

Query: 330 SSTILIFLSIYSSI 343
           +  ILI LS  SS+
Sbjct: 320 TGAILIILSFVSSV 333


>gi|296141865|ref|YP_003649108.1| hypothetical protein Tpau_4201 [Tsukamurella paurometabola DSM
           20162]
 gi|296029999|gb|ADG80769.1| protein of unknown function DUF475 [Tsukamurella paurometabola DSM
           20162]
          Length = 364

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 124/361 (34%), Positives = 204/361 (56%), Gaps = 35/361 (9%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F  +I+VT+A  +            L G    + +  IL V+EISLSF+NA++NA  
Sbjct: 3   LRTFGLSIVVTIAALIVAF---------LYGGPQALLLTAILGVLEISLSFDNAVINATV 53

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD----YL 126
           L++MS  WQK FLT GILIAV GMR++FP+ IV I + ++P+ AM LA+  P D    Y 
Sbjct: 54  LRRMSDFWQKMFLTVGILIAVVGMRLLFPLAIVWITAGLDPVHAMRLALNPPTDGSPTYE 113

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL-S 185
            +++ AH  I+ FGG FL+M+ L F   ++  + W+ ++E  +  + ++  + + I   +
Sbjct: 114 SLVTAAHPQIAAFGGIFLLMLFLDFVL-AEKDVTWLSWIEKPLEKIGRLDQLSVVIASGA 172

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH------------ 233
           +++    I    E  + + +    ++ +  +N L  +   D    +              
Sbjct: 173 LLYTAMYIAHPGEETTVLVAGLLGMMTYLVVNGLGELFHIDEEAEIADLDAESKPNSGPS 232

Query: 234 ------GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLL 286
                 GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL  IGA++VRS+T+ 
Sbjct: 233 ELAKAAGKAGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGLGLIGAMFVRSITVY 292

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS-IKN 345
           +++QG L++Y YLEHG++++I  L+VI+       +PE+ TG    +LI  ++ SS ++N
Sbjct: 293 LVRQGTLSQYVYLEHGAHWAIGALAVILLYSIGTPVPEVVTGLIGLVLIIAALISSVVRN 352

Query: 346 K 346
           +
Sbjct: 353 R 353


>gi|288922172|ref|ZP_06416373.1| protein of unknown function DUF475 [Frankia sp. EUN1f]
 gi|288346493|gb|EFC80821.1| protein of unknown function DUF475 [Frankia sp. EUN1f]
          Length = 413

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 111/331 (33%), Positives = 190/331 (57%), Gaps = 46/331 (13%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           EISLSF+NA++NA  L++MS +WQ+ FL+ G++IAVFGMR++FPI+IV + + ++P++  
Sbjct: 40  EISLSFDNAVINATILRRMSEVWQRLFLSLGVIIAVFGMRLLFPIVIVALTAHLSPLDVF 99

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
           +LA+    +Y   + +AH  I+ FGG FL M+ L F F+ +  + W+ +LE       ++
Sbjct: 100 DLALNDEAEYAARLHEAHPSIAAFGGIFLFMIFLDFMFDPERDIQWLRWLEEPFRKAGQL 159

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYS------FVSSSTAAIIIFYGINFL---------- 219
           +      VLS++ G+  +L   E +S       +++  A +  + G+  L          
Sbjct: 160 E------VLSVVTGLVALLVVAEAFSGDHTQQVLTAGVAGLATYLGVRGLGEFFEARGIG 213

Query: 220 -----------------ESVLSSDSSNN-------VTHGKHGLNLFLYLEIIDASLSLDG 255
                            ++  S+ +          +  G+    LFLYLE+IDAS S DG
Sbjct: 214 ADDDEDEDDDAAQSTSAQATGSAPAERRTGTPDLVLATGRAAFFLFLYLEVIDASFSFDG 273

Query: 256 VISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF 315
           V+ +FAI++N FII  GL IGA+Y+RS T+ ++++G L++Y +LEHG++Y+I  L+VI+ 
Sbjct: 274 VVGAFAISQNIFIIATGLGIGAMYIRSTTVYLVRRGTLSEYVFLEHGAHYAIGALAVILA 333

Query: 316 LQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +    ++ E+ TG      I L++ SSI+ +
Sbjct: 334 VSIETEVHEVVTGLIGVAFIGLALLSSIRFR 364


>gi|311895883|dbj|BAJ28291.1| hypothetical protein KSE_24770 [Kitasatospora setae KM-6054]
          Length = 360

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 199/344 (57%), Gaps = 30/344 (8%)

Query: 32  GWQFTHTLSGTISTVYI--------CIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T++G I+   I         +IL+++EISLSF+NA++NA  L++M++ WQK FL
Sbjct: 7   GWSFAITIAGLIAAGLIWGAEGFGVVLILSILEISLSFDNAVVNATVLKRMNAFWQKLFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD-----YLKIISQAHVPISG 138
           T G+LIAVFGMR++FP+++V + + ++P   + LA+ S +      Y + +  A+  I+ 
Sbjct: 67  TVGVLIAVFGMRLVFPLLVVGLTAHLSPGTVIELALDSSKTHDGHTYAEYLDLANPAIAA 126

Query: 139 FGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNE 198
           FGG FL+M+ L F F  ++  +W+ +LE  +  + K+  +   + L ++   S     + 
Sbjct: 127 FGGIFLLMIFLDFIFEEKD-FNWLRWLEKPLEKIGKLDALSSVVALVVLALSSRFFAGDR 185

Query: 199 MYSFVSSSTAAIIIFYGINFLESVLSS---------DSSNNVTH------GKHGLNLFLY 243
             + + +    +  +  +N L  V  S         D++           GK    LF+Y
Sbjct: 186 AETVLLAGICGLATYLAVNGLSEVFESGLEQQQEAEDAAERSGKSIVQVGGKAAFFLFIY 245

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           LE++DAS S DGV+ +FAI+++ F I +GL IGA+Y+RS+T+ ++++G L+ Y YLEHG+
Sbjct: 246 LEVLDASFSFDGVVGAFAISQDIFQITLGLGIGAMYIRSLTVFLVRKGTLDDYVYLEHGA 305

Query: 304 YYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI-KNK 346
           +Y+I  L++I+       IPEI TG      I  ++ +SI +NK
Sbjct: 306 HYAIGALALILLASIKYHIPEIVTGLIGVAFIGAALATSIVRNK 349


>gi|239931533|ref|ZP_04688486.1| hypothetical protein SghaA1_25160 [Streptomyces ghanaensis ATCC
           14672]
 gi|291439909|ref|ZP_06579299.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291342804|gb|EFE69760.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 379

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 128/371 (34%), Positives = 206/371 (55%), Gaps = 49/371 (13%)

Query: 10  LIHHFRWAILVT----VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAI 65
           ++  F W+  VT    VA FL G   GW          +   I  IL+++EISLSF+NA+
Sbjct: 2   VLKTFGWSFAVTALGLVAAFLFG---GW----------TAFGIVAILSILEISLSFDNAV 48

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+KM++ WQK FLT GILIAVFGMR++FP++IV + + + PIEA++LA+     Y
Sbjct: 49  VNAGILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAVSAQLGPIEAVDLALSDKDRY 108

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            ++++ AH  I+ FGG FL+M+ L F F  + ++ W+ +LE  ++ L K+  + + I L 
Sbjct: 109 QELVTDAHPAIAAFGGMFLLMIFLDFIFEDR-EIKWLAWLERPLAKLGKVDMLSVCIALI 167

Query: 186 IIFGISNILPT----------NEMYSFVSSSTAAIIIFYGINFLES-------------- 221
           ++   +    T          ++  + + S  A +I +  +  L                
Sbjct: 168 VLLISATAFATQAHQHGGTHVDKAETVLLSGIAGLITYLVVGGLSGFFEGKLEEEEEREH 227

Query: 222 -------VLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT 274
                        S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL 
Sbjct: 228 EEEEKAAREGKPRSAVALAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLG 287

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA+YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+ ++ +    ++ E+ TG     L
Sbjct: 288 IGAMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAALLLITIRYEVNELITGFIGVFL 347

Query: 335 IFLSIYSSIKN 345
           I  S +SS++ 
Sbjct: 348 IGASFWSSVRR 358


>gi|148927769|ref|ZP_01811201.1| protein of unknown function DUF475 [candidate division TM7
           genomosp. GTL1]
 gi|147886881|gb|EDK72419.1| protein of unknown function DUF475 [candidate division TM7
           genomosp. GTL1]
          Length = 344

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 122/349 (34%), Positives = 202/349 (57%), Gaps = 14/349 (4%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           MK+ S  A+L+  +  A  VT+   L  LG        L G  + ++  I+L  +E + S
Sbjct: 1   MKNTSSRAALLKIYWLAASVTL---LIWLG------AALWGGFTALFTVIVLTFLETTFS 51

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
            +NA++N+K L  MS  WQK F+T GI IAVF +R + PI+IV + + +   E + LAI 
Sbjct: 52  ADNAVVNSKVLASMSPRWQKLFMTLGIFIAVFLVRFLVPILIVVLTAGLGSTEVIQLAIN 111

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P  Y + +++A   IS FGGTFL+M++L++F + + + HW+ FLE  +  L +   + I
Sbjct: 112 EPHRYEQELAKAEPIISAFGGTFLLMIALSYFVDYEKQSHWLKFLERRLGKLGRFDDLTI 171

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN----NVTHGKH 236
           F++L    G+   +      + + +S AA+++  G+N LE++   +           G  
Sbjct: 172 FVMLLAALGLFFTVERAYHTAVLIASIAAMVLHIGLNLLEALFEKNKKGLFSIKPKVGGA 231

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
            L  FLYLEI+DAS S DGVI +FAIT +  +I+ GL  GA++VR+MT+ +++   L KY
Sbjct: 232 ALAAFLYLEILDASFSFDGVIGAFAITGSVVLIMAGLGAGAVWVRAMTIHLVRAKALTKY 291

Query: 297 KYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIK 344
            +LEHG+++++  L ++M L+   ++ PE F G +  ++I  SI  S +
Sbjct: 292 VFLEHGAHWALVFLGLVMLLKLYHIEFPEWFVGLAGIVVIAFSIVWSRR 340


>gi|183985097|ref|YP_001853388.1| hypothetical protein MMAR_5129 [Mycobacterium marinum M]
 gi|183178423|gb|ACC43533.1| conserved hypothetical membrane protein [Mycobacterium marinum M]
          Length = 358

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 120/361 (33%), Positives = 211/361 (58%), Gaps = 35/361 (9%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           I  F  ++LVT A  + G    W       G ++ +++ ++LA++EISLSF+NAI+NA  
Sbjct: 4   IRVFGLSLLVTAAALVAGY---WH------GGVTALFLLVVLAILEISLSFDNAIINATI 54

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP-------- 122
           L++MS  WQ+ FLT GI+IAVFGMR++FP+ IV + + ++P+ AM LA+  P        
Sbjct: 55  LKQMSQFWQQMFLTIGIVIAVFGMRLVFPLTIVWVTAGLDPVRAMRLALNPPPGGALDFP 114

Query: 123 ---QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                Y K+IS AH  I+ FGG FL+ + L F FN + ++ W+ ++E   + + ++  + 
Sbjct: 115 DGSPSYEKLISAAHPQIAAFGGMFLLTLFLDFVFNDR-EIKWLKWIEAPFARIGRLGQVH 173

Query: 180 IFIV-LSIIFGISNILP-TNEMYSFVSSSTAAIIIFYGINFLESVLSSDS--------SN 229
           + +  +++IF    +   ++++ + + +    ++ +  +N L   L            + 
Sbjct: 174 VMVACVTLIFAGPGLTDSSDDLGTVMVAGLLGLVTYLVVNGLSRALQPPRVGAGPGELAA 233

Query: 230 NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLML 288
               GK G  LF+YLE++DAS S DGV  +FAIT +  +I +GL  +GA++VRS+T+ ++
Sbjct: 234 QGAVGKAGFMLFMYLEVLDASFSFDGVTGAFAITSDPIVIALGLGLVGAMFVRSITIYLV 293

Query: 289 KQGILNKYKYLEHGSYYSIFVLSVIMFLQTI--VDIPEIFTGTSSTILIFLSIYSS-IKN 345
           +Q  L++Y YLEHG++++I  L+VIM +     + IPE  T +   + I  +  +S ++N
Sbjct: 294 RQDALDRYVYLEHGAHWAIGALAVIMLMSIDHHLQIPEWITASIGVVFIGAAFTNSVVRN 353

Query: 346 K 346
           +
Sbjct: 354 R 354


>gi|126643296|ref|YP_001086280.1| hypothetical protein A1S_3289 [Acinetobacter baumannii ATCC 17978]
          Length = 327

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 119/312 (38%), Positives = 190/312 (60%), Gaps = 15/312 (4%)

Query: 48  ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVS 107
           I  ILAV+E+SLSF+NA++NA  L+     W+  FLT GILIAVFGMR+IFP++IV + +
Sbjct: 7   ITAILAVMEVSLSFDNAVVNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTA 66

Query: 108 TINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEI 167
            +  IE   +A+  P+ Y + +   H  IS FGGTFL++V L FFF+ + + HW  +LE 
Sbjct: 67  DMGVIEVAKMALNDPKTYSERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLES 126

Query: 168 AMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS--- 224
            ++ L+ +  + +F+ L  +  ++  +  ++  +   +    I+++ G+  L  +L    
Sbjct: 127 KLASLASVPAMSVFLALIALIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEP 186

Query: 225 --SDSSNNVTHG---------KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
              ++ N V            K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL
Sbjct: 187 EIDENGNAVLQDGTGAASGVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGL 246

Query: 274 TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSST 332
            IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG    
Sbjct: 247 AIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGV 306

Query: 333 ILIFLSIYSSIK 344
             I  ++ +SI+
Sbjct: 307 AFIVWAVIASIQ 318


>gi|213159028|ref|YP_002321026.1| major facilitator family transporter [Acinetobacter baumannii
           AB0057]
 gi|213058188|gb|ACJ43090.1| major facilitator family transporter [Acinetobacter baumannii
           AB0057]
          Length = 327

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 118/312 (37%), Positives = 190/312 (60%), Gaps = 15/312 (4%)

Query: 48  ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVS 107
           I  ILAV+E+SLSF+NA++NA  L+     W+  FLT GILIAVFGMR+IFP++IV + +
Sbjct: 7   ITAILAVMEVSLSFDNAVVNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTA 66

Query: 108 TINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEI 167
            +  +E   +A+  P+ Y + +   H  IS FGGTFL++V L FFF+ + + HW  +LE 
Sbjct: 67  DMGVVEVAKMALNDPKTYSERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLES 126

Query: 168 AMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS--- 224
            ++ L+ +  + +F+ L  +  ++  +  ++  +   +    I+++ G+  L  +L    
Sbjct: 127 KLASLASVPAMSVFLALIALIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEP 186

Query: 225 --SDSSNNVTHG---------KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
              ++ N V            K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL
Sbjct: 187 EIDENGNAVLQDGSGAASGVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGL 246

Query: 274 TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSST 332
            IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG    
Sbjct: 247 AIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGV 306

Query: 333 ILIFLSIYSSIK 344
             I  ++ +SI+
Sbjct: 307 AFIVWAVIASIQ 318


>gi|118619378|ref|YP_907710.1| hypothetical protein MUL_4205 [Mycobacterium ulcerans Agy99]
 gi|118571488|gb|ABL06239.1| conserved hypothetical membrane protein [Mycobacterium ulcerans
           Agy99]
          Length = 358

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 121/361 (33%), Positives = 209/361 (57%), Gaps = 35/361 (9%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           I  F  ++LVT A  + G    W       G ++ +++ ++LA++EISLSF+NAI+NA  
Sbjct: 4   IRVFGLSLLVTAAALIAGY---WH------GGVTALFLLVVLAILEISLSFDNAIINATI 54

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP-------- 122
           L++MS  WQ+ FLT GI+IAVFGMR++FP+ IV + + ++P+ AM LA+  P        
Sbjct: 55  LKQMSQFWQQMFLTIGIVIAVFGMRLVFPLTIVWVTAGLDPVRAMRLALNPPPGGALDFP 114

Query: 123 ---QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                Y K+IS AH  I+ FGG FL+ + L F FN + ++ W+ ++E   + + ++  + 
Sbjct: 115 DGSPSYEKLISAAHPQIAAFGGMFLLTLFLDFVFNDR-EIKWLKWIEAPFARIGRLGQVH 173

Query: 180 IFIV-LSIIFGISNILPTNEMYSFVS-SSTAAIIIFYGINFLESVLSSDS--------SN 229
           + +  +++IF    +  +++    V  +    ++ +  +N L   L            + 
Sbjct: 174 VMVACVTLIFAGPGLTDSSDDLGIVMVAGLLGLVTYLVVNGLSRALQPPRVGAGPGELAA 233

Query: 230 NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLML 288
               GK G  LF+YLE++DAS S DGV  +FAIT +  +I +GL  +GA++VRS+T+ ++
Sbjct: 234 QGAVGKAGFMLFMYLEVLDASFSFDGVTGAFAITSDPIVIALGLGLVGAMFVRSITIYLV 293

Query: 289 KQGILNKYKYLEHGSYYSIFVLSVIMFLQTI--VDIPEIFTGTSSTILIFLSIYSS-IKN 345
           +Q  L++Y YLEHG++++I  L+VIM +     + IPE  T +   + I  +  +S ++N
Sbjct: 294 RQDALDRYVYLEHGAHWAIGALAVIMLMSIDHHLQIPEWITASIGVVFIGAAFTNSVVRN 353

Query: 346 K 346
           +
Sbjct: 354 R 354


>gi|325123816|gb|ADY83339.1| putative integral membrane protein [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 327

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 121/312 (38%), Positives = 188/312 (60%), Gaps = 15/312 (4%)

Query: 48  ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVS 107
           I  ILAV+E+SLSF+NA++NA  L+     W+  FLT GILIAVFGMR+IFP+ IV + +
Sbjct: 7   ITAILAVMEVSLSFDNAVVNASVLRNWDPFWKMLFLTVGILIAVFGMRLIFPVAIVAVTA 66

Query: 108 TINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEI 167
            +  IE   LA+  P+ Y + +   H  IS FGGTFL++V L FFF+ + + HW  +LE 
Sbjct: 67  DMGMIEVAKLALNDPKTYSERLMAHHAEISAFGGTFLLLVFLNFFFDEEKETHWFRWLEA 126

Query: 168 AMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFL------ES 221
            +S L+ +  + +FI L  +  ++  +  ++      +    I+++ G+  L      E 
Sbjct: 127 KLSSLASVPAMSVFIALIAMLIMAANVDESQRLVVTMAGIWGIVVYIGVEVLSHMLGGEP 186

Query: 222 VLSSDSSNNVTHG--------KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
            +  D +  +  G        K G+  FLYLE++DAS S DGVI +FAIT +  +I++GL
Sbjct: 187 EIDEDGNAIMKDGSGAASGVVKAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGL 246

Query: 274 TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSST 332
            IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG    
Sbjct: 247 AIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGV 306

Query: 333 ILIFLSIYSSIK 344
             I  ++ +SI+
Sbjct: 307 AFIVWAVIASIQ 318


>gi|262204555|ref|YP_003275763.1| hypothetical protein Gbro_4752 [Gordonia bronchialis DSM 43247]
 gi|262087902|gb|ACY23870.1| protein of unknown function DUF475 [Gordonia bronchialis DSM 43247]
          Length = 380

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 124/356 (34%), Positives = 202/356 (56%), Gaps = 48/356 (13%)

Query: 25  FLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLT 84
           FL G   GWQ           + + +IL ++E+SLSF+NA++NA  L++MS  WQK FLT
Sbjct: 21  FLYG---GWQ----------ALILTVILGILEVSLSFDNAVINATVLRRMSEFWQKIFLT 67

Query: 85  WGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD-----------YLKIISQAH 133
            GILIAVFGMR++FP+ IV + S + P++A++LA+  P D           Y  II+ AH
Sbjct: 68  IGILIAVFGMRLVFPLAIVWMASGLGPVQALDLALNPPPDDAAYFPNGDPSYETIITDAH 127

Query: 134 VPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNI 193
             I+ FGG FL+M+ L F    + ++ W+ ++E  +  + K++ +++ I   ++   +  
Sbjct: 128 PQIAAFGGMFLLMLFLGFVLE-EKEITWLSWIERPLERIGKLEMLEVVIATGLLIITAEY 186

Query: 194 LPTNEMYSFVSSSTA-AIIIFYGINFL------ESVLSSDSSNNVTH------------- 233
           +   E  S V  + A  +I +  +N L      ++V+  + ++                 
Sbjct: 187 IAAPEERSTVMIAGALGMITYIAVNGLGELFKVDNVVDDEDADPAPENAKRSGGPSDLAK 246

Query: 234 --GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQ 290
             GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL  IGA++VRS+T+ ++++
Sbjct: 247 ATGKAGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGLGLIGAMFVRSLTVYLVRK 306

Query: 291 GILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           G L++Y YLEHG++++I  L+ I+       + E+ TG    +LI  +  SSI  +
Sbjct: 307 GTLSEYVYLEHGAHWAIGALAFILLYSIGTHVNEVITGLVGVVLIGAAFASSIVRR 362


>gi|281491592|ref|YP_003353572.1| hypothetical protein LLKF_1120 [Lactococcus lactis subsp. lactis
           KF147]
 gi|281375310|gb|ADA64823.1| Hypothetical protein LLKF_1120 [Lactococcus lactis subsp. lactis
           KF147]
          Length = 339

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 191/309 (61%), Gaps = 13/309 (4%)

Query: 46  VYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCI 105
           ++I +ILAV+EISLS +NAI+NA+ L++MSS WQK FLT G+LIAV GMR+IFP++IV +
Sbjct: 27  LFITLILAVLEISLSMDNAIVNARILERMSSAWQKAFLTLGVLIAVLGMRLIFPLLIVGV 86

Query: 106 VSTINPIEAMNLAIYSPQD-----YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
            + I+PI A+ LA+          Y  I+  AH  I+ FGG FL+M++L FFF+ +    
Sbjct: 87  SAQIDPISALKLALEKGNPNTVGTYGYILHHAHPQIAAFGGMFLLMLALGFFFDERAH-T 145

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGIN-FL 219
           W+   E  +  +         I + ++   S  +   + ++ + +    I+ F  ++ F 
Sbjct: 146 WLKIPEKILQKIGNFPAANAIISIILLLITSEFI-AKDAHAVLFAGILGILTFMLVDGFG 204

Query: 220 ESVLSSDSSNN----VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL-T 274
           E++  S ++N     V  GK GL LFLYLE+IDAS S DGVI +FAIT +  II++GL  
Sbjct: 205 ETMSHSKAANTTSSVVATGKAGLALFLYLEVIDASFSFDGVIGAFAITADPIIILLGLGV 264

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA++VRS+TL ++++G LN   YLEHG++++I  L+ ++      +I E+ TG    + 
Sbjct: 265 IGAMFVRSLTLYLVQKGTLNDLVYLEHGAHWAILTLAFLILASIKWEIGEVVTGLLGAVF 324

Query: 335 IFLSIYSSI 343
           I LS  SS+
Sbjct: 325 IILSFISSV 333


>gi|15673075|ref|NP_267249.1| hypothetical protein L99421 [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12724049|gb|AAK05191.1|AE006341_10 conserved hypothetical protein [Lactococcus lactis subsp. lactis
           Il1403]
 gi|326406643|gb|ADZ63714.1| conserved hypothetical protein [Lactococcus lactis subsp. lactis
           CV56]
          Length = 339

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 123/309 (39%), Positives = 190/309 (61%), Gaps = 13/309 (4%)

Query: 46  VYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCI 105
           ++I +ILAV+EISLS +NAI+NA+ L++MS  WQK FLT G+LIAV GMR+IFP++IV +
Sbjct: 27  LFITLILAVLEISLSMDNAIVNARILERMSFAWQKAFLTLGVLIAVLGMRLIFPLLIVGV 86

Query: 106 VSTINPIEAMNLAIYSPQD-----YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
            + I+PI A+ LA+          Y  I+  AH  I+ FGG FL+M++L FFF+ +    
Sbjct: 87  SAQIDPISALKLALEKGNPNTVGTYGYILHHAHPQIAAFGGMFLLMLALGFFFDERAH-T 145

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGIN-FL 219
           W+   E  +  +         I + ++   S  +   + ++ + +    I+ F  ++ F 
Sbjct: 146 WLKIPEKILQKIGNFPAANAIISIILLLITSEFI-AKDAHAVLFAGILGILTFMLVDGFG 204

Query: 220 ESVLSSDSSNN----VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL-T 274
           E++  S ++N     V  GK GL LFLYLE+IDAS S DGVI +FAIT +  II++GL  
Sbjct: 205 ETMSHSKAANTTSSVVATGKAGLALFLYLEVIDASFSFDGVIGAFAITADPIIILLGLGV 264

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA++VRS+TL ++++G LN   YLEHG++++I  L+ ++      +I E+ TG    + 
Sbjct: 265 IGAMFVRSLTLYLVQKGTLNDLVYLEHGAHWAILTLAFLILASIKWEIGEVVTGLLGAVF 324

Query: 335 IFLSIYSSI 343
           I LS  SS+
Sbjct: 325 IILSFISSV 333


>gi|111019440|ref|YP_702412.1| integral membrane protein [Rhodococcus jostii RHA1]
 gi|110818970|gb|ABG94254.1| possible integral membrane protein [Rhodococcus jostii RHA1]
          Length = 389

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 116/336 (34%), Positives = 196/336 (58%), Gaps = 31/336 (9%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G    V + +IL+++EISLSF+NA++NA  L++MS  WQK FLT GI+IAVFGMR++FP+
Sbjct: 33  GGPQAVLLVVILSILEISLSFDNAVINATVLRRMSEFWQKIFLTVGIVIAVFGMRLVFPL 92

Query: 101 MIVCIVSTINPIEAMNLAIYSPQD-----------YLKIISQAHVPISGFGGTFLMMVSL 149
           +IV + S + P+ A++LA+  P D           Y  +++ AH  I+ FGG FL+M+ L
Sbjct: 93  VIVWLASGLGPVAALDLALNPPADGAAYFPDGSASYETLLTDAHPQIAAFGGMFLLMLFL 152

Query: 150 TFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF-GISNILPTNEMYSFVSSSTA 208
            F    + ++ W+ +LE  ++   K+  + + I  +++    + I P + + + + +   
Sbjct: 153 GFILE-EREITWLSWLEKPLARAGKLDQLAVIIAGALLLITAAYIAPEDTVSTVMIAGVL 211

Query: 209 AIIIFYGINFLESVLSSDSSNNVTH----------------GKHGLNLFLYLEIIDASLS 252
            ++ +  +N L  + ++   +                    GK G  LFLYLE++DAS S
Sbjct: 212 GMVTYIAVNGLGELFNTPEGDEDGELVEGSKGGPTELAKATGKAGFFLFLYLEVLDASFS 271

Query: 253 LDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
            DGVI +FAIT +  II +GL  +GA++VRS+T+ ++++G L+ Y YLEHG++++I  L+
Sbjct: 272 FDGVIGAFAITSDPIIIALGLGFVGAMFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALA 331

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI-KNK 346
           VI+ +     + E  TG     LI  +  SSI +N+
Sbjct: 332 VILLVSIGYHVNENVTGLVGVALIGAAFISSIVRNR 367


>gi|111024984|ref|YP_707404.1| integral membrane protein [Rhodococcus jostii RHA1]
 gi|110823963|gb|ABG99246.1| possible integral membrane protein [Rhodococcus jostii RHA1]
          Length = 389

 Score =  202 bits (515), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 116/336 (34%), Positives = 196/336 (58%), Gaps = 31/336 (9%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G    V + +IL+++EISLSF+NA++NA  L++MS  WQK FLT GI+IAVFGMR++FP+
Sbjct: 33  GGPQAVLLVVILSILEISLSFDNAVINATVLRRMSEFWQKIFLTVGIVIAVFGMRLVFPL 92

Query: 101 MIVCIVSTINPIEAMNLAIYSPQD-----------YLKIISQAHVPISGFGGTFLMMVSL 149
           +IV + S + P+ A++LA+  P D           Y  +++ AH  I+ FGG FL+M+ L
Sbjct: 93  VIVWLASGLGPVAALDLALNPPADGAAYFPDGSASYETLLTDAHPQIAAFGGMFLLMLFL 152

Query: 150 TFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF-GISNILPTNEMYSFVSSSTA 208
            F    + ++ W+ +LE  ++   K+  + + I  +++    + I P + + + + +   
Sbjct: 153 GFILE-EREITWLSWLEKPLARAGKLDQLAVIIAGALLLITAAYIAPEDTVSTVMIAGVL 211

Query: 209 AIIIFYGINFLESVLSSDSSNNVTH----------------GKHGLNLFLYLEIIDASLS 252
            ++ +  +N L  + ++   +                    GK G  LFLYLE++DAS S
Sbjct: 212 GMVTYIAVNGLGELFNTPEGDEDGELVEGSKGGPTELAKATGKAGFFLFLYLEVLDASFS 271

Query: 253 LDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
            DGVI +FAIT +  II +GL  +GA++VRS+T+ ++++G L+ Y YLEHG++++I  L+
Sbjct: 272 FDGVIGAFAITSDPIIIALGLGFVGAMFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALA 331

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSS-IKNK 346
           VI+ +     + E  TG     LI  +  SS I+N+
Sbjct: 332 VILLVSIGYHVNENVTGLVGVALIGAAFISSIIRNR 367


>gi|125624168|ref|YP_001032651.1| hypothetical protein llmg_1349 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|124492976|emb|CAL97939.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300070945|gb|ADJ60345.1| hypothetical protein LLNZ_06975 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 356

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 199/326 (61%), Gaps = 25/326 (7%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G +  + +  IL ++E+SLSF+NAI+NA+ L++MS  W+  FLT G+LIAV GMR IFP+
Sbjct: 22  GGVDALILATILGIMEVSLSFDNAIVNARILERMSHRWRNIFLTVGMLIAVLGMRFIFPL 81

Query: 101 MIVCIVSTINPIEAMNLAIY--SPQ---DYLKIISQAHVPISGFGGTFLMMVSLTFFFNS 155
            +V + + ++P++A++LA+   +P+    Y  I+  AH  I+ FGG FL+M++L FFF+ 
Sbjct: 82  AVVSVSAQMSPMKALHLAMEKGNPETVGTYGYILQHAHPVIAAFGGAFLLMLALNFFFD- 140

Query: 156 QNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYG 215
           +N  HW    E  +  + K       IVL ++  IS  + + + Y    S  A ++++  
Sbjct: 141 ENDYHWFVLPEKLLFKIGKFPMATPMIVLVVMMVISKWV-SGQSYLVFFSGAAGMVLYMA 199

Query: 216 I----NFLE-----SVLSSDSSNN--------VTHGKHGLNLFLYLEIIDASLSLDGVIS 258
           +    N +E     + ++ +  N+        +  GK    LFLYLE+IDAS S DG I 
Sbjct: 200 VEGLGNLMEHHGTLAEVAEEIENDEPLIAQSILATGKQAFVLFLYLEMIDASFSFDGAIG 259

Query: 259 SFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ 317
           +FAIT +  +I++GL  IGA++VRS+T+ ++++G LN + YL+HG++++I  LS+++ + 
Sbjct: 260 AFAITSDPIVIMLGLGLIGAMFVRSLTVYLVEKGTLNDFVYLDHGAHWAILTLSILLLVS 319

Query: 318 TIVDIPEIFTGTSSTILIFLSIYSSI 343
             ++IPEI TG    ILI  S  SSI
Sbjct: 320 INIEIPEIVTGLIGAILIGASFLSSI 345


>gi|34557555|ref|NP_907370.1| hypothetical protein WS1186 [Wolinella succinogenes DSM 1740]
 gi|34483272|emb|CAE10270.1| INTEGRAL MEMBRANE PROTEIN [Wolinella succinogenes]
          Length = 333

 Score =  202 bits (514), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 120/339 (35%), Positives = 201/339 (59%), Gaps = 21/339 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +FR++ ++ + G L          +   G +   YI  +LA++E+S+SF+NA++NAK 
Sbjct: 7   MKYFRFSFVLALVGVLV--------AYFFLGGLYAAYIVALLALLEVSISFDNAVINAKV 58

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M+  W++RF+ +GI IAVFG+R I PI+IV + S    IE +NLA+     Y + + 
Sbjct: 59  LEGMTPKWRERFIIYGIPIAVFGVRFILPIIIVSLASGEGMIEILNLALSDAALYAEKLE 118

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM--SHLSKIKGIKIFIVLSIIF 188
                I  FGG FL+MV L FFF+   ++ W+  LE       +S+I  I++ +  +I+ 
Sbjct: 119 GVMGKIYAFGGAFLLMVFLEFFFDEDREVVWLRRLEQNRITQRISQINFIELLV--AILV 176

Query: 189 GISNILPTNEMYSFVSSSTA-AIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
           G+        + SF+S     ++  F GI     +   D +      + G+  FLYLE++
Sbjct: 177 GV--------VLSFLSGELGVSLAYFIGIALYALIRGIDHALIKGGARSGVIGFLYLEVL 228

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS SLDGVI +FA++ N FIIVIGL IGA +VRS+T+  +++ +L+++ YLEHG+ Y+I
Sbjct: 229 DASFSLDGVIGAFALSSNIFIIVIGLAIGAFFVRSLTIYFVEKKVLSEFIYLEHGARYAI 288

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            +L+++MF+Q  + + E   G+   ++I  ++  SI +K
Sbjct: 289 LILALMMFVQIFMHVSEAIVGSVGVVIILGALLHSIIHK 327


>gi|258653185|ref|YP_003202341.1| hypothetical protein Namu_3015 [Nakamurella multipartita DSM 44233]
 gi|258556410|gb|ACV79352.1| protein of unknown function DUF475 [Nakamurella multipartita DSM
           44233]
          Length = 379

 Score =  202 bits (514), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 197/345 (57%), Gaps = 42/345 (12%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G+ S V +C IL V+E+SLSF+NA++NA  L++MS  WQK FLT GI+IAVFGMR++ P+
Sbjct: 24  GSWSAVVLCAILGVLEVSLSFDNAVINATILERMSEFWQKMFLTVGIVIAVFGMRLLLPL 83

Query: 101 MIVCIVSTINPIEAMNLAIYSPQD-----------YLKIISQAHVPISGFGGTFLMMVSL 149
           +IV   + + P+EA  LA+  P D           Y  +++ AH  I+ FGG FL+M+ L
Sbjct: 84  LIVYFAAGLPPVEAFQLAMNPPADGAAYFPDGSPSYETLLTDAHPIIAAFGGMFLLMLFL 143

Query: 150 TFFFNSQNKLH-WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTA 208
            + F  + K H W+ +LE  ++   ++  + I +   ++  +S  L   +  + + +   
Sbjct: 144 NWLF--EEKEHTWLTWLERPLAKAGRLDSMAILVACLLLLVVSETL-AEDAETVLFAGLL 200

Query: 209 AIIIFYGINFL-------ESVLSSDS---SNNVTH---------------GKHGLNLFLY 243
            ++++  +N L       E +   D      NV H               GK G  LFLY
Sbjct: 201 GLVVYLAVNGLGTFFENAEHIGEDDGEARETNVDHEPSVAGRNTKLVKAAGKAGFFLFLY 260

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           LE++DAS S DGVI +FAIT +  +I +GL  IGA++VRS+T+ ++++G L++Y YLEHG
Sbjct: 261 LEVLDASFSFDGVIGAFAITSDPILIALGLGLIGAMFVRSLTVYLVRKGTLSEYVYLEHG 320

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI-KNK 346
           ++++I  L+VI+ +   V I E  TG      I  +  SSI +NK
Sbjct: 321 AHWAIGALAVILMISIGVHISEFITGLLGVAFIGAAFISSIQRNK 365


>gi|116512028|ref|YP_809244.1| hypothetical protein LACR_1294 [Lactococcus lactis subsp. cremoris
           SK11]
 gi|116107682|gb|ABJ72822.1| hypothetical protein LACR_1294 [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 355

 Score =  202 bits (513), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 126/326 (38%), Positives = 201/326 (61%), Gaps = 25/326 (7%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G +  + +  IL ++E+SLSF+NAI+NA+ L++MS  W+  FLT G+LIAV GMR IFP+
Sbjct: 22  GGVDALVLATILGIMEVSLSFDNAIVNARILERMSHRWRNIFLTVGMLIAVLGMRFIFPL 81

Query: 101 MIVCIVSTINPIEAMNLAIY--SPQ---DYLKIISQAHVPISGFGGTFLMMVSLTFFFNS 155
            +V I + ++P+EA++LA+    P+    Y  I+  AH  I+ FGG FL+M++L FFF+ 
Sbjct: 82  AVVSISAQLSPLEALHLAMEKGDPETIGTYGYILQHAHPMIAAFGGAFLLMLALNFFFD- 140

Query: 156 QNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYG 215
           +N  HWI   E  +  + K       IVL ++ GIS  + +++ Y    +  A ++++  
Sbjct: 141 ENDYHWIVIPEKLLFRIGKFPMATPMIVLIVMMGISKWV-SSQSYLIFFAGAAGMVLYMA 199

Query: 216 INFLESVL---------SSDSSNN--------VTHGKHGLNLFLYLEIIDASLSLDGVIS 258
           +  L S++         + +  N+        +  GK    LFLYLE+IDAS S DG I 
Sbjct: 200 VEGLGSLMEHHGTLAEVTEEIENDEPLIAQTVLATGKQAFVLFLYLEMIDASFSFDGAIG 259

Query: 259 SFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ 317
           +FAIT +  +I++GL  IGA++VRS+T+ ++++G LN + YL+HG++++I VLSV++ + 
Sbjct: 260 AFAITSDPIVIMLGLGLIGAMFVRSLTVYLVEKGTLNDFVYLDHGAHWAILVLSVLLLIS 319

Query: 318 TIVDIPEIFTGTSSTILIFLSIYSSI 343
             V+IPEI TG    ILI  S  SS+
Sbjct: 320 INVEIPEIITGLIGAILIGASFLSSV 345


>gi|300744120|ref|ZP_07073139.1| integral membrane protein [Rothia dentocariosa M567]
 gi|300379845|gb|EFJ76409.1| integral membrane protein [Rothia dentocariosa M567]
          Length = 365

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 126/355 (35%), Positives = 204/355 (57%), Gaps = 32/355 (9%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+  F++ +L+T+A       IG  F   + G +S      IL V+EI  SF+NA +NA
Sbjct: 2   ALLKFFKYDLLITLAAL-----IGAAFYGGIVGMVSAA----ILIVLEIVFSFDNAGVNA 52

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQ 123
           K L KMS  W+  FLT G+L+AVFGMR+IFP +IVC+   + P+EA NLA+     ++P 
Sbjct: 53  KYLDKMSHAWRNIFLTVGVLVAVFGMRLIFPFLIVCLAGNVGPVEAWNLAMERGDPHTPG 112

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK---- 179
            Y  I+  AH  I+ FGG FL+M+ L+F F +   +HW+  +E  ++       +     
Sbjct: 113 TYGYILESAHHTIASFGGMFLLMLFLSFLFEAGKDVHWLSVIEKPLAKAGHFDSMPVLVS 172

Query: 180 --IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN------- 230
             I +  S +FG  +    +E Y+ + S    ++ F   N L + +   + +        
Sbjct: 173 GVILVTASQLFGAEH----HEQYTILLSGLLGMLTFLATNGLATFMEDRNESQEESLANV 228

Query: 231 -VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLK 289
            V  GK   ++F++LE++DAS S DGV+ +FA+T +  II IGL +GA++VRSMT+ +++
Sbjct: 229 AVLTGKAAFSMFIFLEVLDASFSFDGVLGAFAVTSDPIIIAIGLGVGALFVRSMTIYLVE 288

Query: 290 QGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +G L + +YL+HG++++I VL++++      DIP+   G S  + I  SI SS K
Sbjct: 289 KGTLQELRYLDHGAHWAIGVLALMLLATLKWDIPDYVIGLSGIVFIAGSIISSRK 343


>gi|226361590|ref|YP_002779368.1| hypothetical protein ROP_21760 [Rhodococcus opacus B4]
 gi|226240075|dbj|BAH50423.1| hypothetical membrane protein [Rhodococcus opacus B4]
          Length = 389

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 116/339 (34%), Positives = 197/339 (58%), Gaps = 31/339 (9%)

Query: 38  TLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRII 97
            L G    V + +IL+++EISLSF+NA++NA  L++MS  WQK FLT GI+IAVFGMR++
Sbjct: 30  ALYGGPQAVLLVVILSILEISLSFDNAVINATVLRRMSEFWQKIFLTVGIVIAVFGMRLV 89

Query: 98  FPIMIVCIVSTINPIEAMNLAIYSPQD-----------YLKIISQAHVPISGFGGTFLMM 146
           FP++IV + S + P+ A++LA+  P D           Y  +++ AH  I+ FGG FL+M
Sbjct: 90  FPLVIVWLASGLGPVAALDLALNPPADGAAYFPDGSASYETLLTDAHPQIAAFGGMFLLM 149

Query: 147 VSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV-LSIIFGISNILPTNEMYSFVSS 205
           + L F    + ++ W+ +LE  ++   K+  + + +  + ++   + I P + + + + +
Sbjct: 150 LFLGFILE-EREITWLSWLEKPLARAGKLDQLAVVVAGVLLLITAAYIAPEDTVSTVMIA 208

Query: 206 STAAIIIFYGINFLESVLSSDSSNNVTH----------------GKHGLNLFLYLEIIDA 249
               ++ +  +N L  + ++   +                    GK G  LFLYLE++DA
Sbjct: 209 GVLGMVTYIAVNGLGELFNTPEEDEDGEPVAGSTGGPTELAKATGKAGFFLFLYLEVLDA 268

Query: 250 SLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           S S DGVI +FAIT +  II +GL  +GA++VRS+T+ ++++G L+ Y YLEHG++++I 
Sbjct: 269 SFSFDGVIGAFAITSDPIIIALGLGFVGAMFVRSITVFLVRKGTLSDYVYLEHGAHWAIG 328

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI-KNK 346
            L+VI+ +     + E  TG     LI  +  SSI +N+
Sbjct: 329 ALAVILLVSIGYHVNENVTGLVGVALIGAAFISSIVRNR 367


>gi|311112703|ref|YP_003983925.1| integral membrane protein [Rothia dentocariosa ATCC 17931]
 gi|310944197|gb|ADP40491.1| integral membrane protein [Rothia dentocariosa ATCC 17931]
          Length = 365

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 126/355 (35%), Positives = 204/355 (57%), Gaps = 32/355 (9%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+  F++ +L+T+A       IG  F   + G +S      IL V+EI  SF+NA +NA
Sbjct: 2   ALLKFFKYDLLITLAAL-----IGAAFYGGIVGMVSAA----ILIVLEIVFSFDNAGVNA 52

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQ 123
           K L KMS  W+  FLT G+L+AVFGMR+IFP +IVC+   + P+EA NLA+     ++P 
Sbjct: 53  KYLDKMSHAWRNIFLTVGVLVAVFGMRLIFPFLIVCLAGNVGPVEAWNLAMERGDPHTPG 112

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK---- 179
            Y  I+  AH  I+ FGG FL+M+ L+F F +   +HW+  +E  ++       +     
Sbjct: 113 TYGYILESAHHTIASFGGMFLLMLFLSFLFEAGKDVHWLSVIEKPLAKAGHFDSMPVLVS 172

Query: 180 --IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN------- 230
             I +  S +FG  +    +E Y+ + S    ++ F   N L + +   + +        
Sbjct: 173 GVILVTASQLFGAEH----HEQYAILLSGLLGMLTFLATNGLATFMEDRNESQEESLANV 228

Query: 231 -VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLK 289
            V  GK   ++F++LE++DAS S DGV+ +FA+T +  II IGL +GA++VRSMT+ +++
Sbjct: 229 AVLTGKAAFSMFIFLEVLDASFSFDGVLGAFAVTSDPIIIAIGLGVGALFVRSMTIYLVE 288

Query: 290 QGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +G L + +YL+HG++++I VL++++      DIP+   G S  + I  SI SS K
Sbjct: 289 KGTLQELRYLDHGAHWAIGVLALMLLATLKWDIPDYVIGLSGIVFIAGSIISSRK 343


>gi|158312910|ref|YP_001505418.1| hypothetical protein Franean1_1056 [Frankia sp. EAN1pec]
 gi|158108315|gb|ABW10512.1| protein of unknown function DUF475 [Frankia sp. EAN1pec]
          Length = 422

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 109/319 (34%), Positives = 185/319 (57%), Gaps = 28/319 (8%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           EISLSF+NA++NA  L++MS  WQ+ FL+ G++IAVFGMR++FPI+IV + + ++P++  
Sbjct: 68  EISLSFDNAVINATILRRMSEFWQRIFLSVGVIIAVFGMRLLFPIVIVALTAHLSPVDVF 127

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
           +LA+   ++Y   +  AH  I+ FGG FL M+ L F F+ + ++ WI  +E       ++
Sbjct: 128 DLALNHEEEYGARLHDAHPSIAAFGGIFLFMIFLDFMFDPEREIQWIKRIEEPFRRAGQL 187

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGI----NFLESV--------- 222
             + + + L  +  +      +     +++  A +  + G+     F E+          
Sbjct: 188 DVVSVVLGLVALLVVGEAFSGDHTQQVLTAGVAGLATYLGVRGLGEFFEARGIGADDDED 247

Query: 223 --------------LSSDSSNNV-THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFF 267
                          ++ +S+ V   G+    LFLYLE+IDAS S DGV+ +FAI++N F
Sbjct: 248 DEDEKAGANGSAPGRTTGTSDVVLATGRAAFFLFLYLEVIDASFSFDGVVGAFAISQNIF 307

Query: 268 IIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFT 327
           II  GL IGA+Y+RS T+ ++++G L +Y YLEHG++Y+I  L+VI+ +    ++ EI T
Sbjct: 308 IIAAGLGIGAMYIRSTTVYLVRRGTLGEYIYLEHGAHYAIGALAVILAVSIETEVHEIVT 367

Query: 328 GTSSTILIFLSIYSSIKNK 346
           G      I L++ SSI+++
Sbjct: 368 GLIGVAFIGLALLSSIRHR 386


>gi|296166693|ref|ZP_06849118.1| integral membrane protein [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295897958|gb|EFG77539.1| integral membrane protein [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 358

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 107/312 (34%), Positives = 194/312 (62%), Gaps = 22/312 (7%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           EISLSF+NAI+NA  L++MS  W++ FLT G+L+AVFGMR++FP++IV + + ++P+ AM
Sbjct: 40  EISLSFDNAIINAAILKQMSPFWRQMFLTIGVLVAVFGMRLLFPLLIVWVTAGLDPVRAM 99

Query: 116 NLAIYSPQD-----------YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHF 164
            LA++ P +           Y K+I  AH  I+ FGGTFL+M+ L F F+ ++ + W+ +
Sbjct: 100 ELALHPPPNGALEFPDGSPSYEKLIGAAHPQIAAFGGTFLLMLFLDFVFHDRD-IKWLKW 158

Query: 165 LEIAMSHLSKIK--GIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESV 222
           +E+  + + ++    + + +V  ++ G+       E  + +++    ++ +  +N L   
Sbjct: 159 IEVPFARIGRLGQVSVAVTVVALVVVGMRLTHSGEERATVLTAGLLGLVTYLVVNGLSRA 218

Query: 223 LSSD----SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGA 277
                   + +    GK GL LFLYLE++DA+ S DGV  +FAIT +  +I +GL  +G+
Sbjct: 219 FRPPHIEAAGDGEAVGKAGLTLFLYLEVLDAAFSFDGVTGAFAITSDPIVIALGLGLVGS 278

Query: 278 IYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF--LQTIVDIPEIFTGTSSTILI 335
           ++VRS+T+ ++KQ  L++Y YLEHG++++I VL+VIM   ++   ++P+  T +   + I
Sbjct: 279 MFVRSITIFLVKQDALDRYVYLEHGAHWAIGVLAVIMLVSIEPRFEVPDPVTASVGVVFI 338

Query: 336 FLSI-YSSIKNK 346
             ++ +S ++N+
Sbjct: 339 GAALGWSVLRNR 350


>gi|331697380|ref|YP_004333619.1| hypothetical protein Psed_3595 [Pseudonocardia dioxanivorans
           CB1190]
 gi|326952069|gb|AEA25766.1| protein of unknown function DUF475 [Pseudonocardia dioxanivorans
           CB1190]
          Length = 571

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 118/345 (34%), Positives = 197/345 (57%), Gaps = 41/345 (11%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G +  + +C IL V+EISLSF+NA++NA  L++MS+ WQ+ FLT GI+IAVFGMR++FP+
Sbjct: 24  GGVEALVLCAILGVLEISLSFDNAVVNATVLERMSAFWQRIFLTVGIVIAVFGMRLVFPL 83

Query: 101 MIVCIVSTINPIEAMNLAIY-----SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNS 155
           +IV I + +NP+EA  LA+       P  Y  ++++A+  I+ FGG FL+M+ L + F +
Sbjct: 84  LIVGITANLNPVEAFRLALEQRPESDPTSYAHLLNEAYPSIAAFGGMFLLMLFLDWLF-A 142

Query: 156 QNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYG 215
           +  + W+ +LE  ++ + ++  + I + +  +  ++  L  +     V + T  ++ +  
Sbjct: 143 ERDVRWLSWLERPLARIGQLNRLSIILAVVALVVLAGTLAADPAKVLV-AGTLGLVTYLL 201

Query: 216 INFL------------------ESVLSSDSSNN--------------VTHGKHGLNLFLY 243
           +N L                  E+   ++   N                 GK G  LFLY
Sbjct: 202 VNGLGDLFEQAGGADAIASSGEEAGDGAEEGGNGAAAARPGGPSGLAKAAGKAGFFLFLY 261

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           LE++DA+ S DGVI +FAIT +  II +GL  IGA++VRS+T+ ++++G L  Y YLEHG
Sbjct: 262 LEVLDAAFSFDGVIGAFAITTDPIIIALGLGLIGAMFVRSLTVFLVRKGTLADYVYLEHG 321

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS-IKNK 346
           ++++I  LSVI+ +     + E+ TG      I  +  SS I+N+
Sbjct: 322 AHWAIGALSVILLVGIGYHVDEVVTGLIGVAFIGAAFVSSVIRNR 366


>gi|326383858|ref|ZP_08205542.1| hypothetical protein SCNU_13023 [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326197317|gb|EGD54507.1| hypothetical protein SCNU_13023 [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 351

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 121/318 (38%), Positives = 202/318 (63%), Gaps = 14/318 (4%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           L G  + + + +IL V+E+SLSF+NA++NA  L +MS  WQK FLT G++IAVFGMR++F
Sbjct: 22  LYGGTTAMVLTLILGVLEVSLSFDNAVINATVLARMSEFWQKMFLTVGVIIAVFGMRLLF 81

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQD----YLKIISQAHVPISGFGGTFLMMVSLTFFFN 154
           P+MIV + + +NP++A++LA+  P D    Y  I++ AH  I+ FGG FL+M+ L F F 
Sbjct: 82  PLMIVWVTAGLNPVDALDLALNPPTDGSPTYESIVTAAHPQIASFGGMFLLMLFLGFLFE 141

Query: 155 SQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISN-ILPTNEMYSFVSSSTAAIIIF 213
            + +L W+ ++E  +    K++GI + + LS++   +  I P +E  + + S    +I +
Sbjct: 142 DR-ELTWLSWIERPLQRAGKLRGISVVVALSLLVLTATYIAPDDETSTVMISGALGLITY 200

Query: 214 YGINFLESV--LSSDSSNNVTH-----GKHGLNLFLYLEIIDASLSLDGVISSFAITKNF 266
             +N    +  +  +SS   +      G+ G  LFLYLE++DAS S DGVI +FAIT + 
Sbjct: 201 IVVNGFGELFHVEEESSGGPSGLVKATGRAGFFLFLYLEVLDASFSFDGVIGAFAITADP 260

Query: 267 FIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEI 325
            II +GL  IGA++VRS+T+ ++ +G L++Y +LEHG++++I  L++I+      D+PE+
Sbjct: 261 IIIALGLGLIGAMFVRSITIYLVHRGTLSEYVFLEHGAHWAIGALALILLYSLGTDVPEL 320

Query: 326 FTGTSSTILIFLSIYSSI 343
            TG +    I  ++ +S+
Sbjct: 321 VTGLTGLCFILAALATSL 338


>gi|269796668|ref|YP_003316123.1| hypothetical protein Sked_33950 [Sanguibacter keddieii DSM 10542]
 gi|269098853|gb|ACZ23289.1| uncharacterized conserved protein [Sanguibacter keddieii DSM 10542]
          Length = 419

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 121/375 (32%), Positives = 206/375 (54%), Gaps = 62/375 (16%)

Query: 32  GWQF--------THTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F        T  L G    + +C+ILAV+E+SLSF+NA++NAK L++MS  WQK FL
Sbjct: 7   GWSFVITALALVTALLYGGPEALVLCLILAVLEVSLSFDNAVVNAKVLERMSEAWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA-----IYSPQDYLKIISQAHVPISG 138
           T G+LIAVFGMR++FP+++V + + + P+EA+ LA     ++ P  Y  I+++AH  I+ 
Sbjct: 67  TVGVLIAVFGMRLVFPLLVVSVTAGLGPVEAVRLAMAKGDVHEPGSYGYILAEAHPQIAA 126

Query: 139 FGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNE 198
           F G   +++    F  S+ ++ W+ ++E  ++   K+  + + +V +I   +++ L   +
Sbjct: 127 F-GGLFLLMLFLDFVFSEREITWLSWIERPLARAGKLANLSV-VVAAIALVLASELLAED 184

Query: 199 MYSFVSSSTAAIIIFYGINFLES------VLSSDSSNNVTH------------------- 233
            ++ + +    +I +  +N L S      VL  D++ +                      
Sbjct: 185 SHTVLLAGVLGMITYLAVNGLGSLFEDSHVLDDDATADGVQEQEPVARAAAAGGADVSTD 244

Query: 234 ---------------------GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG 272
                                GK G  LFLYLE++DAS S DGVI +FAIT +  II +G
Sbjct: 245 PRAPITSAARPTGPTGLAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALG 304

Query: 273 LT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSS 331
           L  IGA++VRS+T+ ++++G L +Y YLEHG++++I  L+ I+ L     I E+ TG   
Sbjct: 305 LGFIGAMFVRSITIFLVRKGTLAEYVYLEHGAHWAIGALATILLLSIHWHINEVVTGLIG 364

Query: 332 TILIFLSIYSSIKNK 346
            + I  + +SS++++
Sbjct: 365 VVFIGAAFWSSVRHR 379


>gi|215405677|ref|ZP_03417858.1| integral membrane protein [Mycobacterium tuberculosis 02_1987]
 gi|289747465|ref|ZP_06506843.1| integral membrane protein [Mycobacterium tuberculosis 02_1987]
 gi|289687993|gb|EFD55481.1| integral membrane protein [Mycobacterium tuberculosis 02_1987]
          Length = 365

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 108/317 (34%), Positives = 184/317 (58%), Gaps = 31/317 (9%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           E+SLSF+NAI+NA  LQ+MS  WQ+ FLT GILIAVFGMR++FP+ I+   + ++P+ AM
Sbjct: 40  EVSLSFDNAIINAAILQRMSPFWQRMFLTIGILIAVFGMRLVFPLAIIWTTAGLDPVRAM 99

Query: 116 NLAIYSP-----------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHF 164
            LA+  P             Y K+I+ AH  I+ FGG FL+M+ L F  + ++ + W+ +
Sbjct: 100 ELALRPPAHGALEFADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVVHDRD-IKWLKW 158

Query: 165 LEIAMSHLSKIKGIKIFIVLSIIFGISNILPT---NEMYSFVSSSTAAIIIFYGINFLES 221
           +E+  + + ++  + + IV S+   ++  L T   ++  + + +    ++ +  +N +  
Sbjct: 159 IEVPFARIGRLGQVPV-IVASVGLVLAGALLTHSSDQRGTVLIAGLLGMVTYLVVNGISR 217

Query: 222 VLSSDSSNNVTH--------GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
                     T         GK G  LFLYLE++DA+ S DGV  +FAIT +  II +GL
Sbjct: 218 AFRPAGLGEATPGVQARQAAGKAGCALFLYLEVLDAAFSFDGVTGAFAITTDPIIIALGL 277

Query: 274 -TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD----IPEIFTG 328
             +GA++VRS+T+ +++Q  L++Y YLEHG++++I  L++I+ L   +D    +PE  T 
Sbjct: 278 GVVGAMFVRSITICLVRQDTLDRYVYLEHGAHWAIGALAIILLLS--IDHRFAVPEWVTA 335

Query: 329 TSSTILIFLSIYSSIKN 345
           +   + I  +   S++ 
Sbjct: 336 SVGVVFIGAAFTESVRR 352


>gi|15610765|ref|NP_218146.1| hypothetical protein Rv3629c [Mycobacterium tuberculosis H37Rv]
 gi|31794799|ref|NP_857292.1| hypothetical protein Mb3653c [Mycobacterium bovis AF2122/97]
 gi|121639542|ref|YP_979766.1| hypothetical protein BCG_3687c [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|148663492|ref|YP_001285015.1| hypothetical protein MRA_3665 [Mycobacterium tuberculosis H37Ra]
 gi|148824833|ref|YP_001289587.1| integral membrane protein [Mycobacterium tuberculosis F11]
 gi|167968548|ref|ZP_02550825.1| hypothetical protein MtubH3_11131 [Mycobacterium tuberculosis
           H37Ra]
 gi|215413549|ref|ZP_03422221.1| integral membrane protein [Mycobacterium tuberculosis 94_M4241A]
 gi|215424871|ref|ZP_03422790.1| integral membrane protein [Mycobacterium tuberculosis T92]
 gi|215432600|ref|ZP_03430519.1| integral membrane protein [Mycobacterium tuberculosis EAS054]
 gi|215447966|ref|ZP_03434718.1| integral membrane protein [Mycobacterium tuberculosis T85]
 gi|218755407|ref|ZP_03534203.1| integral membrane protein [Mycobacterium tuberculosis GM 1503]
 gi|219559700|ref|ZP_03538776.1| integral membrane protein [Mycobacterium tuberculosis T17]
 gi|224992039|ref|YP_002646728.1| putative integral membrane protein [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|253800667|ref|YP_003033668.1| hypothetical protein TBMG_03666 [Mycobacterium tuberculosis KZN
           1435]
 gi|254233127|ref|ZP_04926453.1| hypothetical protein TBCG_03552 [Mycobacterium tuberculosis C]
 gi|254366181|ref|ZP_04982225.1| conserved integral membrane protein [Mycobacterium tuberculosis
           str. Haarlem]
 gi|254552741|ref|ZP_05143188.1| hypothetical protein Mtube_20215 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260184546|ref|ZP_05762020.1| hypothetical protein MtubCP_00610 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260198668|ref|ZP_05766159.1| hypothetical protein MtubT4_00630 [Mycobacterium tuberculosis T46]
 gi|260202812|ref|ZP_05770303.1| hypothetical protein MtubK8_00645 [Mycobacterium tuberculosis K85]
 gi|289441058|ref|ZP_06430802.1| conserved membrane protein [Mycobacterium tuberculosis T46]
 gi|289445222|ref|ZP_06434966.1| conserved membrane protein [Mycobacterium tuberculosis CPHL_A]
 gi|289555888|ref|ZP_06445098.1| conserved membrane protein [Mycobacterium tuberculosis KZN 605]
 gi|289571865|ref|ZP_06452092.1| conserved membrane protein [Mycobacterium tuberculosis T17]
 gi|289572276|ref|ZP_06452503.1| integral membrane protein [Mycobacterium tuberculosis K85]
 gi|289748143|ref|ZP_06507521.1| conserved membrane protein [Mycobacterium tuberculosis T92]
 gi|289755756|ref|ZP_06515134.1| integral membrane protein [Mycobacterium tuberculosis EAS054]
 gi|289759787|ref|ZP_06519165.1| integral membrane protein [Mycobacterium tuberculosis T85]
 gi|289763805|ref|ZP_06523183.1| conserved integral membrane protein [Mycobacterium tuberculosis GM
           1503]
 gi|294995461|ref|ZP_06801152.1| hypothetical protein Mtub2_13345 [Mycobacterium tuberculosis 210]
 gi|297636301|ref|ZP_06954081.1| hypothetical protein MtubK4_19345 [Mycobacterium tuberculosis KZN
           4207]
 gi|297733295|ref|ZP_06962413.1| hypothetical protein MtubKR_19485 [Mycobacterium tuberculosis KZN
           R506]
 gi|298527105|ref|ZP_07014514.1| conserved integral membrane protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306777982|ref|ZP_07416319.1| conserved membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|306778513|ref|ZP_07416850.1| conserved membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|306786535|ref|ZP_07424857.1| conserved membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|306790902|ref|ZP_07429224.1| conserved membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|306791222|ref|ZP_07429524.1| conserved membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|306796008|ref|ZP_07434310.1| conserved membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|306801255|ref|ZP_07437923.1| conserved membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|306805469|ref|ZP_07442137.1| conserved membrane protein [Mycobacterium tuberculosis SUMu007]
 gi|306969761|ref|ZP_07482422.1| conserved membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|306974100|ref|ZP_07486761.1| conserved membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|307081808|ref|ZP_07490978.1| conserved membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|307086423|ref|ZP_07495536.1| conserved membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|313660626|ref|ZP_07817506.1| hypothetical protein MtubKV_19480 [Mycobacterium tuberculosis KZN
           V2475]
 gi|2105065|emb|CAB08828.1| PROBABLE CONSERVED INTEGRAL MEMBRANE PROTEIN [Mycobacterium
           tuberculosis H37Rv]
 gi|31620396|emb|CAD95839.1| PROBABLE CONSERVED INTEGRAL MEMBRANE PROTEIN [Mycobacterium bovis
           AF2122/97]
 gi|121495190|emb|CAL73676.1| Probable conserved integral membrane protein [Mycobacterium bovis
           BCG str. Pasteur 1173P2]
 gi|124602920|gb|EAY61195.1| hypothetical protein TBCG_03552 [Mycobacterium tuberculosis C]
 gi|134151693|gb|EBA43738.1| conserved integral membrane protein [Mycobacterium tuberculosis
           str. Haarlem]
 gi|148507644|gb|ABQ75453.1| putative conserved integral membrane protein [Mycobacterium
           tuberculosis H37Ra]
 gi|148723360|gb|ABR07985.1| conserved integral membrane protein [Mycobacterium tuberculosis
           F11]
 gi|224775154|dbj|BAH27960.1| putative integral membrane protein [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|253322170|gb|ACT26773.1| conserved membrane protein [Mycobacterium tuberculosis KZN 1435]
 gi|289413977|gb|EFD11217.1| conserved membrane protein [Mycobacterium tuberculosis T46]
 gi|289418180|gb|EFD15381.1| conserved membrane protein [Mycobacterium tuberculosis CPHL_A]
 gi|289440520|gb|EFD23013.1| conserved membrane protein [Mycobacterium tuberculosis KZN 605]
 gi|289536707|gb|EFD41285.1| integral membrane protein [Mycobacterium tuberculosis K85]
 gi|289545619|gb|EFD49267.1| conserved membrane protein [Mycobacterium tuberculosis T17]
 gi|289688730|gb|EFD56159.1| conserved membrane protein [Mycobacterium tuberculosis T92]
 gi|289696343|gb|EFD63772.1| integral membrane protein [Mycobacterium tuberculosis EAS054]
 gi|289711311|gb|EFD75327.1| conserved integral membrane protein [Mycobacterium tuberculosis GM
           1503]
 gi|289715351|gb|EFD79363.1| integral membrane protein [Mycobacterium tuberculosis T85]
 gi|298496899|gb|EFI32193.1| conserved integral membrane protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308213696|gb|EFO73095.1| conserved membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|308328450|gb|EFP17301.1| conserved membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|308328859|gb|EFP17710.1| conserved membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|308332700|gb|EFP21551.1| conserved membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|308340193|gb|EFP29044.1| conserved membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|308343480|gb|EFP32331.1| conserved membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|308347978|gb|EFP36829.1| conserved membrane protein [Mycobacterium tuberculosis SUMu007]
 gi|308351920|gb|EFP40771.1| conserved membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|308352679|gb|EFP41530.1| conserved membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|308356554|gb|EFP45405.1| conserved membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|308360512|gb|EFP49363.1| conserved membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|308364127|gb|EFP52978.1| conserved membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|323717679|gb|EGB26880.1| membrane protein [Mycobacterium tuberculosis CDC1551A]
 gi|326905464|gb|EGE52397.1| conserved membrane protein [Mycobacterium tuberculosis W-148]
 gi|328460397|gb|AEB05820.1| conserved membrane protein [Mycobacterium tuberculosis KZN 4207]
          Length = 365

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 108/317 (34%), Positives = 184/317 (58%), Gaps = 31/317 (9%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           E+SLSF+NAI+NA  LQ+MS  WQ+ FLT GILIAVFGMR++FP+ I+   + ++P+ AM
Sbjct: 40  EVSLSFDNAIINAAILQRMSPFWQRMFLTIGILIAVFGMRLVFPLAIIWTTAGLDPVRAM 99

Query: 116 NLAIYSP-----------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHF 164
            LA+  P             Y K+I+ AH  I+ FGG FL+M+ L F  + ++ + W+ +
Sbjct: 100 ELALRPPAHGALEFADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVVHDRD-IKWLKW 158

Query: 165 LEIAMSHLSKIKGIKIFIVLSIIFGISNILPT---NEMYSFVSSSTAAIIIFYGINFLES 221
           +E+  + + ++  + + IV S+   ++  L T   ++  + + +    ++ +  +N +  
Sbjct: 159 IEVPFARIGRLGQVPV-IVASVGLVLAGALLTHSSDQRGTVLIAGLLGMVTYLVVNGISR 217

Query: 222 VLSSDSSNNVTH--------GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
                     T         GK G  LFLYLE++DA+ S DGV  +FAIT +  II +GL
Sbjct: 218 AFRPAGLGEATPGVQARQAAGKAGCALFLYLEVLDAAFSFDGVTGAFAITTDPIIIALGL 277

Query: 274 -TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD----IPEIFTG 328
             +GA++VRS+T+ +++Q  L++Y YLEHG++++I  L++I+ L   +D    +PE  T 
Sbjct: 278 GVVGAMFVRSITIYLVRQDTLDRYVYLEHGAHWAIGALAIILLLS--IDHRFAVPEWVTA 335

Query: 329 TSSTILIFLSIYSSIKN 345
           +   + I  +   S++ 
Sbjct: 336 SVGVVFIGAAFTESVRR 352


>gi|15843241|ref|NP_338278.1| hypothetical protein MT3731 [Mycobacterium tuberculosis CDC1551]
 gi|13883597|gb|AAK48092.1| conserved hypothetical transmembrane protein [Mycobacterium
           tuberculosis CDC1551]
          Length = 374

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 108/317 (34%), Positives = 184/317 (58%), Gaps = 31/317 (9%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           E+SLSF+NAI+NA  LQ+MS  WQ+ FLT GILIAVFGMR++FP+ I+   + ++P+ AM
Sbjct: 49  EVSLSFDNAIINAAILQRMSPFWQRMFLTIGILIAVFGMRLVFPLAIIWTTAGLDPVRAM 108

Query: 116 NLAIYSP-----------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHF 164
            LA+  P             Y K+I+ AH  I+ FGG FL+M+ L F  + ++ + W+ +
Sbjct: 109 ELALRPPAHGALEFADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVVHDRD-IKWLKW 167

Query: 165 LEIAMSHLSKIKGIKIFIVLSIIFGISNILPT---NEMYSFVSSSTAAIIIFYGINFLES 221
           +E+  + + ++  + + IV S+   ++  L T   ++  + + +    ++ +  +N +  
Sbjct: 168 IEVPFARIGRLGQVPV-IVASVGLVLAGALLTHSSDQRGTVLIAGLLGMVTYLVVNGISR 226

Query: 222 VLSSDSSNNVTH--------GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
                     T         GK G  LFLYLE++DA+ S DGV  +FAIT +  II +GL
Sbjct: 227 AFRPAGLGEATPGVQARQAAGKAGCALFLYLEVLDAAFSFDGVTGAFAITTDPIIIALGL 286

Query: 274 -TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD----IPEIFTG 328
             +GA++VRS+T+ +++Q  L++Y YLEHG++++I  L++I+ L   +D    +PE  T 
Sbjct: 287 GVVGAMFVRSITIYLVRQDTLDRYVYLEHGAHWAIGALAIILLLS--IDHRFAVPEWVTA 344

Query: 329 TSSTILIFLSIYSSIKN 345
           +   + I  +   S++ 
Sbjct: 345 SVGVVFIGAAFTESVRR 361


>gi|208779126|ref|ZP_03246472.1| integral membrane protein [Francisella novicida FTG]
 gi|208744926|gb|EDZ91224.1| integral membrane protein [Francisella novicida FTG]
          Length = 340

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 131/312 (41%), Positives = 196/312 (62%), Gaps = 7/312 (2%)

Query: 40  SGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFP 99
           +  + T+Y  +ILA++EISLSF+NA++NAK L +MS  WQK F+  G+ IAVFGMR++FP
Sbjct: 27  NAPLETIYSVLILAILEISLSFDNAVINAKILGQMSPRWQKIFIYIGLPIAVFGMRLLFP 86

Query: 100 IMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKL 159
           I++V I S IN +  + LA+ +PQ Y  I+  +   I  FGG+FL+MV L FF +     
Sbjct: 87  ILLVSITSGINFMNVVTLALDNPQQYQAILEHSMPYICSFGGSFLLMVFLNFFLSENKGH 146

Query: 160 HWIHFLE--IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY--SFVSSSTAAIIIFYG 215
           HWI  +E  I    +    G   +I+L++I G+  I   N  Y  S   +    I++   
Sbjct: 147 HWIPLIENNIITKKIRNYDG--GYILLAVIIGVITIYYANPNYQGSLAIAFLLGIVVHES 204

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           I  L S+  +   +     ++GL  F+YLEIIDAS S DGVI +FAIT N  II+IGL I
Sbjct: 205 IGLLNSLFDTAKVSTTDVARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGI 264

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA++VRS+T+L +++  L KY YLEHG++Y+I  L+ I+ L+  + IPE F+G+   +++
Sbjct: 265 GAMFVRSLTILFVEKKTLAKYIYLEHGAHYAIGFLAAILLLKIFMHIPEWFSGSIGILVL 324

Query: 336 FLS-IYSSIKNK 346
            L+ I+S I +K
Sbjct: 325 TLAFIHSVISHK 336


>gi|254369516|ref|ZP_04985527.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122470|gb|EDO66605.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 340

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 198/312 (63%), Gaps = 7/312 (2%)

Query: 40  SGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFP 99
           +  + T+Y  +ILA++EISLSF+NA++NAK L +MSS WQK F+  G+ IAVFGMR++FP
Sbjct: 27  NAPLETIYSVLILAILEISLSFDNAVINAKILGQMSSRWQKIFIYIGLPIAVFGMRLLFP 86

Query: 100 IMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKL 159
           I++V + S IN +  + LA+ +PQ Y  I+  +   I  FGG+FL+MV L FF +     
Sbjct: 87  ILLVSVTSGINFMNVVTLALDNPQQYQAILEHSMPYICSFGGSFLLMVFLNFFLSENKGH 146

Query: 160 HWIHFLE--IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY--SFVSSSTAAIIIFYG 215
           HWI  +E  I    +    G   +I+L++I G+  I  ++  Y  S   +    I++   
Sbjct: 147 HWIPLIENNIITKKIRNYDG--GYILLAVIIGVITIYYSDPNYQGSLAIAFLLGIVVHES 204

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           I  L S+  +   +     ++GL  F+YLEIIDAS S DGVI +FAIT N  II+IGL I
Sbjct: 205 IGLLNSLFDTAKVSTTDVARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGI 264

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA++VRS+T+L +++  L KY YLEHG++Y+I  L+ ++ L+  + IPE F+G+   +++
Sbjct: 265 GAMFVRSLTILFVEKKTLAKYIYLEHGAHYAIGFLAAVLLLKIFMHIPEWFSGSIGILVL 324

Query: 336 FLS-IYSSIKNK 346
            L+ I+S I +K
Sbjct: 325 TLAFIHSVISHK 336


>gi|118497338|ref|YP_898388.1| hypothetical protein FTN_0743 [Francisella tularensis subsp.
           novicida U112]
 gi|195536025|ref|ZP_03079032.1| membrane protein, putative [Francisella tularensis subsp. novicida
           FTE]
 gi|118423244|gb|ABK89634.1| conserved hypothetical membrane protein [Francisella novicida U112]
 gi|194372502|gb|EDX27213.1| membrane protein, putative [Francisella tularensis subsp. novicida
           FTE]
          Length = 340

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 131/312 (41%), Positives = 195/312 (62%), Gaps = 7/312 (2%)

Query: 40  SGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFP 99
           +  + T+Y  +ILA++EISLSF+NA++NAK L +MS  WQK F+  G+ IAVFGMR++FP
Sbjct: 27  NAPLETIYSVLILAILEISLSFDNAVINAKILGQMSPRWQKIFIYIGLPIAVFGMRLLFP 86

Query: 100 IMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKL 159
           I++V + S IN +  + LA+ +PQ Y  I+  +   I  FGG+FL+MV L FF +     
Sbjct: 87  ILLVSVTSGINFMNVVTLALDNPQQYQTILEHSMPYICSFGGSFLLMVFLNFFLSENKGH 146

Query: 160 HWIHFLE--IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY--SFVSSSTAAIIIFYG 215
           HWI  +E  I    +    G   +I+ +II G+  I   N  Y  S   +    II+   
Sbjct: 147 HWIPLIENNIITKKIRNYDG--GYILFAIIIGVITIHYANPNYQGSLAIAFLLGIIVHES 204

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           I  L S+  +   +     ++GL  F+YLEIIDAS S DGVI +FAIT N  II+IGL I
Sbjct: 205 IGLLNSLFDTAKVSTTDVARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGI 264

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA++VRS+T+L +++  L KY YLEHG++Y+I  L+ I+ L+  + IPE F+G+   +++
Sbjct: 265 GAMFVRSLTILFVEKKTLAKYIYLEHGAHYAIGFLAAILLLKIFMHIPEWFSGSIGILVL 324

Query: 336 FLS-IYSSIKNK 346
            L+ I+S I +K
Sbjct: 325 TLAFIHSVISHK 336


>gi|56707698|ref|YP_169594.1| hypothetical protein FTT_0569c [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670169|ref|YP_666726.1| hypothetical protein FTF0569c [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134302332|ref|YP_001122301.1| hypothetical protein FTW_1443 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|187931925|ref|YP_001891910.1| hypothetical protein FTM_1275 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|224456769|ref|ZP_03665242.1| hypothetical protein FtultM_03072 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254370204|ref|ZP_04986210.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874511|ref|ZP_05247221.1| integral membrane protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|56604190|emb|CAG45202.1| conserved hypothetical membrane protein [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320502|emb|CAL08585.1| conserved hypothetical membrane protein [Francisella tularensis
           subsp. tularensis FSC198]
 gi|134050109|gb|ABO47180.1| integral membrane protein [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|151568448|gb|EDN34102.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|187712834|gb|ACD31131.1| integral membrane protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254840510|gb|EET18946.1| integral membrane protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158865|gb|ADA78256.1| integral membrane protein [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 340

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 197/312 (63%), Gaps = 7/312 (2%)

Query: 40  SGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFP 99
           +  + T+Y  +ILA++EISLSF+NA++NAK L +MS  WQK F+  G+ IAVFGMR++FP
Sbjct: 27  NAPLETIYSVLILAILEISLSFDNAVINAKILGQMSPRWQKIFIYIGLPIAVFGMRLLFP 86

Query: 100 IMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKL 159
           I++V + S IN +  + LA+ +PQ Y  I+  +   I  FGG+FL+MV L FF +     
Sbjct: 87  ILLVSVTSGINFMNVVTLALDNPQQYQAILEHSMPYICSFGGSFLLMVFLNFFLSENKGH 146

Query: 160 HWIHFLE--IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY--SFVSSSTAAIIIFYG 215
           HWI  +E  I    +    G   +I+L++I G+  I  ++  Y  S   +    I++   
Sbjct: 147 HWIPLIENNIITKKIRNYDG--GYILLAVIIGVITIYYSDPNYQGSLAIAFLLGIVVHES 204

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           I  L S+  +   +     ++GL  F+YLEIIDAS S DGVI +FAIT N  II+IGL I
Sbjct: 205 IGLLNSLFDTAKVSTTDVARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGI 264

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA++VRS+T+L +++  L KY YLEHG++Y+I  L+ ++ L+  + IPE F+G+   +++
Sbjct: 265 GAMFVRSLTILFVEKKTLAKYIYLEHGAHYAIGFLAAVLLLKIFMHIPEWFSGSIGILVL 324

Query: 336 FLS-IYSSIKNK 346
            L+ I+S I +K
Sbjct: 325 TLAFIHSVISHK 336


>gi|115315063|ref|YP_763786.1| hypothetical protein FTH_1307 [Francisella tularensis subsp.
           holarctica OSU18]
 gi|115129962|gb|ABI83149.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
          Length = 340

 Score =  189 bits (481), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 197/312 (63%), Gaps = 7/312 (2%)

Query: 40  SGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFP 99
           +  + T+Y  +ILA++EISLSF+NA++NAK L +MS  WQK F+  G+ IAVFGMR++FP
Sbjct: 27  NAPLETIYSVLILAILEISLSFDNAVINAKILGQMSPRWQKIFIYIGLPIAVFGMRLLFP 86

Query: 100 IMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKL 159
           I++V + S IN +  + LA+ +PQ Y  I+  +   I  FGG+FL+MV L FF +     
Sbjct: 87  ILLVSVTSGINFMNVVTLALDNPQQYQAILEHSMPYICSFGGSFLLMVFLNFFLSENKGH 146

Query: 160 HWIHFLE--IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY--SFVSSSTAAIIIFYG 215
           HWI  +E  I    +    G   +I+L++I G+  I  ++  Y  S   +    I++   
Sbjct: 147 HWIPLIENNIITKKIRNYDG--GYILLAVIIGVITIYYSDPNYQGSLDIAFLLGIVVHES 204

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           I  L S+  +   +     ++GL  F+YLEIIDAS S DGVI +FAIT N  II+IGL I
Sbjct: 205 IGLLNSLFDTAKVSTTDVARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGI 264

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA++VRS+T+L +++  L KY YLEHG++Y+I  L+ I+ L+  + IPE F+G+   +++
Sbjct: 265 GAMFVRSLTILFVEKKTLAKYIYLEHGAHYAIGFLAAILLLKIFMHIPEWFSGSIGILVL 324

Query: 336 FLS-IYSSIKNK 346
            L+ I+S I +K
Sbjct: 325 TLAFIHSVISHK 336


>gi|254819880|ref|ZP_05224881.1| hypothetical protein MintA_08144 [Mycobacterium intracellulare ATCC
           13950]
          Length = 356

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 178/296 (60%), Gaps = 21/296 (7%)

Query: 60  SFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           SF+NAI+NA  L++MS  W++ FLT GI+IAVFGMR++FP++IV   + I P+ AM LA+
Sbjct: 44  SFDNAIINAAILKRMSPFWRQMFLTVGIVIAVFGMRLLFPLVIVWATAGIGPVRAMELAL 103

Query: 120 YSPQD-----------YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIA 168
           + P +           Y K+I  AH  I+ FGG FL+M+ L F F+ ++ + W+ ++E+ 
Sbjct: 104 HPPPNGALEFADGSPSYEKMILSAHPQIAAFGGMFLLMLFLDFVFHDRD-IKWLKWIEVP 162

Query: 169 MSHLSKIKGIKIFIVLSIIFGISNIL--PTNEMYSFVSSSTAAIIIFYGINFLESVLSSD 226
            + + ++  + + +  + +  + + L    +E  + +++    ++ +  +N L       
Sbjct: 163 FARIGRLGQVSVVVAGATLVLVGSRLTHSADERATVLTAGVLGLVTYLVVNGLSRAFRPA 222

Query: 227 SSNNVT----HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVR 281
           +   +T     G+ G  LFLYLE++DA+ S DGV  +FAIT +  +I +GL  IG+++VR
Sbjct: 223 NVEGMTVGEAVGRAGFTLFLYLEVLDAAFSFDGVTGAFAITSDPIVIALGLGLIGSMFVR 282

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF--LQTIVDIPEIFTGTSSTILI 335
           S+T+ ++KQ  L++Y YLEHG++++I  L+VIM   +   + +PE  T +   + I
Sbjct: 283 SITIYLVKQETLDRYVYLEHGAHWAIGALAVIMLGSIDPGLQVPEAVTASVGVVFI 338


>gi|167011127|ref|ZP_02276058.1| hypothetical protein Ftulh_10562 [Francisella tularensis subsp.
           holarctica FSC200]
          Length = 338

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 197/312 (63%), Gaps = 7/312 (2%)

Query: 40  SGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFP 99
           +  + T+Y  +ILA++EISLSF+NA++NAK L +MS  WQK F+  G+ IAVFGMR++FP
Sbjct: 27  NAPLETIYSVLILAILEISLSFDNAVINAKILGQMSPRWQKIFIYIGLPIAVFGMRLLFP 86

Query: 100 IMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKL 159
           I++V + S IN +  + LA+ +PQ Y  I+  +   I  FGG+FL+MV L FF +     
Sbjct: 87  ILLVSVTSGINFMNVVTLALDNPQQYQAILEHSMPYICSFGGSFLLMVFLNFFLSENKGH 146

Query: 160 HWIHFLE--IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY--SFVSSSTAAIIIFYG 215
           HWI  +E  I    +    G   +I+L++I G+  I  ++  Y  S   +    I++   
Sbjct: 147 HWIPLIENNIITKKIRNYDG--GYILLAVIIGVITIYYSDPNYQGSLDIAFLLGIVVHES 204

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           I  L S+  +   +     ++GL  F+YLEIIDAS S DGVI +FAIT N  II+IGL I
Sbjct: 205 IGLLNSLFDTAKVSTTDVARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGI 264

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA++VRS+T+L +++  L KY YLEHG++Y+I  L+ ++ L+  + IPE F+G+   +++
Sbjct: 265 GAMFVRSLTILFVEKKTLAKYIYLEHGAHYAIGFLAAVLLLKIFMHIPEWFSGSIGILVL 324

Query: 336 FLS-IYSSIKNK 346
            L+ I+S I +K
Sbjct: 325 TLAFIHSVISHK 336


>gi|89256645|ref|YP_514007.1| hypothetical protein FTL_1342 [Francisella tularensis subsp.
           holarctica LVS]
 gi|169656661|ref|YP_001428851.2| hypothetical protein FTA_1421 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|254367959|ref|ZP_04983979.1| hypothetical protein FTHG_01262 [Francisella tularensis subsp.
           holarctica 257]
 gi|290953536|ref|ZP_06558157.1| hypothetical protein FtulhU_04179 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313140|ref|ZP_06803822.1| hypothetical protein FtulhU_04164 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89144476|emb|CAJ79781.1| conserved hypothetical membrane protein [Francisella tularensis
           subsp. holarctica LVS]
 gi|134253769|gb|EBA52863.1| hypothetical protein FTHG_01262 [Francisella tularensis subsp.
           holarctica 257]
 gi|164551729|gb|ABU61896.2| putative membrane protein [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 340

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 197/312 (63%), Gaps = 7/312 (2%)

Query: 40  SGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFP 99
           +  + T+Y  +ILA++EISLSF+NA++NAK L +MS  WQK F+  G+ IAVFGMR++FP
Sbjct: 27  NAPLETIYSVLILAILEISLSFDNAVINAKILGQMSPRWQKIFIYIGLPIAVFGMRLLFP 86

Query: 100 IMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKL 159
           I++V + S IN +  + LA+ +PQ Y  I+  +   I  FGG+FL+MV L FF +     
Sbjct: 87  ILLVSVTSGINFMNVVTLALDNPQQYQAILEHSMPYICSFGGSFLLMVFLNFFLSENKGH 146

Query: 160 HWIHFLE--IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY--SFVSSSTAAIIIFYG 215
           HWI  +E  I    +    G   +I+L++I G+  I  ++  Y  S   +    I++   
Sbjct: 147 HWIPLIENNIITKKIRNYDG--GYILLAVIIGVITIYYSDPNYQGSLDIAFLLGIVVHES 204

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           I  L S+  +   +     ++GL  F+YLEIIDAS S DGVI +FAIT N  II+IGL I
Sbjct: 205 IGLLNSLFDTAKVSTTDVARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGI 264

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA++VRS+T+L +++  L KY YLEHG++Y+I  L+ ++ L+  + IPE F+G+   +++
Sbjct: 265 GAMFVRSLTILFVEKKTLAKYIYLEHGAHYAIGFLAAVLLLKIFMHIPEWFSGSIGILVL 324

Query: 336 FLS-IYSSIKNK 346
            L+ I+S I +K
Sbjct: 325 TLAFIHSVISHK 336


>gi|254374161|ref|ZP_04989643.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151571881|gb|EDN37535.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 340

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 196/312 (62%), Gaps = 7/312 (2%)

Query: 40  SGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFP 99
           +  + T+Y  +ILA++EISLSF+NA++NAK L +M   WQK F+  G+ IAVFGMR++FP
Sbjct: 27  NAPLETIYSVLILAILEISLSFDNAVINAKILGQMPPKWQKIFIYIGLPIAVFGMRLLFP 86

Query: 100 IMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKL 159
           I++V + S IN +  + LA+ +PQ Y  I+  +   I  FGG+FL+MV L FF +     
Sbjct: 87  ILLVSVTSGINFMNVVTLALDNPQQYQAILEHSMPYICSFGGSFLLMVFLNFFLSENKGH 146

Query: 160 HWIHFLE--IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY--SFVSSSTAAIIIFYG 215
           HWI  +E  I    +    G   +I+L++I G+  I  ++  Y  S   +    I++   
Sbjct: 147 HWIPLIENNIITKKIRNYDG--GYILLAVIIGVITIYYSDPNYQGSLAIAFLLGIVVHES 204

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           I  L S+  +   +     ++GL  F+YLEIIDAS S DGVI +FAIT N  II+IGL I
Sbjct: 205 IGLLNSLFDTAKVSTTDVARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGI 264

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA++VRS+T+L +++  L KY YLEHG++Y+I  L+ I+ L+  + IPE F+G+   +++
Sbjct: 265 GAMFVRSLTILFVEKKTLAKYIYLEHGAHYAIGFLAAILLLKIFMHIPEWFSGSIGILVL 324

Query: 336 FLS-IYSSIKNK 346
            L+ I+S I +K
Sbjct: 325 TLAFIHSVISHK 336


>gi|15827010|ref|NP_301273.1| hypothetical protein ML0205 [Mycobacterium leprae TN]
 gi|221229488|ref|YP_002502904.1| hypothetical protein MLBr_00205 [Mycobacterium leprae Br4923]
 gi|3097236|emb|CAA18813.1| putative membrane protein [Mycobacterium leprae]
 gi|13092557|emb|CAC29713.1| putative membrane protein [Mycobacterium leprae]
 gi|219932595|emb|CAR70298.1| putative membrane protein [Mycobacterium leprae Br4923]
          Length = 356

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 105/295 (35%), Positives = 180/295 (61%), Gaps = 22/295 (7%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G ++++   I+LA+ E+SLSF+NAI+NA  L++MS  W+K FLT GILIA FGMR+IFP 
Sbjct: 25  GGLASLLPLIVLAIFEVSLSFDNAIINAAILKQMSRFWRKMFLTIGILIAAFGMRLIFPA 84

Query: 101 MIVCIVSTINPIEAMNLAIYSPQD-----------YLKIISQAHVPISGFGGTFLMMVSL 149
           +IV   + ++P+  M+LA++ P +           Y K+I  AH  I+ FGGTFL+M+ L
Sbjct: 85  VIVWATAKLDPVRTMDLALHPPPNHALEFPDGSPSYQKLIMSAHPQIAAFGGTFLLMLFL 144

Query: 150 TFFFNSQNKLHWIHFLEIAMSHLSKIKG---IKIFIVLSIIFGISNILPTNEMYSFVSSS 206
            F F  ++ + W+ ++E   + + ++     + IF+++ I   +++    +E    + + 
Sbjct: 145 DFVFQDRD-IKWLKWIEAPFTRIGRLGPLSVVAIFVLVLIATALTH--SGDERAKVLIAG 201

Query: 207 TAAIIIFYGINFLESVLSSD----SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAI 262
             +++ +  ++ L           +S     G+ GL  FLYLEI+DA+ S DGV  +FAI
Sbjct: 202 LLSLVTYLLVSVLNRAFRPPDIDTASGRRMAGRAGLVRFLYLEILDATFSFDGVTGAFAI 261

Query: 263 TKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFL 316
           T +  II +GL  I ++++RS+T+ ++ Q  L++Y YLE+G++++I  LSV+M L
Sbjct: 262 TSDPVIIALGLGLISSVFIRSITIYLVHQDALDRYVYLEYGAHWAIGALSVMMLL 316


>gi|167626357|ref|YP_001676857.1| hypothetical protein Fphi_0136 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167596358|gb|ABZ86356.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 364

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 199/326 (61%), Gaps = 5/326 (1%)

Query: 25  FLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLT 84
           F+  +GIG       +  + T+Y  +ILA++EISLSF+NA++NAK L +MS  WQK F+ 
Sbjct: 35  FVTLIGIGIAIFIYPTAPLETIYSVLILAILEISLSFDNAVINAKILGQMSQKWQKIFIY 94

Query: 85  WGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFL 144
            G+ IAVFGMR++FPI++V + S IN    + LA+  PQ Y  I+  +   I  FGG+FL
Sbjct: 95  LGLPIAVFGMRLLFPILLVSVTSGINFTNVVTLALNDPQQYQNILEHSMPYICSFGGSFL 154

Query: 145 MMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK-IFIVLSIIFGISNILPTNEMY--S 201
           +MV L FF +     HWI  +E       KI+     +I+ +I  G+  I      Y  S
Sbjct: 155 LMVFLNFFLSENEGHHWIPIVE-NNRITRKIRDYNGGYILFAIFIGLIIIYDAESDYQGS 213

Query: 202 FVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFA 261
              +    I++   I  L S+  +   ++ T  ++G+  F+YLEIIDAS S DGVI +FA
Sbjct: 214 LAIAYFLGIVVHESIGMLNSIFDTSHIDSSTVARNGIMGFIYLEIIDASFSFDGVIGAFA 273

Query: 262 ITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD 321
           IT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I  L+ ++ L+  V 
Sbjct: 274 ITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAIGFLAAVLLLKIFVH 333

Query: 322 IPEIFTGTSSTILIFLS-IYSSIKNK 346
           IPE F+G+   +++F++ I+S I  K
Sbjct: 334 IPEWFSGSIGILVLFIAFIHSVISAK 359


>gi|241668789|ref|ZP_04756367.1| hypothetical protein FphipA2_08475 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254877320|ref|ZP_05250030.1| integral membrane protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254843341|gb|EET21755.1| integral membrane protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 341

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 199/326 (61%), Gaps = 5/326 (1%)

Query: 25  FLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLT 84
           F+  +G+G       +  + T+Y  +ILA++EISLSF+NA++NAK L +MS  WQK F+ 
Sbjct: 12  FVTLIGVGIAIFIYPTAPLETIYSVLILAILEISLSFDNAVINAKILGQMSQKWQKIFIY 71

Query: 85  WGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFL 144
            G+ IAVFGMR++FPI++V + S IN    + LA+  PQ Y  I+  +   I  FGG+FL
Sbjct: 72  LGLPIAVFGMRLLFPILLVSVTSGINFTNVVTLALNDPQQYQNILEHSMPYICSFGGSFL 131

Query: 145 MMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK-IFIVLSIIFGISNILPTNEMY--S 201
           +MV L FF +     HWI  +E       KI+     +I+ +I  G+  I      Y  S
Sbjct: 132 LMVFLNFFLSENEGHHWIPIVE-NNRITRKIRDYNGGYILFAIFIGLIIIYDAEPDYQGS 190

Query: 202 FVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFA 261
              +    I++   I  L S+  +   ++ T  ++G+  F+YLEIIDAS S DGVI +FA
Sbjct: 191 LAIAYFLGIVVHESIGMLNSIFDTSHIDSSTVARNGIMGFIYLEIIDASFSFDGVIGAFA 250

Query: 262 ITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD 321
           IT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I  L+ ++ L+  V 
Sbjct: 251 ITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAIGFLAAVLLLKIFVH 310

Query: 322 IPEIFTGTSSTILIFLS-IYSSIKNK 346
           IPE F+G+   +++F++ I+S I  K
Sbjct: 311 IPEWFSGSIGILVLFIAFIHSVISAK 336


>gi|332184185|gb|AEE26439.1| hypothetical protein FN3523_1136 [Francisella cf. novicida 3523]
          Length = 340

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 193/312 (61%), Gaps = 7/312 (2%)

Query: 40  SGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFP 99
           +  + T+Y  +ILA++EISLSF+NA++NAK L +M   WQK F+  G+ IAVFGMR+IFP
Sbjct: 27  NAPLETIYSVLILAILEISLSFDNAVINAKILGQMPPKWQKIFIYIGLPIAVFGMRLIFP 86

Query: 100 IMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKL 159
           I++V + S IN I  + LA+ +PQ Y  I+  +   I  FGG+FL+MV L FF +     
Sbjct: 87  ILLVSVTSGINFINVITLALDNPQQYQAILEHSMPYICSFGGSFLLMVFLNFFLSENKGH 146

Query: 160 HWIHFLE--IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY--SFVSSSTAAIIIFYG 215
           HWI  +E  +    +    G   +I+ +II G+  I   +  Y  +   +    II+   
Sbjct: 147 HWIPLIENNVVTKKIRNYDG--GYILFAIIIGVITIHYADPNYQGNLAIAFLLGIIVHES 204

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           I  L S+  +   +     ++GL  F+YLEIIDAS S DGVI +FAIT N  II+IGL I
Sbjct: 205 IGLLNSLFDTAKVSTTDVARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGI 264

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA++VRS+T+L +++  L KY YLEHG++Y+I  L+ I+ L+    IPE F+G+   +++
Sbjct: 265 GAMFVRSLTILFVEKKTLAKYIYLEHGAHYAIGFLAAILLLKIFTHIPEWFSGSIGILVL 324

Query: 336 FLS-IYSSIKNK 346
            L+ I+S I +K
Sbjct: 325 SLAFIHSVISHK 336


>gi|256391404|ref|YP_003112968.1| hypothetical protein Caci_2208 [Catenulispora acidiphila DSM 44928]
 gi|256357630|gb|ACU71127.1| protein of unknown function DUF475 [Catenulispora acidiphila DSM
           44928]
          Length = 356

 Score =  186 bits (471), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 99/318 (31%), Positives = 182/318 (57%), Gaps = 15/318 (4%)

Query: 43  ISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMI 102
           I +  +  +LAV+E++LSF+NA++NA  L++    WQ+ FLT G+LIAVFGMR++ P+ +
Sbjct: 26  IRSATVVAMLAVLEVALSFDNAVVNATVLRRFDLRWQRIFLTVGVLIAVFGMRLVIPMAV 85

Query: 103 VCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWI 162
           +  V+  +P   ++ +++ P  Y   I      I+ FGG FL+M+++ FF +  + L W+
Sbjct: 86  LVAVTRQSPFHVLSSSVHDPNGYAHEILGVQPLIAAFGGVFLLMIAMDFFLSGHD-LIWL 144

Query: 163 HFLEIAMSHLSK------IKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGI 216
            F E  ++   +      ++  ++  V+  +F  +    T+       +    +  ++ I
Sbjct: 145 PFFERRLAAFGERFKPLALEAFQVVGVVLFLFVAAGTFATDHPVGVPIAGVIGLATYFTI 204

Query: 217 NFLESV-------LSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFII 269
             L          L+ ++      G+  L LF+YLE++DA+ S D V+  F++T +  + 
Sbjct: 205 KRLSDAAADRSESLADEADETPPQGRQALMLFIYLEVLDATFSFDSVMGGFSVTVDIALF 264

Query: 270 VIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGT 329
            IGL IGA YVRS+T+ ++++  L++Y YLEHG+YYSI VL+V++ ++   D+P+     
Sbjct: 265 TIGLGIGAAYVRSLTVFLVRKKTLDRYVYLEHGAYYSIGVLAVLLLVEIGPDVPDWLASV 324

Query: 330 SSTILIFLS-IYSSIKNK 346
           + T +I  + I+S++K K
Sbjct: 325 AGTSMIVAAFIHSAVKAK 342


>gi|262202415|ref|YP_003273623.1| hypothetical protein Gbro_2489 [Gordonia bronchialis DSM 43247]
 gi|262085762|gb|ACY21730.1| protein of unknown function DUF475 [Gordonia bronchialis DSM 43247]
          Length = 374

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 186/328 (56%), Gaps = 32/328 (9%)

Query: 48  ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVS 107
           +C IL V+E+SLSF+NA++NA  L++MS  WQ+ FLT G++IAVFGMR+ FP+ IV + +
Sbjct: 31  LCAILGVLEVSLSFDNAVINATILERMSEFWQRMFLTVGVIIAVFGMRLFFPLAIVWVTA 90

Query: 108 TINPIEAMNLAIYSPQD-----------YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQ 156
            ++P +A  LA+  P D           Y  I+  A+  I+ FGG   +++    F  S 
Sbjct: 91  GLDPADAFRLAMNPPADGSEYFADGSPSYETILHDANPQIAAFGG-MFLLLLFLNFVLSD 149

Query: 157 NKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFV-SSSTAAIIIFYG 215
            +  W+ + E  ++ L K+  + + I  + +  ++  L   +  + V  +    II +  
Sbjct: 150 RENTWLTWFERPLAALGKLDQLAVVIAAAALLAVAQFLAAEDKRATVLVAGLLGIITYIL 209

Query: 216 INFLESVLSSDSSNN----------------VTH--GKHGLNLFLYLEIIDASLSLDGVI 257
           ++ L S+ +    +                 VT   GK G  LFLYLE++DAS S DGVI
Sbjct: 210 VDGLSSLFAGQGHDRAAGSGDGSGGATGPTAVTRATGKAGFFLFLYLEVLDASFSFDGVI 269

Query: 258 SSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFL 316
            +FAIT +  II +GL  IGA++VRS+T+ ++++G L +Y+YLEHG++++I  L+VI+  
Sbjct: 270 GAFAITPDPIIIALGLGFIGAMFVRSITIFLVRKGTLAEYRYLEHGAHWAIGALAVILLT 329

Query: 317 QTIVDIPEIFTGTSSTILIFLSIYSSIK 344
              V IPEI TG      I  ++ SSI+
Sbjct: 330 SVKVHIPEIITGLIGVAFIGAALLSSIR 357


>gi|41406532|ref|NP_959368.1| hypothetical protein MAP0434 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41394881|gb|AAS02751.1| hypothetical protein MAP_0434 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 359

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 104/314 (33%), Positives = 186/314 (59%), Gaps = 26/314 (8%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           E+SLSF+NA++NA  L++MS  WQ+ FLT GIL+AVFGMR++FP++IV   + ++P+ A+
Sbjct: 37  EVSLSFDNAVINAAVLKQMSRFWQRMFLTIGILVAVFGMRLLFPLLIVWATAGLDPVRAL 96

Query: 116 NLAIYSP-----------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHF 164
            LA+  P             Y K+++ AH  I+ FGG FL+M+ L F    ++ + W+ +
Sbjct: 97  ELALRPPPHGALEFPDGSPSYQKLLTAAHPQIAAFGGIFLLMLFLDFLLIDRD-IKWLKW 155

Query: 165 LEIAMSHLSKIKGIKIFIVLS----IIFGISNILPTNEMYSFVSSSTAAIIIFYGIN--- 217
           +E+  + + ++   ++ +VLS    ++ G      + E  + +++    ++ +  +N   
Sbjct: 156 IEVPFARIGRLG--QVSVVLSGLTLVLVGTGLTHSSQEAVTVLTAGLLGMVAYLVVNGLS 213

Query: 218 --FLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL-T 274
             F  S +          G  GL+LFLYLE++DA+ S DGV  +FAIT +  +IV+GL  
Sbjct: 214 RAFRPSGVGQPQPAGPATGWAGLSLFLYLEVLDAAFSFDGVTGAFAITSDPVVIVLGLGA 273

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF--LQTIVDIPEIFTGTSST 332
           +G+++VRS+T+ ++ Q  L++Y YLEHG++++I  L+VIM   ++  + +PE  T +   
Sbjct: 274 VGSMFVRSITIYLVHQETLDRYVYLEHGAHWAIGALAVIMLASIEPRLTVPEPVTASVGV 333

Query: 333 ILIFLSIYSSIKNK 346
             I  ++  S+  +
Sbjct: 334 FFIGTAVGFSVLRR 347


>gi|240172428|ref|ZP_04751087.1| hypothetical protein MkanA1_24140 [Mycobacterium kansasii ATCC
           12478]
          Length = 355

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 181/309 (58%), Gaps = 23/309 (7%)

Query: 60  SFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           SF+NAI+NA  L++MS  WQ+ FLT GILIAVFGMR++FP+ IV + + ++P+ AM+LA+
Sbjct: 44  SFDNAIINAAILKQMSRFWQQMFLTVGILIAVFGMRLVFPLAIVWVTAGLDPVHAMDLAL 103

Query: 120 YSPQD-----------YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIA 168
             P +           Y K+I  AH  I+ FGG FL+M+ L F F+ ++ + W+ ++E  
Sbjct: 104 NPPPNGALEFPDGSPSYEKLIKAAHPQIAAFGGMFLLMLFLDFVFHDRD-IKWLKWIEAP 162

Query: 169 MSHLSKIKGIKIFIVLSIIFGISNIL--PTNEMYSFVSSSTAAIIIFYGINFLESVLSSD 226
            + + ++  + + +    +  +   L    +E  + + +    ++I+  +N L       
Sbjct: 163 FARVGRLGQVPVVVACVALVLVGTELTHSGDERANVLIAGLLGLVIYLVVNGLSRAFRPP 222

Query: 227 S-----SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYV 280
                       GK G  LFLYLE++DAS S DGV  +FAIT +  II +GL  +GA++V
Sbjct: 223 EAAADVGGAGAVGKAGFTLFLYLEVLDASFSFDGVTGAFAITSDPIIIALGLGLVGAMFV 282

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLS 338
           RS+T+ +++Q  L++Y YLEHG++++I  L+VIM +     + +PE  T +   + I  +
Sbjct: 283 RSITIYLVRQETLDRYVYLEHGAHWAIGALAVIMLISVNHRLQLPEWITASIGVVFIAAA 342

Query: 339 IYSSI-KNK 346
           + +S+ +N+
Sbjct: 343 VTNSVLRNR 351


>gi|254773497|ref|ZP_05215013.1| hypothetical protein MaviaA2_02300 [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 359

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/315 (32%), Positives = 185/315 (58%), Gaps = 27/315 (8%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           E+SLSF+NA++NA  L++MS  WQ+ FLT GIL+AVFGMR++FP++IV   + ++P+ A+
Sbjct: 37  EVSLSFDNAVINAAVLKQMSRFWQRMFLTIGILVAVFGMRLLFPLLIVWATAGLDPVRAL 96

Query: 116 NLAIYSP-----------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHF 164
            LA+  P             Y K+++ AH  I+ FGG FL+M+ L F    ++ + W+ +
Sbjct: 97  ELALRPPPHGALEFPDGSPSYQKLLTAAHPQIAAFGGIFLLMLFLDFLLIDRD-IKWLKW 155

Query: 165 LEIAMSHLSKIKGIKIFIVLS----IIFGISNILPTNEMYSFVSSSTAAIIIFYGIN--- 217
           +E+  + + ++   ++ +VLS    ++ G      + E  + +++    ++ +  +N   
Sbjct: 156 IEVPFARIGRLG--QVSVVLSGLTLVLVGTGLTHSSQEAVTVLTAGLLGMVAYLVVNGLS 213

Query: 218 --FLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKN-FFIIVIGLT 274
             F  S +          G  GL+LFLYLE++DA+ S DGV  +FAIT +   I++    
Sbjct: 214 RAFRPSGVGQPQPAGPATGWAGLSLFLYLEVLDAAFSFDGVTGAFAITSDPVVIVLGLGV 273

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF--LQTIVDIPEIFTGTSST 332
           +GA++VRS+T+ ++ Q  L++Y YLEHG++++I  L+VIM   ++  + +PE  T +   
Sbjct: 274 VGAMFVRSITIYLVHQETLDRYVYLEHGAHWAIGALAVIMLASIEPRLTVPEPVTASVGV 333

Query: 333 ILIFLSI-YSSIKNK 346
             I  ++ +S ++ +
Sbjct: 334 FFIGTAVGFSVLRRR 348


>gi|118463569|ref|YP_879807.1| hypothetical protein MAV_0528 [Mycobacterium avium 104]
 gi|118164856|gb|ABK65753.1| integral membrane protein [Mycobacterium avium 104]
          Length = 362

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/315 (32%), Positives = 185/315 (58%), Gaps = 27/315 (8%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           E+SLSF+NA++NA  L++MS  WQ+ FLT GIL+AVFGMR++FP++IV   + ++P+ A+
Sbjct: 40  EVSLSFDNAVINAAVLKQMSRFWQRMFLTIGILVAVFGMRLLFPLLIVWATAGLDPVRAL 99

Query: 116 NLAIYSP-----------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHF 164
            LA+  P             Y K+++ AH  I+ FGG FL+M+ L F    ++ + W+ +
Sbjct: 100 ELALRPPPHGALEFPDGSPSYQKLLTAAHPQIAAFGGIFLLMLFLDFLLIDRD-IKWLKW 158

Query: 165 LEIAMSHLSKIKGIKIFIVLS----IIFGISNILPTNEMYSFVSSSTAAIIIFYGIN--- 217
           +E+  + + ++   ++ +VLS    ++ G      + E  + +++    ++ +  +N   
Sbjct: 159 IEVPFARIGRLG--QVSVVLSGLTLVLVGTGLTHSSQEAVTVLTAGLLGMVAYLVVNGLS 216

Query: 218 --FLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKN-FFIIVIGLT 274
             F  S +          G  GL+LFLYLE++DA+ S DGV  +FAIT +   I++    
Sbjct: 217 RAFRPSGVGQPQPAGPATGWAGLSLFLYLEVLDAAFSFDGVTGAFAITSDPVVIVLGLGV 276

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF--LQTIVDIPEIFTGTSST 332
           +GA++VRS+T+ ++ Q  L++Y YLEHG++++I  L+VIM   ++  + +PE  T +   
Sbjct: 277 VGAMFVRSITIYLVHQETLDRYVYLEHGAHWAIGALAVIMLASIEPRLTVPEPVTASVGV 336

Query: 333 ILIFLSI-YSSIKNK 346
             I  ++ +S ++ +
Sbjct: 337 FFIGTAVGFSVLRRR 351


>gi|167957390|ref|ZP_02544464.1| hypothetical protein cdiviTM7_01901 [candidate division TM7
           single-cell isolate TM7c]
          Length = 270

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 85/255 (33%), Positives = 149/255 (58%), Gaps = 3/255 (1%)

Query: 92  FGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTF 151
           F +R + PI+IV   S +N  E +++A+ +P+ Y  ++  A   I+ FGG FL+M+ L++
Sbjct: 1   FAVRFLLPIVIVMFASGLNLGEVVSMALNNPERYGHVLHNASPMINAFGGIFLLMIGLSY 60

Query: 152 FFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAII 211
           F +   ++HW+  +E  ++   K +  +  ++L ++  +   +        + SS    +
Sbjct: 61  FVDYNKQIHWVRGVEPWLARAGKFENFRACLILLVMVVLYFTVEEKYKAMILISSVLGTL 120

Query: 212 IFYGINFLESVLSSDSSNNVT--HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFII 269
           +  G+    S+  S SS ++    G      FLYLE++DAS S DGVI +FAIT +  +I
Sbjct: 121 LHIGLELFGSLFGSHSSKDIKLKTGWAAFAAFLYLEVLDASFSFDGVIGAFAITSSVILI 180

Query: 270 VIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTG 328
             GL+ GAI+VRS+T+ +++ G L+KY+YLEHG++++I  L V+M  +   V++PE  TG
Sbjct: 181 TSGLSAGAIWVRSLTIYLMRSGTLSKYRYLEHGAHWAIVALGVMMLFKLFHVELPEWITG 240

Query: 329 TSSTILIFLSIYSSI 343
           +     I L+I SS+
Sbjct: 241 SLGLAFIILAIGSSV 255


>gi|218506716|ref|ZP_03504594.1| hypothetical protein RetlB5_03449 [Rhizobium etli Brasil 5]
          Length = 173

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 113/171 (66%)

Query: 169 MSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSS 228
           M+  + I+GI+I  VL+++   S ++   E   FV  +   ++ F  +  +  +L +   
Sbjct: 1   MARSATIRGIEIAFVLALMLVFSWLIGGEEASIFVHCAIYGLLTFLVVEVVGELLDASQQ 60

Query: 229 NNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLML 288
                 K GL  F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++
Sbjct: 61  TMSAAAKGGLGAFIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLV 120

Query: 289 KQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSI 339
           ++G L +Y+YLEHG++Y+I +L+VIM+ QT+V IPE+ TG     LI LS+
Sbjct: 121 EKGTLAEYRYLEHGAFYAILILAVIMYAQTLVHIPEVITGRGGAALIGLSL 171


>gi|239940903|ref|ZP_04692840.1| hypothetical protein SrosN15_07890 [Streptomyces roseosporus NRRL
           15998]
 gi|291444337|ref|ZP_06583727.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
 gi|291347284|gb|EFE74188.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
          Length = 214

 Score =  146 bits (368), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 109/164 (66%), Gaps = 8/164 (4%)

Query: 32  GWQFTHTLSGTISTVY--------ICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           GW F  T  G ++ ++        I  IL+V+EISLSF+NA++NA  L+KM++ WQK FL
Sbjct: 7   GWSFAVTALGLVAAIFYGGWQAFGIVAILSVLEISLSFDNAVINAGILKKMNAFWQKIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T GILIAVFGMR++FP++IV + + + PIEA++L+   P  Y ++++ AH  I+ FGG F
Sbjct: 67  TIGILIAVFGMRLVFPVVIVAVSAKLGPIEAIDLSFNDPDKYKELVTDAHPSIAAFGGMF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           L+M+ L F F+    +HW+ ++E  ++ L K+  + + + L I+
Sbjct: 127 LLMIFLDFIFDEDRDIHWLRWIERPLAKLGKVDMLSVCVALIIL 170


>gi|218679607|ref|ZP_03527504.1| putative transmembrane protein [Rhizobium etli CIAT 894]
          Length = 134

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 90/111 (81%)

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K GL  F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L 
Sbjct: 6   KGGLGAFIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLA 65

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +Y+YLEHG++Y+I +LSVIM+ QT+V IPE+ TG     LI LS++SSI++
Sbjct: 66  EYRYLEHGAFYAILILSVIMYAQTLVHIPEVITGLGGAALIGLSLWSSIRH 116


>gi|307324700|ref|ZP_07603906.1| protein of unknown function DUF475 [Streptomyces violaceusniger Tu
           4113]
 gi|306889582|gb|EFN20562.1| protein of unknown function DUF475 [Streptomyces violaceusniger Tu
           4113]
          Length = 397

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 111/168 (66%), Gaps = 12/168 (7%)

Query: 10  LIHHFRWAILVTVAGF-LCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           L+  F W+  +TV G  L G+  GW+           + I  IL+++EISLSF+NA++NA
Sbjct: 2   LLKTFGWSFAITVIGLALAGVLWGWK----------GLAIVGILSILEISLSFDNAVINA 51

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + ++P++A++LAI +   Y  +
Sbjct: 52  GILRKMNAFWQKIFLTVGVLIAVFGMRLVFPVIIVAITAKLSPLQAVDLAINNKDKYEHL 111

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
           ++ AH  I+ FGG FL+M+ L F F  ++ + W+ +LE  ++ L ++ 
Sbjct: 112 VTAAHPAIAAFGGMFLLMIFLDFIFEERD-IRWLGWLEKPLAKLGRLD 158



 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 80/114 (70%), Gaps = 1/114 (0%)

Query: 234 GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
           GK    LFLYLE+IDAS S DGVI +FAIT + F + +GL IGA+Y+RS+T+ ++++G L
Sbjct: 265 GKAAFFLFLYLEVIDASFSFDGVIGAFAITNDIFEMALGLGIGAMYIRSLTVFLVRRGTL 324

Query: 294 NKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS-IKNK 346
           + Y YLEHG++Y+I  L+ I+ +    +I E+ TG    +LI  S +SS ++N+
Sbjct: 325 DDYVYLEHGAHYAIGALAGILLVTIKYEINEVITGLVGVVLIGASYWSSVVRNR 378


>gi|218680742|ref|ZP_03528639.1| hypothetical protein RetlC8_18509 [Rhizobium etli CIAT 894]
          Length = 116

 Score =  132 bits (332), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 83/115 (72%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M     + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQPVTHTSSLSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+
Sbjct: 61  FDNAIVNANKLKEMTPVWQKRFLTWGIIIAVFGMRIVFPLAIVAIAAQIGPWDAL 115


>gi|325917232|ref|ZP_08179456.1| hypothetical protein XVE_3449 [Xanthomonas vesicatoria ATCC 35937]
 gi|325536527|gb|EGD08299.1| hypothetical protein XVE_3449 [Xanthomonas vesicatoria ATCC 35937]
          Length = 204

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/187 (36%), Positives = 119/187 (63%), Gaps = 5/187 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLS-GTISTVYICIILAVVEISLSFENAILNA 68
           +   FR ++LV     +C LG+   + HT S G    +++C++L+V+E+SLSF+NA++NA
Sbjct: 1   MFREFRMSLLVAA---VC-LGVAAWWGHTTSMGLWQALWLCLVLSVLEVSLSFDNAVVNA 56

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P+ Y ++
Sbjct: 57  GVLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPERYSQV 116

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + ++++ 
Sbjct: 117 LTDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVTVLL 176

Query: 189 GISNILP 195
                LP
Sbjct: 177 CTKLFLP 183


>gi|218510480|ref|ZP_03508358.1| hypothetical protein RetlB5_25371 [Rhizobium etli Brasil 5]
          Length = 101

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 76/100 (76%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  ++ + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQSATHKSSLGYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+
Sbjct: 61  FDNAIVNANKLKEMTPLWQKRFLTWGIIIAVFGMRIVFPL 100


>gi|325918801|ref|ZP_08180887.1| hypothetical protein XVE_4920 [Xanthomonas vesicatoria ATCC 35937]
 gi|325535001|gb|EGD06911.1| hypothetical protein XVE_4920 [Xanthomonas vesicatoria ATCC 35937]
          Length = 149

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 95/134 (70%), Gaps = 3/134 (2%)

Query: 216 INFLESVLSSDSSNNVTHG---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG 272
           +  ++++  S+ S + + G   + G+  FLYLE++DAS S DGVI +FAIT++  II++G
Sbjct: 6   VGSVDALFESEESEDGSMGPAKRSGIAAFLYLEVLDASFSFDGVIGAFAITRDVVIIMLG 65

Query: 273 LTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSST 332
           L IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I VL++IM + T+  +PE+ TG    
Sbjct: 66  LAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAIGVLAIIMLVGTVYHVPEVLTGLIGV 125

Query: 333 ILIFLSIYSSIKNK 346
             I  S++SSI+ +
Sbjct: 126 AFIAASVWSSIRYR 139


>gi|328676825|gb|AEB27695.1| Integral membrane protein [Francisella cf. novicida Fx1]
          Length = 242

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 91/240 (37%), Positives = 142/240 (59%), Gaps = 7/240 (2%)

Query: 112 IEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAM 169
           +  + LA+ +PQ Y  I+  +   I  FGG+FL+MV L FF +     HWI  +E  I  
Sbjct: 1   MNVVTLALDNPQQYQAILEHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIIT 60

Query: 170 SHLSKIKGIKIFIVLSIIFGISNILPTNEMY--SFVSSSTAAIIIFYGINFLESVLSSDS 227
             +    G   +I+L++I G+  I  ++  Y  S   +    I++   I  L S+  +  
Sbjct: 61  KKIRNYDGG--YILLAVIIGVITIYYSDPNYQGSLAIAFLLGIVVHESIGLLNSLFDTAK 118

Query: 228 SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLM 287
            +     ++GL  F+YLEIIDAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L 
Sbjct: 119 VSTTDVARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILF 178

Query: 288 LKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS-IYSSIKNK 346
           +++  L KY YLEHG++Y+I  L+ I+ L+  + IPE F+G+   +++ L+ I+S I +K
Sbjct: 179 VEKKTLAKYIYLEHGAHYAIGFLAAILLLKIFMHIPEWFSGSIGILVLTLAFIHSVISHK 238


>gi|256784165|ref|ZP_05522596.1| hypothetical protein SlivT_06733 [Streptomyces lividans TK24]
 gi|289768050|ref|ZP_06527428.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289698249|gb|EFD65678.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 256

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 119/235 (50%), Gaps = 34/235 (14%)

Query: 143 FLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNIL--PTNEMY 200
           FL+M+ L F F  ++ + W+ +LE  ++ L K+  + + I L ++  +S I        +
Sbjct: 2   FLLMIFLDFIFEDRD-IKWLAWLERPLAKLGKVDMLSVCIALVVLL-VSAITFGAHAHQH 59

Query: 201 SFVSSSTAAIIIFYGI-------------NFLESVL-----------------SSDSSNN 230
               +  A  ++  GI              + E  L                     S  
Sbjct: 60  GGAHADKAETVLLAGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEEEAARTGKPKSAV 119

Query: 231 VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQ 290
              GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++Q
Sbjct: 120 RLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQ 179

Query: 291 GILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           G L+ Y YLEHG++Y+I  L+VI+ +    +I EI TG     LI  S +SS++ 
Sbjct: 180 GTLDDYVYLEHGAHYAIVALAVILLVTIQYEIHEIITGLVGVALIGWSFFSSVRR 234


>gi|169839791|ref|ZP_02872979.1| hypothetical protein cdivTM_22142 [candidate division TM7
           single-cell isolate TM7a]
          Length = 161

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 89/142 (62%), Gaps = 3/142 (2%)

Query: 205 SSTAAIIIFYGINFLESVLSSDSSNNVT--HGKHGLNLFLYLEIIDASLSLDGVISSFAI 262
           SS    ++  G+    S+  S SS ++    G      FLYLE++DAS S DGVI +FAI
Sbjct: 5   SSVLGTLLHIGLELFGSLFGSHSSKDIKLKTGWAAFAAFLYLEVLDASFSFDGVIGAFAI 64

Query: 263 TKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VD 321
           T +  +I  GL+ GAI+VRS+T+ +++ G L+KY+YLEHG++++I  L V+M  +   V+
Sbjct: 65  TSSVILITSGLSAGAIWVRSLTIYLMRSGTLSKYRYLEHGAHWAIVALGVMMLFKLFHVE 124

Query: 322 IPEIFTGTSSTILIFLSIYSSI 343
           +PE  TG+     I L+I SS+
Sbjct: 125 LPEWITGSLGLAFIILAIGSSV 146


>gi|126178296|ref|YP_001046261.1| hypothetical protein Memar_0346 [Methanoculleus marisnigri JR1]
 gi|125861090|gb|ABN56279.1| protein of unknown function DUF475 [Methanoculleus marisnigri JR1]
          Length = 309

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 91/306 (29%), Positives = 154/306 (50%), Gaps = 28/306 (9%)

Query: 52  LAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVS-TIN 110
           L+V EI  S +NAI+NA  L  M    ++ FL WG++ AVF +R + P +IV   + ++ 
Sbjct: 13  LSVFEIVSSIDNAIINADVLATMGEKARRWFLLWGLIAAVFVVRGLLPWLIVWATNPSLG 72

Query: 111 PIEAMNLAIYSPQDYLKIISQAHVPISG-FGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM 169
           P++A+ LA +S    +    +   PI   FGGTFL+ +    FF      HW+   E   
Sbjct: 73  PVDAL-LATFSSDPAVTAAIEESAPILLIFGGTFLVFL----FF------HWLFAEEKTC 121

Query: 170 SHLSKI----KGIKIFIVLSIIFGI--SNILPTNEMYSFVS--SSTAAIIIFYGINFLES 221
              S+     + +  + V+S++  I     L  N M  F +   STA    F+ ++    
Sbjct: 122 GLRSERFFSRQSVWFYAVVSVLLAILVWFALQINVMMGFAAVLGSTA----FFIVHGFRQ 177

Query: 222 VLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
                 +     G   L+   YLE++DA+ S+DGVI +FA T +  +I+IG  IGA+ VR
Sbjct: 178 NAEVQEARLRRPGMSDLSKIAYLEVLDATFSIDGVIGAFAFTLSVPLILIGNGIGAVVVR 237

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIY 340
            +T+  + +  +  Y +L++G+ YSI VL  IM   +    IP   +  ++  ++   +Y
Sbjct: 238 ELTVRGVDR--IRSYCFLKNGAMYSILVLGTIMLADSFGFHIPAWLSPVATFAIVGYFLY 295

Query: 341 SSIKNK 346
            S++ +
Sbjct: 296 RSVQEQ 301


>gi|307353278|ref|YP_003894329.1| hypothetical protein Mpet_1125 [Methanoplanus petrolearius DSM
           11571]
 gi|307156511|gb|ADN35891.1| protein of unknown function DUF475 [Methanoplanus petrolearius DSM
           11571]
          Length = 308

 Score = 99.8 bits (247), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 88/282 (31%), Positives = 144/282 (51%), Gaps = 26/282 (9%)

Query: 52  LAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVS-TIN 110
           L + EI  S +NAI+NA+ L  M    ++ FL WG+L+AVF +R + P +IV I + ++ 
Sbjct: 13  LCLFEIISSIDNAIINAEVLSTMEEKARRWFLVWGLLLAVFVIRGLLPWLIVWITTPSLG 72

Query: 111 PIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE---- 166
           P+EA+     S    ++ I  +   +   GGTFL+ +    FF      HW+   E    
Sbjct: 73  PVEALFATFSSDPAVVEAIETSSPILLIGGGTFLIFL----FF------HWLFVDEKNFG 122

Query: 167 IAMSHLSKIKGIKIFIVLSIIFG--ISNILPTNEMYSF--VSSSTAAIIIFYGINFLESV 222
           +        + +  F V+SI+    +   +  + M  F  V  STA    F+ ++     
Sbjct: 123 LPGERFFSRQSVWFFAVVSILLCSIVWFAMQVSPMMGFGAVVGSTA----FFIVHGFRQN 178

Query: 223 LSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRS 282
                +         ++   YLE+IDA+ S+DGVI +FA T    +I+IG +IGA  VR 
Sbjct: 179 AEVQEARLKDRKISDISKIFYLEVIDATFSIDGVIGAFAFTLAVPLILIGNSIGAFVVRE 238

Query: 283 MTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIP 323
           +T+  +++  +  Y++L++G+ YSIFVL  IM L +  V IP
Sbjct: 239 LTIRNIEK--IKCYQFLKNGAMYSIFVLGTIMILDSFGVHIP 278


>gi|124486447|ref|YP_001031063.1| hypothetical protein Mlab_1635 [Methanocorpusculum labreanum Z]
 gi|124363988|gb|ABN07796.1| protein of unknown function DUF475 [Methanocorpusculum labreanum Z]
          Length = 323

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 139/282 (49%), Gaps = 23/282 (8%)

Query: 45  TVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR-FLTWGILIAVFGMRIIFPIMIV 103
            V + I L   E   S +NAI+NA  L  M + W +R FLTWG++IAVFG+R + P  I+
Sbjct: 6   AVVVIIGLVAFETVASIDNAIINADILSTMKA-WARRWFLTWGLIIAVFGVRGLLPWAII 64

Query: 104 -CIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGF-GGTFLMMVSLTFFFNSQNKLHW 161
                ++ PI A+  A +S  +   +  +   P     GG F++ + L +F   Q     
Sbjct: 65  WASAPSLGPIGALT-ATFSGDETAALAIEHSAPFLLLAGGVFMIFLFLHWFMVEQKNC-- 121

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVS----SSTAAIIIFYGIN 217
                I    L+  K    F   + I  ++ +  T ++  F++    + +A   I  G  
Sbjct: 122 -----IVPGELAFSKTGPWFYAAAAIILLAIVYFTVQINPFLAVAAVAGSAIFFIMQGFR 176

Query: 218 FLESVLSSDSSN-----NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG 272
                 S +        N T  K  ++  + LE+IDA+ S+DGV+ +FA T +  +I+IG
Sbjct: 177 LFADAKSLELETKTVDVNETGHKSDISKLMLLEVIDATFSIDGVVGAFAFTMSVPLILIG 236

Query: 273 LTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIM 314
             IGA+ VR +T+  +    + KY YL++G+ YSIF L +IM
Sbjct: 237 NGIGALVVRELTIRNVDS--IRKYAYLKNGAMYSIFCLGIIM 276


>gi|300853571|ref|YP_003778555.1| hypothetical protein CLJU_c03710 [Clostridium ljungdahlii DSM
           13528]
 gi|300433686|gb|ADK13453.1| putative membrane protein [Clostridium ljungdahlii DSM 13528]
          Length = 308

 Score = 96.3 bits (238), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 144/280 (51%), Gaps = 26/280 (9%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVS-TINPIEA 114
           E+  S +NA++NA+ L  MS   +K FL +GIL AVF +R + P +IV   + ++ PI A
Sbjct: 17  EVVSSIDNAVINAEVLSTMSEKAKKWFLLYGILFAVFIVRGLLPWVIVWATNRSLGPIGA 76

Query: 115 MNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWI----HFLEIAMS 170
           +  A +S   ++    +   PI   GG     V L F F     LHW+      L +A  
Sbjct: 77  LT-ATFSNDPHIIESIEYSTPILMLGGG----VFLVFLF-----LHWLFIEDKHLGLATE 126

Query: 171 HLSKIKGIKIFIVLSIIF-GISNIL----PTNEMYSFVSSSTAAIIIFYGINFLESVLSS 225
                 G   + V+S+I  GI  +     P   + + + SS   I   +  N  E+    
Sbjct: 127 EFFLKNGTWFYAVVSVILVGIVAVALKYNPVLALSAVIGSSAFFITDGFKKNAEEN---E 183

Query: 226 DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTL 285
               N T     ++  LYLEIID + S+DGV+ +FA T +  +I++G  +GAI VR +T+
Sbjct: 184 KKLLNNTSEMSDISKILYLEIIDTTFSIDGVLGAFAFTMSIPLIILGNGLGAIVVRKITM 243

Query: 286 LMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPE 324
             +++  + KY YL++G+ YSI  L ++M L+   V++PE
Sbjct: 244 GSIEK--IKKYIYLKNGAMYSILCLGIVMVLEGFHVEVPE 281


>gi|300853967|ref|YP_003778951.1| hypothetical protein CLJU_c07810 [Clostridium ljungdahlii DSM
           13528]
 gi|300434082|gb|ADK13849.1| putative membrane protein [Clostridium ljungdahlii DSM 13528]
          Length = 308

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/280 (31%), Positives = 146/280 (52%), Gaps = 26/280 (9%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVS-TINPIEA 114
           E+  S +NA++NA+ L  MS   +K FL +GIL AVF +R + P  IV   + ++ PI A
Sbjct: 17  EVVSSIDNAVINAEVLSTMSEKAKKWFLLYGILFAVFIVRGLLPWAIVWATNQSLGPIGA 76

Query: 115 MNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWI----HFLEIAMS 170
           +  A +S   ++    +   PI   GG     V L F F     LHW+      L +A  
Sbjct: 77  LT-ATFSNDPHIIESIEYSTPILMLGGG----VFLVFLF-----LHWLFIEDKHLGLATE 126

Query: 171 HLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAI---IIFYGINFLESVLSSDS 227
                 G   + V+S+I  +  I+     Y+ V + +A I     F    F ++   ++ 
Sbjct: 127 EFFLKNGTWFYAVVSVI--LVGIVAAALKYNPVLALSAVIGSSAFFITDGFKKNAEENEK 184

Query: 228 S--NNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTL 285
              +N T     ++  LYLEIID + S+DGV+ +FA T +  +I++G  IGAI VR +T+
Sbjct: 185 KLIDN-TSEMSDISKILYLEIIDTTFSIDGVLGAFAFTMSIPLIILGNGIGAIVVRKITM 243

Query: 286 LMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPE 324
             +++  + KY YL++G+ YS+  L ++M L+   V++PE
Sbjct: 244 GSIEK--IKKYIYLKNGAMYSVLCLGIVMVLEGFHVEVPE 281


>gi|154151171|ref|YP_001404789.1| hypothetical protein Mboo_1629 [Candidatus Methanoregula boonei
           6A8]
 gi|153999723|gb|ABS56146.1| protein of unknown function DUF475 [Methanoregula boonei 6A8]
          Length = 307

 Score = 92.8 bits (229), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 132/265 (49%), Gaps = 27/265 (10%)

Query: 52  LAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIV-CIVSTIN 110
           L + E   S +NAI+NA+ L  MS   ++ FL WG+L AVF +R + P +IV     ++ 
Sbjct: 13  LCLFETITSIDNAIINAEVLSTMSQKARRWFLIWGLLFAVFVIRGVLPWLIVWASAPSLG 72

Query: 111 PIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE---- 166
           P+ A+     S    +  I+QA   +   GGTFL+     F F     LHWI FLE    
Sbjct: 73  PVGALTATFSSDPAVVAAIAQAAPILLVGGGTFLI-----FLF-----LHWI-FLEEKEY 121

Query: 167 -IAMSHLSKIKGIKIFIVLSIIFG--ISNILPTNEMYSF--VSSSTAAIIIFYGINFLES 221
            I        KG+  F V+SI     +   +  N M +F  V  S+A    F+ ++    
Sbjct: 122 GICGERYIATKGVWFFAVVSIFLAGLVWLAISKNPMMAFGAVVGSSA----FFIVHGFRQ 177

Query: 222 VLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
                    V+     ++   YLEIIDA+ S+DGV+ +FA T    +I+IG  IGA+ VR
Sbjct: 178 NAEEHERKMVSGDLSDISKIFYLEIIDATFSIDGVMGAFAFTMAVPLIIIGNGIGALIVR 237

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYS 306
            +T+  +    +  Y+YL++G+ YS
Sbjct: 238 ELTVRNVDT--IRNYRYLKNGAMYS 260


>gi|219852709|ref|YP_002467141.1| hypothetical protein Mpal_2120 [Methanosphaerula palustris E1-9c]
 gi|219546968|gb|ACL17418.1| Integral membrane protein TerC [Methanosphaerula palustris E1-9c]
          Length = 308

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 90/301 (29%), Positives = 154/301 (51%), Gaps = 22/301 (7%)

Query: 52  LAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVS-TIN 110
           L + E   S +NAI+NA+ L  M    ++ FL WG+LIAVF +R + P +IV + + ++ 
Sbjct: 13  LVLFETVSSIDNAIINAEVLSSMGEKARRWFLVWGLLIAVFVVRGLLPWLIVWMATPSLG 72

Query: 111 PIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMS 170
           PI+A      S    L+ I ++  PI    G   ++     +   ++K    H+  +   
Sbjct: 73  PIQAFTAMFSSDPMVLEAIERSS-PILLIAGGTFLLFLFFNWLFVEHK----HY-GLRGE 126

Query: 171 HLSKIKGIKIFIVLSIIF-GISNI-LPTNEMYSF--VSSSTAAIIIFYGINFLESVLSSD 226
              + KG+  + V+S++  GI    L T+ M +F  V  STA    F+ +N  +   +++
Sbjct: 127 RFIQSKGVWFYAVISLLLTGIVWFALKTDPMMAFGAVVGSTA----FFIVNGFKQ--NAE 180

Query: 227 SSNNVTHGKH--GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMT 284
                  G H   L+   YLE+IDA+ S+DGV+ +FA T    +I+IG  IGA+ VR +T
Sbjct: 181 VQEKRLSGGHLTDLSKLFYLEVIDATFSIDGVVGAFAFTLLVPLIMIGNGIGALVVRELT 240

Query: 285 LLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSI 343
           +  + +  + +Y  L++G+ YSI  L  IM L    +  P   +   + I++   +Y SI
Sbjct: 241 IGNIDR--IRRYPLLKNGAMYSILFLGGIMVLDAFGIKSPSWLSPLITFIVVGFFLYRSI 298

Query: 344 K 344
           +
Sbjct: 299 Q 299


>gi|88602334|ref|YP_502512.1| hypothetical protein Mhun_1043 [Methanospirillum hungatei JF-1]
 gi|88187796|gb|ABD40793.1| protein of unknown function DUF475 [Methanospirillum hungatei JF-1]
          Length = 294

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 144/284 (50%), Gaps = 36/284 (12%)

Query: 56  EISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           EI  S +NAI+NA+ L  M   +++ FL WGIL AVF +R + P+++V   +    +   
Sbjct: 3   EIICSIDNAIINAEVLGSMQPKYRRWFLLWGILFAVFLVRGLLPLLLVWFSTPELTLWEA 62

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGG-TFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSK 174
             A++S    +K   +   PI   GG TFL+ +    FF      HW+ FLE     L  
Sbjct: 63  FTAMFSDNPDIKEAIETSSPILLIGGGTFLIFL----FF------HWL-FLEEKHFGLPG 111

Query: 175 I-----KGIKIFIVLSII------FGISNILPTNEMYSF--VSSSTAAIIIFYGINFLES 221
                 KG+  + V+SI+      F I      N M +F  V  STA    F+ ++    
Sbjct: 112 ERYFFSKGVWFYAVVSILLMAIVWFAIEK----NAMMAFGAVVGSTA----FFIVHGFRQ 163

Query: 222 VLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
                    +      ++  LYLE+IDA+ S+DGV+ +FA T +  +I+IG  +GAI VR
Sbjct: 164 NAELQEQKLINGDMSDISKILYLEVIDATFSIDGVLGAFAFTMSVPLILIGNALGAIAVR 223

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPE 324
            +T+  + +  + KY++L++G+ YSI  L +IM + +    IPE
Sbjct: 224 QITVGNIDR--IKKYRFLKNGAMYSILCLGIIMLIDSFGFHIPE 265


>gi|218674533|ref|ZP_03524202.1| hypothetical protein RetlG_25252 [Rhizobium etli GR56]
          Length = 83

 Score = 89.4 bits (220), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (69%)

Query: 1  MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
          M   + + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1  MNQPATHESSLGYFRWAFIVTALGLILGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 60

Query: 61 FENAILNAKNLQKMSSIWQKRFL 83
          F+NAI+NA  L++M+ +WQKRFL
Sbjct: 61 FDNAIVNANKLKEMTPLWQKRFL 83


>gi|85858091|ref|YP_460293.1| hypothetical protein SYN_01442 [Syntrophus aciditrophicus SB]
 gi|85721182|gb|ABC76125.1| hypothetical membrane protein [Syntrophus aciditrophicus SB]
          Length = 313

 Score = 86.3 bits (212), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 142/280 (50%), Gaps = 15/280 (5%)

Query: 43  ISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMI 102
           IST+ I   L + E+  S +NAI+NA  L+ MS  ++K FL WGIL AVF +R + P +I
Sbjct: 3   ISTLIIIFGLCLFEVICSVDNAIINATVLKTMSVKYRKIFLFWGILFAVFVVRGMLPFVI 62

Query: 103 VCIVSTINP----IEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNK 158
           V      NP    +E       S     + + ++   +   GG +L+ V+L++ F  + K
Sbjct: 63  VW---ATNPALSLVEVFKACFSSYGGAAEAMEKSKPLLLLGGGVYLLYVALSWLFLEEKK 119

Query: 159 LHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINF 218
             ++        H    +G+  + ++S++  +   +          ++T  +  F+  + 
Sbjct: 120 YAFLA------EHFIHRQGVWFYAIVSLLTTLLVYVSLRIDPILALAATIGVSAFFITDG 173

Query: 219 LESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
            +          +T      +  LYLE++D S S+DGVI +FA T +  +I++G  +GA 
Sbjct: 174 FKKNAEEKEKELLTGNLSAWSKILYLEVLDTSFSIDGVIGAFAFTMSVPLIILGNGLGAF 233

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
            VR +T+  +   ++ +Y YL++G+ YSI VL V+M L++
Sbjct: 234 VVRELTIKGID--VIARYAYLKNGAMYSIGVLGVLMILES 271


>gi|255596348|ref|XP_002536514.1| conserved hypothetical protein [Ricinus communis]
 gi|223519419|gb|EEF25867.1| conserved hypothetical protein [Ricinus communis]
          Length = 120

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 60/84 (71%)

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            LYLE++DAS S DGVI +FA+T N  II +GL IGA++VRS+TL +++ G L +Y++LE
Sbjct: 3   LLYLELLDASFSFDGVIGAFAVTNNILIITLGLGIGAMFVRSITLHLVETGKLAEYRFLE 62

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPE 324
           H ++++I  L+ +       DIP+
Sbjct: 63  HSAFWAIGALAALTISGVHWDIPD 86


>gi|262340884|ref|YP_003283739.1| integral membrane protein TerC family [Blattabacterium sp.
           (Blattella germanica) str. Bge]
 gi|262272221|gb|ACY40129.1| integral membrane protein TerC family [Blattabacterium sp.
           (Blattella germanica) str. Bge]
          Length = 235

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 62/104 (59%), Gaps = 4/104 (3%)

Query: 211 IIFYGIN-FL-ESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFI 268
           +IF G N FL ++  SS +S N+        + L++EI+D S S+D + +S A+++NF +
Sbjct: 90  LIFVGFNHFLTKNNFSSKNSKNIKRKDSFWKIVLFIEIMDLSFSIDNIFASVALSENFLL 149

Query: 269 IVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSV 312
           I +G+ IG + +R +    ++  ++ K+  L++ ++  I VL +
Sbjct: 150 IFLGVFIGILSMRLIAQFFIQ--LMEKFPELKNSAFLIIIVLGI 191


>gi|298490892|ref|YP_003721069.1| Integral membrane protein TerC ['Nostoc azollae' 0708]
 gi|298232810|gb|ADI63946.1| Integral membrane protein TerC ['Nostoc azollae' 0708]
          Length = 239

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 56/101 (55%), Gaps = 5/101 (4%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S +   N  HG    +L+  + +I   D + SLD V ++ A+++ +++++ G TIG + +
Sbjct: 100 SQEEEENHHHGPRFNSLWQAIPVIAFTDLAFSLDSVTTAIAVSQEWWLVITGTTIGIVAL 159

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD 321
           R M  L ++   L++Y+ LE   Y ++  + + + L+ I D
Sbjct: 160 RFMAGLFIRW--LDEYENLEDAGYITVAFVGLRLLLKVIND 198


>gi|75909631|ref|YP_323927.1| hypothetical protein Ava_3425 [Anabaena variabilis ATCC 29413]
 gi|75703356|gb|ABA23032.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 240

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 65/118 (55%), Gaps = 7/118 (5%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S ++ ++  HG    NL+  + +I   D + SLD V ++ A+++  ++++ G TIG   +
Sbjct: 101 SEETEDDHHHGPRFANLWQAIPVIAFTDLAFSLDSVTTAIAVSQETWLVITGTTIGIFTL 160

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD--IPEIFTGTSSTILIF 336
           R M  L ++   L++++ LE   Y ++ ++ + + L+ + D  +P  +   ++  LIF
Sbjct: 161 RFMAGLFIRW--LDEFENLEDAGYITVALVGLRLLLKVVNDDFVPPEWLMIAAIALIF 216


>gi|218458418|ref|ZP_03498509.1| hypothetical protein RetlK5_02743 [Rhizobium etli Kim 5]
          Length = 56

 Score = 46.6 bits (109), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 31/48 (64%)

Query: 9  SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVE 56
          S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+E
Sbjct: 9  SSLSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICAVLAVLE 56


>gi|67922090|ref|ZP_00515605.1| Integral membrane protein TerC [Crocosphaera watsonii WH 8501]
 gi|67855990|gb|EAM51234.1| Integral membrane protein TerC [Crocosphaera watsonii WH 8501]
          Length = 250

 Score = 45.8 bits (107), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 5/87 (5%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S D+  +  HG    +L+  + +I   D + SLD V ++ A+    ++I++G TIG I +
Sbjct: 100 SQDNEEDNHHGPEFASLWQAIPLIAVTDLAFSLDSVTTAIALADEIWLILLGGTIGVITL 159

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSI 307
           R +  L ++   LN+Y YLE   + ++
Sbjct: 160 RFLAELFIRW--LNEYTYLEDAGFITV 184


>gi|17230895|ref|NP_487443.1| hypothetical protein all3403 [Nostoc sp. PCC 7120]
 gi|17132498|dbj|BAB75102.1| all3403 [Nostoc sp. PCC 7120]
          Length = 240

 Score = 45.8 bits (107), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 64/118 (54%), Gaps = 7/118 (5%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S ++ +   HG    NL+  + +I   D + SLD V ++ A+++  ++++ G TIG   +
Sbjct: 101 SEETEDEHHHGPRFANLWQAIPVIAFTDLAFSLDSVTTAIAVSQETWLVITGTTIGIFTL 160

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD--IPEIFTGTSSTILIF 336
           R M  L ++   L++++ LE   Y ++ ++ + + L+ + D  +P  +   ++  LIF
Sbjct: 161 RFMAGLFIRW--LDEFENLEDAGYITVSLVGLRLLLKVVNDDFVPPEWLMIAAIALIF 216


>gi|126661430|ref|ZP_01732489.1| conserved membrane protein TerC [Cyanothece sp. CCY0110]
 gi|126617287|gb|EAZ88097.1| conserved membrane protein TerC [Cyanothece sp. CCY0110]
          Length = 215

 Score = 45.1 bits (105), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 70/134 (52%), Gaps = 6/134 (4%)

Query: 208 AAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFF 267
           AAI +FY +      LSSDS  N    K  ++  + +   D + SLD V ++  I+  F 
Sbjct: 75  AAIYLFYLVFDYFWDLSSDS--NFKTKKSLMSAIVAVVFTDLAFSLDSVSAAVGISDRFL 132

Query: 268 IIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFT 327
           II+ G  IG + +R +T L   Q  + K+ YLE   Y +I ++++ + ++ I   P +  
Sbjct: 133 IIIAGCGIGVLALRFLTELF--QVWMEKFTYLELSGYLAIGLVAIKLLIEIIY--PSLVL 188

Query: 328 GTSSTILIFLSIYS 341
             S  +L+ +SI+S
Sbjct: 189 PESIELLMVISIFS 202


>gi|282900261|ref|ZP_06308212.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194766|gb|EFA69712.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 245

 Score = 44.3 bits (103), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 57/99 (57%), Gaps = 5/99 (5%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S + +++  HG    +L+  + +I   D + SLD V ++ A+++  ++++IG TIG I +
Sbjct: 101 SQEKADHHHHGPRFKSLWQAIPVIAFTDLAFSLDSVTTAIAVSQETWLVLIGTTIGVITL 160

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI 319
           R M  L ++   L++Y+ L    Y ++ ++ + + L+ +
Sbjct: 161 RFMAELFIRW--LDEYENLADAGYITVALVGLRLLLKVL 197


>gi|167957193|ref|ZP_02544267.1| integral membrane protein [candidate division TM7 single-cell
          isolate TM7c]
          Length = 75

 Score = 44.3 bits (103), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 47/76 (61%), Gaps = 9/76 (11%)

Query: 9  SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
          +L+  FR++I +TV   L GL   WQ +         +++  +L ++E++ SF+NA++N+
Sbjct: 7  NLLGIFRFSIFLTVI--LAGLTF-WQLSW------QGLWLFFVLLILEVTFSFDNAVVNS 57

Query: 69 KNLQKMSSIWQKRFLT 84
          + L  MS IWQ+ FLT
Sbjct: 58 RTLASMSLIWQRIFLT 73


>gi|119510059|ref|ZP_01629199.1| hypothetical protein N9414_19592 [Nodularia spumigena CCY9414]
 gi|119465246|gb|EAW46143.1| hypothetical protein N9414_19592 [Nodularia spumigena CCY9414]
          Length = 243

 Score = 43.9 bits (102), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 56/99 (56%), Gaps = 5/99 (5%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S ++ ++  HG    +L   + +I   D + SLD V ++ A+++  ++++ G TIG I +
Sbjct: 101 SEEAKDDHHHGPRFNSLLQAIPVIAFTDLAFSLDSVTTAIAVSQEKWLVLTGATIGIITL 160

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI 319
           R MT L ++   L+++K LE   Y ++  + + + ++ I
Sbjct: 161 RFMTGLFIRW--LDEFKNLEDAGYITVAFVGLRLLMRVI 197


>gi|257062202|ref|YP_003140090.1| integral membrane protein TerC [Cyanothece sp. PCC 8802]
 gi|256592368|gb|ACV03255.1| Integral membrane protein TerC [Cyanothece sp. PCC 8802]
          Length = 254

 Score = 43.9 bits (102), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (52%), Gaps = 7/106 (6%)

Query: 220 ESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIY 279
           E  L S SSNN   G     + L + + D + SLD V ++ A++    ++++G T+G I 
Sbjct: 106 EDSLGSQSSNN---GYSTGRIILLIALTDLAFSLDSVTAAVALSDQMGLVLLGCTLGIIT 162

Query: 280 VRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEI 325
           +R +  L ++   L ++ YL   +Y +I  L V + L   V IP++
Sbjct: 163 LRCLASLFVRW--LTEFSYLADAAYLTI--LGVGLRLLGKVIIPDL 204


>gi|218249116|ref|YP_002374487.1| integral membrane protein TerC [Cyanothece sp. PCC 8801]
 gi|218169594|gb|ACK68331.1| Integral membrane protein TerC [Cyanothece sp. PCC 8801]
          Length = 254

 Score = 43.9 bits (102), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (52%), Gaps = 7/106 (6%)

Query: 220 ESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIY 279
           E  L S SSNN   G     + L + + D + SLD V ++ A++    ++++G T+G I 
Sbjct: 106 EDSLGSQSSNN---GYSTGRIILLIALTDLAFSLDSVTAAVALSDQMGLVLLGCTLGIIT 162

Query: 280 VRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEI 325
           +R +  L ++   L ++ YL   +Y +I  L V + L   V IP++
Sbjct: 163 LRCLASLFVRW--LTEFSYLADAAYLTI--LGVGLRLLGKVIIPDL 204


>gi|148545030|ref|YP_001272400.1| integral membrane protein TerC [Lactobacillus reuteri DSM 20016]
 gi|184154364|ref|YP_001842705.1| hypothetical protein LAR_1709 [Lactobacillus reuteri JCM 1112]
 gi|194467272|ref|ZP_03073259.1| Integral membrane protein TerC [Lactobacillus reuteri 100-23]
 gi|227364178|ref|ZP_03848275.1| TerC family membrane protein [Lactobacillus reuteri MM2-3]
 gi|325683381|ref|ZP_08162897.1| tellurium resistance protein [Lactobacillus reuteri MM4-1A]
 gi|148532064|gb|ABQ84063.1| Integral membrane protein TerC [Lactobacillus reuteri DSM 20016]
 gi|183225708|dbj|BAG26225.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|194454308|gb|EDX43205.1| Integral membrane protein TerC [Lactobacillus reuteri 100-23]
 gi|227070817|gb|EEI09143.1| TerC family membrane protein [Lactobacillus reuteri MM2-3]
 gi|324977731|gb|EGC14682.1| tellurium resistance protein [Lactobacillus reuteri MM4-1A]
          Length = 251

 Score = 43.5 bits (101), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 56/104 (53%), Gaps = 4/104 (3%)

Query: 213 FYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG 272
           F+G   +    + +    +T  K    + L +E +D   S+D V++S A++ N  I++IG
Sbjct: 112 FFGKRAMRK--TREGKTRLTGRKLFWTVVLQIEFMDIIFSIDSVLASLAVSNNPVIVLIG 169

Query: 273 LTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFL 316
             IG   +R +  +++K  ++ K   LE  +Y  IFV+++ +FL
Sbjct: 170 GLIGIACMRGIAEVIMK--LMRKVPELEPMAYILIFVIAIKLFL 211


>gi|254414686|ref|ZP_05028451.1| Integral membrane protein TerC family [Microcoleus chthonoplastes
           PCC 7420]
 gi|196178534|gb|EDX73533.1| Integral membrane protein TerC family [Microcoleus chthonoplastes
           PCC 7420]
          Length = 238

 Score = 43.5 bits (101), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 62/128 (48%), Gaps = 10/128 (7%)

Query: 227 SSNNVTHGKHGLNLFLYLEII------DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S  +  H  HG      L++I      D + SLD V ++ AI+   ++++ G TIG I +
Sbjct: 100 SEEDEQHHHHGPRFTSLLQVIPLIAITDLAFSLDSVTTAIAISDQIWLVLAGGTIGVITL 159

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD--IPEIFTGTSSTILIFLS 338
           R M  L ++   L +Y  LE   Y ++ ++ + + ++ I    +P  +   +   LIFL 
Sbjct: 160 RFMAGLFIRW--LQEYANLEDAGYITVGIVGLRLLVRAINPEFVPPEWLMITIIALIFLW 217

Query: 339 IYSSIKNK 346
            ++   N+
Sbjct: 218 GFAQRTNE 225


>gi|186686303|ref|YP_001869499.1| integral membrane protein TerC [Nostoc punctiforme PCC 73102]
 gi|186468755|gb|ACC84556.1| Integral membrane protein TerC [Nostoc punctiforme PCC 73102]
          Length = 240

 Score = 43.5 bits (101), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 55/101 (54%), Gaps = 5/101 (4%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S ++ +   HG    +L   + +I   D + SLD V ++ A+++  ++++ G TIG I +
Sbjct: 101 SEETKDEHHHGPRFNSLLQAIPVIAFTDLAFSLDSVTTAIAVSQEKWLVLTGATIGIITL 160

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD 321
           R M  L ++   L++Y+ LE   Y ++  + + + L+ + D
Sbjct: 161 RFMAGLFIRW--LDEYENLEDAGYVTVAFVGLRLLLKVVND 199


>gi|312869348|ref|ZP_07729513.1| integral membrane protein, YkoY family [Lactobacillus oris
           PB013-T2-3]
 gi|311095143|gb|EFQ53422.1| integral membrane protein, YkoY family [Lactobacillus oris
           PB013-T2-3]
          Length = 252

 Score = 43.5 bits (101), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 65/117 (55%), Gaps = 7/117 (5%)

Query: 227 SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLL 286
           +++ VT  K    +   +E +D   S+D V++S A++ N  I++IG  IG   +R +  +
Sbjct: 123 TADRVTGRKRFWLVVAQIEFMDIIFSVDSVLASLAVSPNPVIVLIGGLIGIACMRGVAEI 182

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI----VDIPEIFTGTSSTILIFLSI 339
           ++K  ++ K   LE  +Y  IFV+++ +FL TI    ++IP  + G    I+  L+I
Sbjct: 183 IMK--LMRKIPELEPMAYALIFVIAIKLFL-TIPAIDIEIPSQYFGIFMLIVFGLTI 236


>gi|227545267|ref|ZP_03975316.1| TerC family membrane protein [Lactobacillus reuteri CF48-3A]
 gi|300908663|ref|ZP_07126126.1| tellurium resistance protein [Lactobacillus reuteri SD2112]
 gi|227184757|gb|EEI64828.1| TerC family membrane protein [Lactobacillus reuteri CF48-3A]
 gi|300894070|gb|EFK87428.1| tellurium resistance protein [Lactobacillus reuteri SD2112]
          Length = 251

 Score = 43.5 bits (101), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSM 283
           + +   ++T  K    + L +E +D   S+D V++S A++ N  I++IG  IG   +R +
Sbjct: 121 TREGKTHLTGRKLFWTVVLQIEFMDIIFSIDSVLASLAVSNNPVIVLIGGLIGIACMRGI 180

Query: 284 TLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFL 316
             +++K  ++ K   LE  +Y  IFV+++ +FL
Sbjct: 181 AEVIMK--LMRKVPELEPMAYILIFVIAIKLFL 211


>gi|259502333|ref|ZP_05745235.1| tellurium resistance protein [Lactobacillus antri DSM 16041]
 gi|259169713|gb|EEW54208.1| tellurium resistance protein [Lactobacillus antri DSM 16041]
          Length = 255

 Score = 43.1 bits (100), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 58/105 (55%), Gaps = 5/105 (4%)

Query: 227 SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLL 286
           +++ VT  K    +   +E +D   S+D V++S A++ N  I++IG  IG   +R +  +
Sbjct: 123 TADRVTGRKRFWLVVAQIEFMDIIFSVDSVLASLAVSPNPVIVLIGGLIGIACMRGVAEI 182

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI---VDIPEIFTG 328
           ++K  ++ K   LE  +Y  IFV+++ +FL      ++IP  + G
Sbjct: 183 IMK--LMRKIPELEPMAYALIFVIAIKLFLTIPAIDIEIPSQYFG 225


>gi|88808733|ref|ZP_01124243.1| TerC family protein [Synechococcus sp. WH 7805]
 gi|88787721|gb|EAR18878.1| TerC family protein [Synechococcus sp. WH 7805]
          Length = 239

 Score = 42.7 bits (99), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 55/107 (51%), Gaps = 9/107 (8%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSM 283
           S DSS+ V+  +      + L + D + S+D V ++ AI+   F+++ G  IG + +R  
Sbjct: 116 SLDSSSTVSFRRT----VVTLAVTDLAFSIDSVAAAVAISDQLFLVITGALIGVVALRFT 171

Query: 284 TLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI---VDIPEIFT 327
           + L ++   L  Y  LE   Y ++  +   + +Q +   +D+PE+ T
Sbjct: 172 SGLFIQW--LKIYSRLESAGYLAVAFVGFKLLIQLVFPMIDVPELLT 216


>gi|317970139|ref|ZP_07971529.1| membrane protein, TerC family protein [Synechococcus sp. CB0205]
          Length = 242

 Score = 42.4 bits (98), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 54/97 (55%), Gaps = 5/97 (5%)

Query: 224 SSDSS-NNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRS 282
           S DS+ +    G  G+   + L + D + SLD V ++ A++ N  +++IG  +G + +R 
Sbjct: 117 SDDSAADGAVKGLSGV--VVTLALTDLAFSLDSVAAAVAVSDNLLLVMIGGVLGVVALRL 174

Query: 283 MTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI 319
            ++L ++   L  Y++LE   Y ++ ++ + + L+ +
Sbjct: 175 TSVLFIRW--LEVYRHLEAAGYLAVGLVGIRLLLRLV 209


>gi|312113649|ref|YP_004011245.1| integral membrane protein TerC [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218778|gb|ADP70146.1| Integral membrane protein TerC [Rhodomicrobium vannielii ATCC
           17100]
          Length = 317

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 60/107 (56%), Gaps = 6/107 (5%)

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           L I D   +LD + + FAIT++ FI+        + +R++   +  +G+++K++YL++G 
Sbjct: 205 LNITDIVFALDSIPAIFAITRDPFIVYTSNVFAILGLRALFFAL--RGMVDKFRYLKYGL 262

Query: 304 YYSIFVLSVIM---FLQTIVDIPEIFTGTSSTILIFLSI-YSSIKNK 346
             ++  + + M   + + + DIP  +    + +LIF SI  S IKN+
Sbjct: 263 SLTLVFIGIKMIFNYPEELPDIPTEWALGVTALLIFGSIGLSLIKNR 309


>gi|256847650|ref|ZP_05553095.1| integral membrane protein TerC [Lactobacillus coleohominis
           101-4-CHN]
 gi|256715339|gb|EEU30315.1| integral membrane protein TerC [Lactobacillus coleohominis
           101-4-CHN]
          Length = 265

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 53/87 (60%), Gaps = 4/87 (4%)

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           +E ID   S+D V++S A++ N  I++IG  IG   +R +  ++++  ++ K   LE  +
Sbjct: 141 IEFIDIVFSIDSVLASLAVSSNPVIVLIGGCIGIACMRGVAEIIMR--LMRKIPELEPMA 198

Query: 304 YYSIFVLSVIMFLQ-TIVDIPEIFTGT 329
           Y  IF++++ +FL   ++DI EI +G 
Sbjct: 199 YVLIFLIAIKLFLTIPMIDI-EIPSGQ 224


>gi|282896654|ref|ZP_06304662.1| hypothetical protein CRD_01359 [Raphidiopsis brookii D9]
 gi|281198372|gb|EFA73260.1| hypothetical protein CRD_01359 [Raphidiopsis brookii D9]
          Length = 261

 Score = 41.2 bits (95), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 56/99 (56%), Gaps = 5/99 (5%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S + +++  HG    +L+  + +I   D + SLD V ++ A+++  ++++ G TIG + +
Sbjct: 101 SEERADHHHHGPRFKSLWQAIPVIAFTDLAFSLDSVTTAIAVSQETWLVLTGTTIGVVTL 160

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI 319
           R M  L ++   L++Y+ L    Y ++ ++ + + L+ +
Sbjct: 161 RFMAELFIRW--LDEYENLGDAGYITVALVGLRLLLKVL 197


>gi|172037084|ref|YP_001803585.1| hypothetical protein cce_2169 [Cyanothece sp. ATCC 51142]
 gi|171698538|gb|ACB51519.1| hypothetical protein cce_2169 [Cyanothece sp. ATCC 51142]
          Length = 252

 Score = 40.8 bits (94), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 46/87 (52%), Gaps = 5/87 (5%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S ++  +  HG    +L+  + +I   D + SLD V ++ A+    ++I+ G TIG I +
Sbjct: 100 SEENEQDHHHGPEFASLWQAIPLIAVTDLAFSLDSVTTAIALADEIWLILAGGTIGVITL 159

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSI 307
           R +  L ++   L +Y YLE   + ++
Sbjct: 160 RFLAELFIRW--LKEYTYLEDAGFITV 184


>gi|22297812|ref|NP_681059.1| hypothetical protein tll0268 [Thermosynechococcus elongatus BP-1]
 gi|22293989|dbj|BAC07821.1| tll0268 [Thermosynechococcus elongatus BP-1]
          Length = 246

 Score = 40.8 bits (94), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           L + D + SLD V ++ A++   +++++G TIG I +R M  L ++   L ++  LE   
Sbjct: 122 LALADLAFSLDSVTTAIALSDERWLVLLGGTIGVIMLRFMAELFIRW--LKEFPRLEDAG 179

Query: 304 YYSIFVLSVIMFLQTI 319
           Y+++ ++ + + ++ I
Sbjct: 180 YFTVTLVGLRLLIRVI 195


>gi|78189682|ref|YP_380020.1| hypothetical protein Cag_1726 [Chlorobium chlorochromatii CaD3]
 gi|78171881|gb|ABB28977.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 255

 Score = 40.4 bits (93), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 54/92 (58%), Gaps = 4/92 (4%)

Query: 230 NVTHGKHGL--NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLM 287
            +T GK G+  +  L +E++D + S+D V ++ A T+N  +I +G+ IG + +R +    
Sbjct: 118 QMTVGKLGIFWSTVLLIEMMDLAFSIDNVFAAVAFTENLLLIYLGVFIGILAMRFVAQGF 177

Query: 288 LKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI 319
           +  G++ ++ +LE  ++  I VL V + L ++
Sbjct: 178 V--GLMERFPFLETSAFLVIGVLGVKLLLSSL 207


>gi|218247521|ref|YP_002372892.1| integral membrane protein TerC [Cyanothece sp. PCC 8801]
 gi|257061143|ref|YP_003139031.1| integral membrane protein TerC [Cyanothece sp. PCC 8802]
 gi|218167999|gb|ACK66736.1| Integral membrane protein TerC [Cyanothece sp. PCC 8801]
 gi|256591309|gb|ACV02196.1| Integral membrane protein TerC [Cyanothece sp. PCC 8802]
          Length = 247

 Score = 40.4 bits (93), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 43/74 (58%), Gaps = 2/74 (2%)

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           + D + SLD V ++ AI  + ++I++G TIG I +R +  L ++   L ++ YLE   + 
Sbjct: 125 VTDLAFSLDSVTTAIAIADDLWLILMGGTIGVITLRFLAELFIRW--LQEFTYLEDAGFV 182

Query: 306 SIFVLSVIMFLQTI 319
           ++  + + + L+ I
Sbjct: 183 TVGFVGIRLLLRVI 196


>gi|227511650|ref|ZP_03941699.1| TerC family membrane protein [Lactobacillus buchneri ATCC 11577]
 gi|227524859|ref|ZP_03954908.1| TerC family membrane protein [Lactobacillus hilgardii ATCC 8290]
 gi|227085144|gb|EEI20456.1| TerC family membrane protein [Lactobacillus buchneri ATCC 11577]
 gi|227087979|gb|EEI23291.1| TerC family membrane protein [Lactobacillus hilgardii ATCC 8290]
          Length = 253

 Score = 40.0 bits (92), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 56/97 (57%), Gaps = 10/97 (10%)

Query: 233 HGKHGLNLF----LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLML 288
             KH ++LF    L +E +D   S+D V++S AI+ N  I++IG  IG + +R +  +++
Sbjct: 122 QKKHRISLFWSVVLQIEFMDVVFSVDSVLASLAISPNPVIVLIGGMIGILAMRGVAEVIM 181

Query: 289 KQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEI 325
           K  +++K   L+  +Y    VL  I+ L+ ++ IP I
Sbjct: 182 K--LMSKIPELQPMAY----VLIGIIALKLLLSIPMI 212


>gi|227508668|ref|ZP_03938717.1| TerC family membrane protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227192000|gb|EEI72067.1| TerC family membrane protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 253

 Score = 40.0 bits (92), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 56/97 (57%), Gaps = 10/97 (10%)

Query: 233 HGKHGLNLF----LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLML 288
             KH ++LF    L +E +D   S+D V++S AI+ N  I++IG  IG + +R +  +++
Sbjct: 122 QKKHRISLFWSVVLQIEFMDVVFSVDSVLASLAISPNPVIVLIGGMIGILAMRGVAEVIM 181

Query: 289 KQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEI 325
           K  +++K   L+  +Y    VL  I+ L+ ++ IP I
Sbjct: 182 K--LMSKIPELQPMAY----VLIGIIALKLLLSIPMI 212


>gi|184156167|ref|YP_001844507.1| hypothetical protein LAF_1691 [Lactobacillus fermentum IFO 3956]
 gi|227515297|ref|ZP_03945346.1| TerC family membrane protein [Lactobacillus fermentum ATCC 14931]
 gi|260662397|ref|ZP_05863292.1| integral membrane protein [Lactobacillus fermentum 28-3-CHN]
 gi|183227511|dbj|BAG28027.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956]
 gi|227086357|gb|EEI21669.1| TerC family membrane protein [Lactobacillus fermentum ATCC 14931]
 gi|260553088|gb|EEX26031.1| integral membrane protein [Lactobacillus fermentum 28-3-CHN]
 gi|299783638|gb|ADJ41636.1| Integral membrane protein [Lactobacillus fermentum CECT 5716]
          Length = 269

 Score = 40.0 bits (92), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 60/117 (51%), Gaps = 4/117 (3%)

Query: 213 FYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG 272
           F+G + L     S     +T  K    +   +E  D   S+D V+++ A++ N  I++IG
Sbjct: 112 FFGKHSLHKDKKSSRLGKLTGRKRFWAVVAQIEFTDIVFSIDSVLAALAVSNNPVIVLIG 171

Query: 273 LTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTG 328
             IG + +R +   +++  ++ K   LE  +Y  I V++V +FL    +DI EI +G
Sbjct: 172 GLIGILCMRGIAEFIMR--LMRKVPELEPMAYVLIAVIAVKLFLTIPAIDI-EIPSG 225


>gi|183597912|ref|ZP_02959405.1| hypothetical protein PROSTU_01253 [Providencia stuartii ATCC 25827]
 gi|188022678|gb|EDU60718.1| hypothetical protein PROSTU_01253 [Providencia stuartii ATCC 25827]
          Length = 319

 Score = 40.0 bits (92), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 58/111 (52%), Gaps = 6/111 (5%)

Query: 240 LFLYL---EIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
           LFL L   EI D   ++D + + FA+T + FI++       + +R+M  L+   G+  K+
Sbjct: 205 LFLVLILVEISDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAMYFLL--AGVAEKF 262

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVDIPEIFT-GTSSTILIFLSIYSSIKNK 346
             L++G    +  + V M L  I  IP I + GT +TIL+   + + I NK
Sbjct: 263 TMLKYGLAVILTFIGVKMLLMDIYHIPTIISLGTVATILVATLVINVIVNK 313


>gi|81429249|ref|YP_396250.1| hypothetical protein LSA1637 [Lactobacillus sakei subsp. sakei 23K]
 gi|78610892|emb|CAI55944.1| hypothetical integral membrane protein, TerC family [Lactobacillus
           sakei subsp. sakei 23K]
          Length = 243

 Score = 40.0 bits (92), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 59/108 (54%), Gaps = 7/108 (6%)

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           +E++D   S+D V++S AI+ N  I++IG  IG I +R +  ++ +  ++ K   L   +
Sbjct: 137 IELMDIVFSIDSVLASLAISSNPVIVLIGGMIGIICMRGIAQIIAR--LMEKIPELNPMA 194

Query: 304 YYSIFVLSVIMFLQTI---VDIPE-IFTGTS-STILIFLSIYSSIKNK 346
           Y  I  ++V +FL      ++IP  +F G    TILI L I+   K +
Sbjct: 195 YILILFIAVKLFLSIPAIDIEIPNLVFAGIVFGTILITLGIHYIRKQR 242


>gi|166363689|ref|YP_001655962.1| hypothetical protein MAE_09480 [Microcystis aeruginosa NIES-843]
 gi|166086062|dbj|BAG00770.1| hypothetical protein MAE_09480 [Microcystis aeruginosa NIES-843]
          Length = 239

 Score = 39.7 bits (91), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 8/84 (9%)

Query: 227 SSNNVTHGKHGLNLFLYLEII------DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S  +  H  H L      + I      D + SLD V +S A+  + ++I++G TIG + +
Sbjct: 100 SPEDKDHSHHSLQFHSLWQAIPLIAVTDLAFSLDSVTTSIAVADDTWLILLGGTIGVVTL 159

Query: 281 RSMTLLMLKQGILNKYKYLEHGSY 304
           R M  L ++   L +Y +LE   +
Sbjct: 160 RFMAGLFIRW--LEEYTHLEDAGF 181


>gi|329848857|ref|ZP_08263885.1| integral membrane protein TerC family protein [Asticcacaulis
           biprosthecum C19]
 gi|328843920|gb|EGF93489.1| integral membrane protein TerC family protein [Asticcacaulis
           biprosthecum C19]
          Length = 372

 Score = 39.3 bits (90), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 86/192 (44%), Gaps = 17/192 (8%)

Query: 157 NKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGI 216
           N+ HW+ +L           GIK+++      G    L +N   ++V  S A    + G 
Sbjct: 173 NEFHWVLYL---FGAFLVFTGIKMWLAA----GKEADLDSNPALNWVRKSFAISPTYDGE 225

Query: 217 NFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIG 276
            F   V      N  T     L + L + I+D   ++D + + FAIT + FI++    + 
Sbjct: 226 KFFTRV------NRKTMATPLLVVVLLIGIVDVVFAVDSIPAIFAITTDPFIVLTSNVMA 279

Query: 277 AIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIF 336
            + +R+M  L+   G+  ++  L +G    + ++   M L  +  IP  ++  ++ +++ 
Sbjct: 280 ILGLRAMYFLL--AGVHERFHLLPYGLAMVLVLIGAKMLLIDLYKIPIQWSLGATAVILT 337

Query: 337 LSIYSS--IKNK 346
           L++  S  IK K
Sbjct: 338 LTVLLSLMIKPK 349


>gi|300864129|ref|ZP_07109024.1| conserved membrane hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300337857|emb|CBN54170.1| conserved membrane hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 260

 Score = 39.3 bits (90), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 53/101 (52%), Gaps = 9/101 (8%)

Query: 228 SNNVTHGKHG----LNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S     G+H      NL+  + +I   D + SLD V ++ AI+   ++++ G TIG I +
Sbjct: 100 SATDEDGEHKEPRFANLWQAIPVIALTDLAFSLDSVTTAIAISDETWLVLTGATIGIIAL 159

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD 321
           R M  L ++   L ++ +LE+  Y ++  + + + L+ I D
Sbjct: 160 RFMAGLFIRW--LEEFVHLENAGYITVGFVGIRLLLKVIND 198


>gi|303239738|ref|ZP_07326262.1| lipopolysaccharide biosynthesis protein [Acetivibrio cellulolyticus
           CD2]
 gi|302592675|gb|EFL62399.1| lipopolysaccharide biosynthesis protein [Acetivibrio cellulolyticus
           CD2]
          Length = 220

 Score = 38.9 bits (89), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/129 (19%), Positives = 61/129 (47%), Gaps = 7/129 (5%)

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIF-------PIMIVCIVSTINPIEAMNLAIYSPQD 124
           +K SS+  + F     + + +G R+I+       P     + +++  +  +   I+S  D
Sbjct: 90  KKFSSLTYEDFKKKVNVSSEYGTRVIYIKVKDKNPQAAAIVANSMAEVLILRANIFSSTD 149

Query: 125 YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL 184
            LK++ +A VP    GG+ ++++++ F       +  +  LE     +   + IK+ + +
Sbjct: 150 NLKLLDRAVVPSKPVGGSLILLIAICFILGFGASIACVFLLEYFDDRIRSAEDIKMILEM 209

Query: 185 SIIFGISNI 193
            ++  +SN+
Sbjct: 210 PVLGVVSNV 218


>gi|254423338|ref|ZP_05037056.1| Integral membrane protein TerC family [Synechococcus sp. PCC 7335]
 gi|196190827|gb|EDX85791.1| Integral membrane protein TerC family [Synechococcus sp. PCC 7335]
          Length = 270

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 74/147 (50%), Gaps = 6/147 (4%)

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
           K + I ++++ I  IS IL  + +  +     A  +    + + +  L+ D   +   G 
Sbjct: 53  KALNIGLIVAFILRISLILAASWVLKYWQFEIAGAVYLLWLVY-QHFLADDDDADEHTGP 111

Query: 236 HGLNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
              +L+  +  I   D + SLD V ++ A++K+  I+++G TIG I +R M  L ++   
Sbjct: 112 RFSSLWKAIPTIALTDLAFSLDSVTTAIALSKDVLIVLLGGTIGIIALRFMAGLFIRW-- 169

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTI 319
           L+ Y +LE   + ++ ++ + + ++ I
Sbjct: 170 LSIYVHLEDAGFVTVAIVGLRLIVRVI 196


>gi|159027833|emb|CAO87046.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 239

 Score = 38.9 bits (89), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 45/84 (53%), Gaps = 8/84 (9%)

Query: 227 SSNNVTHGKHGL---NLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S  +  H  H L   +L+  + +I   D + SLD V +S A+  + ++I++G TIG + +
Sbjct: 100 SPEDKDHTHHSLKFQSLWQAIPLIAVTDLAFSLDSVTTSIAVADDTWLILLGGTIGVVTL 159

Query: 281 RSMTLLMLKQGILNKYKYLEHGSY 304
           R M  L ++   L +Y +LE   +
Sbjct: 160 RFMAGLFIRW--LEEYTHLEDAGF 181


>gi|114771065|ref|ZP_01448505.1| putative Exopolyphosphatase [alpha proteobacterium HTCC2255]
 gi|114548347|gb|EAU51233.1| putative Exopolyphosphatase [alpha proteobacterium HTCC2255]
          Length = 365

 Score = 38.5 bits (88), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 6/104 (5%)

Query: 109 INPIEAMNLAIYSPQDYLKIISQAHVPIS-GFGGTFLMMVSLTFFF--NSQNKLHWIHFL 165
           I P E   LA+     +LK  ++  + +  G G T L+ + LT     N +N +  +   
Sbjct: 128 IKPSEEARLAVIGSVGHLKAKTEQVLVVDIGGGSTELVWLDLTNVEPKNRKNSIMLMQSN 187

Query: 166 EIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAA 209
           ++    L K+ G+K+   +S+ FG++ +    E YS V    AA
Sbjct: 188 QLRRKELDKLTGVKVVDWISVPFGVTTL---KEQYSDVEEDKAA 228


>gi|307151454|ref|YP_003886838.1| Integral membrane protein TerC [Cyanothece sp. PCC 7822]
 gi|306981682|gb|ADN13563.1| Integral membrane protein TerC [Cyanothece sp. PCC 7822]
          Length = 239

 Score = 38.5 bits (88), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 224 SSDSSNNVTHGKHGLNLFLYL----EIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIY 279
             DS +   H +   NL   +     + D + SLD V ++ AI+   ++I+ G  IG I 
Sbjct: 107 QEDSLSEPFHPQSNTNLIWQIIPIIALTDLAFSLDSVTTAIAISNETWLILFGGIIGVIT 166

Query: 280 VRSMTLLMLKQGILNKYKYLEHGSY 304
           +R    L +K  +L+KY YL+  +Y
Sbjct: 167 LRFSAGLFIK--LLDKYVYLQDAAY 189


>gi|81299360|ref|YP_399568.1| hypothetical protein Synpcc7942_0549 [Synechococcus elongatus PCC
           7942]
 gi|81168241|gb|ABB56581.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 253

 Score = 38.5 bits (88), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           + D + SLD V ++ A+++  +++++G TIG I +R +  L ++   L +Y  LE   Y 
Sbjct: 135 LTDLAFSLDSVTTAIAVSRETWLVLLGGTIGVITLRFLAGLFIRW--LKEYDNLESAGYG 192

Query: 306 SIFVLSVIMFLQTI 319
           ++ ++ + + ++ I
Sbjct: 193 AVALVGLRLLVRAI 206


>gi|170078439|ref|YP_001735077.1| hypothetical protein SYNPCC7002_A1833 [Synechococcus sp. PCC 7002]
 gi|169886108|gb|ACA99821.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
          Length = 235

 Score = 38.5 bits (88), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 53/99 (53%), Gaps = 5/99 (5%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S +   N  H     +L+  + +I   D + SLD V ++ A+ ++ ++IV+G TIG + +
Sbjct: 100 SPEDDKNHHHSLEFKSLWQAIPMIAVTDLAFSLDSVTTAIAVAEDIWLIVLGGTIGVLTL 159

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI 319
           R +  L ++   L+++  LE   + ++  + V + L+ +
Sbjct: 160 RFLAGLFIRW--LDEFTNLEDAGFVTVGFVGVRLLLKAV 196


>gi|212711131|ref|ZP_03319259.1| hypothetical protein PROVALCAL_02202 [Providencia alcalifaciens DSM
           30120]
 gi|212686299|gb|EEB45827.1| hypothetical protein PROVALCAL_02202 [Providencia alcalifaciens DSM
           30120]
          Length = 323

 Score = 38.1 bits (87), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 54/104 (51%), Gaps = 3/104 (2%)

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           +EI D   ++D + + FA+T + FI++       + +R+M  L+   G+  K+  L++G 
Sbjct: 212 VEISDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAMYFLL--AGVAEKFSMLKYGL 269

Query: 304 YYSIFVLSVIMFLQTIVDIPEIFT-GTSSTILIFLSIYSSIKNK 346
              +  + V M L  +  IP   + GT + IL+   + ++I NK
Sbjct: 270 AVILSFIGVKMLLMDVFHIPTAVSLGTVAAILVLTLVINTIVNK 313


>gi|116334366|ref|YP_795893.1| hypothetical protein LVIS_1797 [Lactobacillus brevis ATCC 367]
 gi|116099713|gb|ABJ64862.1| hypothetical protein LVIS_1797 [Lactobacillus brevis ATCC 367]
          Length = 249

 Score = 38.1 bits (87), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 53/92 (57%), Gaps = 6/92 (6%)

Query: 242 LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEH 301
           L +E++D   S+D V++S AI+ N  I++IG  IG + +R +  ++++  ++ K   LE 
Sbjct: 137 LQIEMMDIIFSVDSVLASLAISSNPVIVLIGGLIGILAMRGVAEVIMR--LMQKIPELEP 194

Query: 302 GSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTI 333
            +Y  I +++V +F    + IP I     +T+
Sbjct: 195 MAYILIALIAVKLF----ISIPAIDIEIPATL 222


>gi|126659845|ref|ZP_01730971.1| hypothetical protein CY0110_24471 [Cyanothece sp. CCY0110]
 gi|126618902|gb|EAZ89645.1| hypothetical protein CY0110_24471 [Cyanothece sp. CCY0110]
          Length = 252

 Score = 38.1 bits (87), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 5/87 (5%)

Query: 224 SSDSSNNVTHGKHGLNLFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
           S ++  +  HG    +L+  + +I   D + SLD V ++ A+    ++I+ G TIG I +
Sbjct: 100 SEENEQDEHHGPTFTSLWQAIPLIAVTDLAFSLDSVTTAIALADEIWLILAGGTIGVITL 159

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSI 307
           R +  L ++   L +Y +LE   + ++
Sbjct: 160 RFLAELFIRW--LQEYTHLEDAGFITV 184


>gi|209808866|ref|YP_002264404.1| protein alx [Aliivibrio salmonicida LFI1238]
 gi|209809822|ref|YP_002265361.1| protein alx [Aliivibrio salmonicida LFI1238]
 gi|208010428|emb|CAQ80781.1| protein alx [Aliivibrio salmonicida LFI1238]
 gi|208011385|emb|CAQ81848.1| protein alx [Aliivibrio salmonicida LFI1238]
          Length = 314

 Score = 37.7 bits (86), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 78/172 (45%), Gaps = 7/172 (4%)

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
           IF V  II GI       E  S  SSS   + +   I F +          V        
Sbjct: 141 IFAVFLIITGIKLWFTDTEAESDFSSSKFVVFLKKHIPFDDKYYGHQLIAKVNGKMIATP 200

Query: 240 LFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
           L L + +I   D   +LD + + FAIT+  F++        + +RS+  ++  QG+L+K+
Sbjct: 201 LLLVVIVIMFTDIMFALDSIPAIFAITQEPFLVFSANVFALLGLRSLYFVL--QGMLSKF 258

Query: 297 KYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSI-KNK 346
            YL+    + +  + + MFL  T  ++P  F+  +   +I L+I  SI KNK
Sbjct: 259 CYLQPALAFILGFIGIKMFLVDTAYEVPTAFSLLTIVGIITLAIVGSIYKNK 310


>gi|119485409|ref|ZP_01619737.1| hypothetical protein L8106_09716 [Lyngbya sp. PCC 8106]
 gi|119457165|gb|EAW38291.1| hypothetical protein L8106_09716 [Lyngbya sp. PCC 8106]
          Length = 230

 Score = 37.7 bits (86), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 2/72 (2%)

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           D + SLD V ++ A+    ++I+IG T+G I +R +  L ++   L +Y +LE   Y ++
Sbjct: 128 DLAFSLDSVTAAIAVADETWLIIIGATLGIITLRFLAGLFIRW--LTEYTHLETAGYLTV 185

Query: 308 FVLSVIMFLQTI 319
            ++ + + ++ I
Sbjct: 186 GLVGMRLLVRVI 197


>gi|261749599|ref|YP_003257285.1| TerC family membrane protein [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
 gi|261497692|gb|ACX84142.1| integral membrane protein TerC family [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 242

 Score = 37.0 bits (84), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 55/98 (56%), Gaps = 8/98 (8%)

Query: 211 IIFYGINFLESVLSSDSSNNVTHGKHGLNLF----LYLEIIDASLSLDGVISSFAITKNF 266
           +I+ G+N+  S  S +SS      +   N F    L +EI+D + S+D + ++ A+++NF
Sbjct: 92  LIYLGLNYFFS--SKNSSLKKNKDRKLRNSFWMVLLSIEIMDLAFSIDNLFAAVALSENF 149

Query: 267 FIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSY 304
            +I +G+ IG + +R      +K  +L  Y +L++ ++
Sbjct: 150 LLIFLGVFIGILAMRFAAQGFVK--LLEFYPFLKNSAF 185


>gi|221632116|ref|YP_002521337.1| putative integral membrane export protein [Thermomicrobium roseum
           DSM 5159]
 gi|221155779|gb|ACM04906.1| putative integral membrane export protein [Thermomicrobium roseum
           DSM 5159]
          Length = 318

 Score = 37.0 bits (84), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           +EI D   ++D + + FA+T++ FI+        + +RSM  L+   G++ +  YL +G 
Sbjct: 203 VEITDLMFAIDSIPAIFAVTRDPFIVFSSNVFAILGLRSMYFLL--AGLVRRLAYLRYGL 260

Query: 304 YYSIFVLSVIMFLQTIVDIP 323
            + +  + V M +Q    IP
Sbjct: 261 AFILSYIGVKMLIQDFYKIP 280


>gi|260181401|gb|ACX35376.1| cytochrome oxidase subunit I [Psithyristria sp. 1 KBRH-2009]
          Length = 216

 Score = 37.0 bits (84), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 47/115 (40%), Gaps = 9/115 (7%)

Query: 28  GLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL------QKMSSIWQKR 81
           G G GW     LS TIS    C+ L +  + L+  ++IL A N        +M  ++  R
Sbjct: 103 GAGTGWTVYPPLSSTISHSGSCVDLTIFSLHLAGASSILGAGNFISTIFNMRMYGMYLDR 162

Query: 82  --FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHV 134
                W +LI  F + +  P++   I   +     +N + + P      I   H+
Sbjct: 163 TPLFVWAVLITAFXLLLSLPVLAGAITMLLTD-RXLNTSFFDPSGGGDPILYZHL 216


>gi|28379085|ref|NP_785977.1| integral membrane protein [Lactobacillus plantarum WCFS1]
 gi|254557217|ref|YP_003063634.1| integral membrane protein [Lactobacillus plantarum JDM1]
 gi|300767994|ref|ZP_07077901.1| tellurium resistance protein [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308181281|ref|YP_003925409.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|28271923|emb|CAD64828.1| integral membrane protein [Lactobacillus plantarum WCFS1]
 gi|254046144|gb|ACT62937.1| integral membrane protein [Lactobacillus plantarum JDM1]
 gi|300494447|gb|EFK29608.1| tellurium resistance protein [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308046772|gb|ADN99315.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 257

 Score = 37.0 bits (84), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 48/83 (57%), Gaps = 5/83 (6%)

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           +E++D   S+D V++S AI+ N  I++IG  IG   +R +  ++++  ++ K   LE  +
Sbjct: 141 IEMMDIIFSIDSVLASLAISDNPVIVLIGGMIGIACMRGIAEVIMR--LMRKIPELETMA 198

Query: 304 YYSIFVLSVIMFLQTIV---DIP 323
           Y  I ++++ +F+       DIP
Sbjct: 199 YCLIVLIAIKLFISIPAIGWDIP 221


>gi|328472827|gb|EGF43675.1| hypothetical protein VP10329_19125 [Vibrio parahaemolyticus 10329]
          Length = 254

 Score = 36.6 bits (83), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 68/142 (47%), Gaps = 22/142 (15%)

Query: 170 SHLSKIK-----GIKIFIVLSIIFGISNILP-TNEMYSFVSSST----------AAIIIF 213
           SH  K+      G+ +F  + ++F I+ I+  T  ++S  + +            A ++ 
Sbjct: 41  SHQRKLARNLGIGLAVFARIGLVFSITWIMQLTQPLFSVANHAVTGRDMIMILGGAFLLA 100

Query: 214 YGINFLESVLSSDSSNNVTHGKHGLNL-FLYLEIIDASLSLDGVISSFAITKNFFIIVIG 272
             +  L S L+ + +N+ TH + GL +  L +  +DA  S+D VI++  +T       + 
Sbjct: 101 KSLKELWSWLTHNETNHSTHVRTGLAVVLLQIVAVDAVFSMDSVITAVGLTSE-----VP 155

Query: 273 LTIGAIYVRSMTLLMLKQGILN 294
           L + AI V ++ ++M  + I N
Sbjct: 156 LMVAAIIVSALVMVMTAEKINN 177


>gi|309379229|emb|CBX22186.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 456

 Score = 36.6 bits (83), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 55/126 (43%), Gaps = 18/126 (14%)

Query: 15  RWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYI---CIILAVVEISLSF-ENAILNAK- 69
           R   ++TVAG   G G  W+F + +       Y+   CI + V+ I +   EN I   K 
Sbjct: 15  RLTYILTVAGATVGFGATWRFPYLVGENGGGAYVFLFCIAMLVIGIPMILVENVIGRRKG 74

Query: 70  -----------NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
                      N + ++ IW  + + W  L+  FG+   + ++   ++S I  I   NL 
Sbjct: 75  VNALDAFGGSMNGKPVAKIW--KLVGWMGLLGAFGIMAYYMVLGGWVISYIVNIIGGNLN 132

Query: 119 IYSPQD 124
           I SP D
Sbjct: 133 ISSPVD 138


>gi|134298216|ref|YP_001111712.1| integral membrane protein TerC [Desulfotomaculum reducens MI-1]
 gi|134050916|gb|ABO48887.1| Integral membrane protein TerC [Desulfotomaculum reducens MI-1]
          Length = 255

 Score = 36.6 bits (83), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           +E++D + S+D ++++FA++   +++ +G  +G + +R +  + +K  +L KY  LE  +
Sbjct: 148 VELMDITFSVDSILAAFAMSNEVWVLFMGGILGILMMRGVATIFIK--LLEKYPELEASA 205

Query: 304 Y 304
           Y
Sbjct: 206 Y 206


>gi|205374653|ref|ZP_03227447.1| YceF [Bacillus coahuilensis m4-4]
          Length = 251

 Score = 36.6 bits (83), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 48/73 (65%), Gaps = 2/73 (2%)

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           +EI+D + S+D ++++FAI++  +++++G  +G I +R++  + +   ++++   LE  +
Sbjct: 142 VEIVDIAFSVDSILAAFAISEQVWVLLVGGMLGIIMMRTVARVFI--ALIDRIPELETTA 199

Query: 304 YYSIFVLSVIMFL 316
           +  I ++S+ M L
Sbjct: 200 FVLIGIISLKMLL 212


>gi|297565727|ref|YP_003684699.1| Integral membrane protein TerC [Meiothermus silvanus DSM 9946]
 gi|296850176|gb|ADH63191.1| Integral membrane protein TerC [Meiothermus silvanus DSM 9946]
          Length = 235

 Score = 36.6 bits (83), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSY 304
           ++D + ++D V+   A ++NF++I  G+ +G + +R     M++  ++ +Y  LE  +Y
Sbjct: 119 VVDLAFAVDSVLVVIAFSENFWVIFTGVAVGILLIRLAAGWMVR--VMERYPRLEQVAY 175


>gi|56750981|ref|YP_171682.1| hypothetical protein syc0972_c [Synechococcus elongatus PCC 6301]
 gi|56685940|dbj|BAD79162.1| hypothetical protein [Synechococcus elongatus PCC 6301]
          Length = 253

 Score = 36.2 bits (82), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           + D + SLD V ++ A+++  +++++G TIG I +R +  L ++   L +Y  L+   Y 
Sbjct: 135 LTDLAFSLDSVTTAIAVSRETWLVLLGGTIGVITLRFLAGLFIRW--LKEYDNLKSAGYG 192

Query: 306 SIFVLSVIMFLQTI 319
           ++ ++ + + ++ I
Sbjct: 193 AVALVGLRLLVRAI 206


>gi|116492175|ref|YP_803910.1| hypothetical protein PEPE_0372 [Pediococcus pentosaceus ATCC 25745]
 gi|116102325|gb|ABJ67468.1| hypothetical protein PEPE_0372 [Pediococcus pentosaceus ATCC 25745]
          Length = 245

 Score = 36.2 bits (82), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 58/113 (51%), Gaps = 10/113 (8%)

Query: 217 NFLESVLSSDSSNNVTHGKHGLNLF----LYLEIIDASLSLDGVISSFAITKNFFIIVIG 272
            F +       +  +   +  L++F    + +E +D   S+D V++S AI+ N  I++IG
Sbjct: 106 RFFDKQKRGRKTRKLVKKEGRLSVFWRVVIQIEFMDIVFSVDSVLASLAISSNPVIVLIG 165

Query: 273 LTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEI 325
             IG + +R +  +++K  ++ K   LE  +Y    VL  I+ L+ ++ IP I
Sbjct: 166 GLIGILAMRGIAEVIMK--MMQKIPELETMAY----VLIGIIALKLLLSIPMI 212


>gi|197337780|ref|YP_002157869.1| tellurium resistance protein TerC [Vibrio fischeri MJ11]
 gi|197315032|gb|ACH64481.1| tellurium resistance protein TerC [Vibrio fischeri MJ11]
          Length = 318

 Score = 36.2 bits (82), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 55/101 (54%), Gaps = 4/101 (3%)

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           D   +LD + + FAIT+  F++        + +RS+  ++  QG+L+K+ YL+    + +
Sbjct: 212 DIMFALDSIPAIFAITQEPFLVFAANVFALLGLRSLYFVL--QGMLDKFCYLQPALAFIL 269

Query: 308 FVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSI-KNK 346
             + + MFL  T  ++P + +  +   +I L+I  SI KN+
Sbjct: 270 SFIGIKMFLVGTKYEVPTVISLLTIVAIITLAIIGSIYKNR 310


>gi|59713461|ref|YP_206236.1| putative membrane-bound redox modulator that IS induced by high pH
           [Vibrio fischeri ES114]
 gi|59481709|gb|AAW87348.1| putative membrane-bound redox modulator that is induced by high pH
           [Vibrio fischeri ES114]
          Length = 318

 Score = 35.8 bits (81), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 55/101 (54%), Gaps = 4/101 (3%)

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           D   +LD + + FAIT+  F++        + +RS+  ++  QG+L+K+ YL+    + +
Sbjct: 212 DIMFALDSIPAIFAITQEPFLVFAANVFALLGLRSLYFVL--QGMLDKFCYLQPALAFIL 269

Query: 308 FVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSI-KNK 346
             + + MFL  T  ++P + +  +   +I L+I  SI KN+
Sbjct: 270 SFIGIKMFLVGTKYEVPTVISLLTIVAIITLAIIGSIYKNR 310


Searching..................................................done


Results from round 2




>gi|86359171|ref|YP_471063.1| hypothetical protein RHE_CH03581 [Rhizobium etli CFN 42]
 gi|86283273|gb|ABC92336.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 463

 Score =  421 bits (1084), Expect = e-116,   Method: Composition-based stats.
 Identities = 161/346 (46%), Positives = 242/346 (69%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +    S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 101 MNQSQTDKSSLGYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICAVLAVLEISLS 160

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 161 FDNAIVNANKLKEMTPVWQKRFLTWGIIIAVFGMRIVFPLAIVAIAARIGPWDALVLAAR 220

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I++ AH+PI+ FGGTFLMMV L++FF+S+ K+HW+  LE  M+  + I+GI+I
Sbjct: 221 EPEEYARIMNDAHLPIAAFGGTFLMMVGLSYFFDSEKKIHWLRGLEKVMARSATIRGIEI 280

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   E   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 281 AFVLALMLVFSWLIGGEEASVFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 340

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 341 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 400

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +L+VIM+ QT++ IPE+ TG     LI LS++SSI++ 
Sbjct: 401 HGAFYAILILAVIMYAQTLMHIPEVITGLGGAALIGLSLWSSIRHN 446


>gi|190893419|ref|YP_001979961.1| hypothetical protein RHECIAT_CH0003846 [Rhizobium etli CIAT 652]
 gi|190698698|gb|ACE92783.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 389

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 161/346 (46%), Positives = 243/346 (70%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  ++ + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 28  MNQSATHKSSLGYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 87

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 88  FDNAIVNANKLKEMTPLWQKRFLTWGIIIAVFGMRIVFPLAIVAIAARIGPWDALVLAAR 147

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I++ AH+PI+ FGGTFLMMV L++FF+ + K+HW+  LE  M+  + I+GI+I
Sbjct: 148 EPEEYARIMNDAHLPIAAFGGTFLMMVGLSYFFDHEKKIHWLRGLEKVMARSATIRGIEI 207

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   E   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 208 AFVLALMLVFSWLIGGEEASIFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 267

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 268 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 327

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +L+VIM+ QT+V IPE+ TG     LI LS++SSI++ 
Sbjct: 328 HGAFYAILILAVIMYAQTLVHIPEVITGLGGAALIGLSLWSSIRHN 373


>gi|327189635|gb|EGE56785.1| hypothetical protein RHECNPAF_570029 [Rhizobium etli CNPAF512]
          Length = 362

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 161/346 (46%), Positives = 243/346 (70%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  ++ + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQSATHKSSLGYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATAFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 61  FDNAIVNANKLKEMTPLWQKRFLTWGIIIAVFGMRIVFPLAIVAIAARIGPWDALVLAAR 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I++ AH+PI+ FGGTFLMMV L++FF+ + K+HW+  LE  M+  + I+GI+I
Sbjct: 121 EPEEYARIMNDAHLPIAAFGGTFLMMVGLSYFFDHEKKIHWLRGLEKVMARSATIRGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   E   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 181 AFVLALMLVFSWLIGGEEASIFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 241 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +L+VIM+ QT+V IPE+ TG     LI LS++SSI++ 
Sbjct: 301 HGAFYAILILAVIMYAQTLVHIPEVITGLGGAALIGLSLWSSIRHN 346


>gi|209550908|ref|YP_002282825.1| hypothetical protein Rleg2_3332 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536664|gb|ACI56599.1| protein of unknown function DUF475 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 363

 Score =  410 bits (1054), Expect = e-112,   Method: Composition-based stats.
 Identities = 161/346 (46%), Positives = 241/346 (69%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M   + + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQPATHHSSLSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 61  FDNAIVNANKLKEMTPVWQKRFLTWGIIIAVFGMRIVFPLAIVAIAARIGPWDALVLAAR 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I++ AH+PI+ FGGTFLMMV L++FF+ + K+HW   LE  M+  + I+GI+I
Sbjct: 121 EPEEYARIMTDAHLPIAAFGGTFLMMVGLSYFFDHEKKIHWFRGLEKVMARSATIRGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   +   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 181 AFVLALMLVFSWLIGGEQASVFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 241 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +LSVIM+ QT+V IPE+ TG     LI LS++SSI++ 
Sbjct: 301 HGAFYAILILSVIMYAQTLVHIPEVITGLGGATLIGLSLWSSIRHN 346


>gi|116253837|ref|YP_769675.1| hypothetical protein RL4100 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258485|emb|CAK09589.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 362

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 161/346 (46%), Positives = 240/346 (69%), Gaps = 1/346 (0%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M      +S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQPVTQSS-LSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 59

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQ+RFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 60  FDNAIVNANKLKEMTPVWQQRFLTWGIIIAVFGMRIVFPLAIVAIAAQIGPWDALVLAAR 119

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P +Y +I++ AH+PI+ FGGTFLMMV L++FF+ + K+HW+  LE  M+  + I+GI+I
Sbjct: 120 EPAEYARIMNDAHLPIAAFGGTFLMMVGLSYFFDHEKKIHWLRGLEKVMARSATIRGIEI 179

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   E   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 180 AFVLALMLVFSWLIGGEEASVFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 239

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 240 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 299

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +LSVIM+ QT+V IPE+ TG     LI LS++SSI++ 
Sbjct: 300 HGAFYAILILSVIMYAQTLVHIPEVITGLGGAALIGLSLWSSIRHN 345


>gi|150376529|ref|YP_001313125.1| hypothetical protein Smed_4388 [Sinorhizobium medicae WSM419]
 gi|150031076|gb|ABR63192.1| protein of unknown function DUF475 [Sinorhizobium medicae WSM419]
          Length = 365

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 169/346 (48%), Positives = 246/346 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M   S   S + +F+WA +VT AG L G  +GWQ T TL G ++  +IC +LAV+EISLS
Sbjct: 1   MTGGSTQTSSLGYFKWAFIVTGAGLLLGAWLGWQSTGTLGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I ++I PIEA+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAASIGPIEAVILAAT 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 QPEEYSRIMHEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L  +E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSKLLEADEAVVFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++  L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKKTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +LSV+M+ QT+V IPE+ TG     LI LS++SS+++ 
Sbjct: 301 HGAFYAILILSVVMYFQTLVHIPEVITGLGGAGLIGLSLWSSVRHN 346


>gi|241206320|ref|YP_002977416.1| hypothetical protein Rleg_3632 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860210|gb|ACS57877.1| protein of unknown function DUF475 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 363

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 164/346 (47%), Positives = 238/346 (68%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M       S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQTVTSKSSLSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 61  FDNAIVNANKLKEMTPVWQKRFLTWGIIIAVFGMRIVFPLAIVAIAAQIGPWDALVLAAR 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P +Y +I++ AH+PI+ FGGTFLMMV L +FFN + ++HWI  LE  M+  + IKGI+I
Sbjct: 121 EPAEYARIMNDAHLPIAAFGGTFLMMVGLNYFFNHEKQVHWIGGLEKMMARSATIKGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   E   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 181 AFVLALMLVFSWLIGGEEATVFVHCAIYGLLTFLAVEVVGGLLDASQQTMSAAAKGGLGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 241 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +LSVIM+ QT+V IPE+ TG     LI LS++SSI++ 
Sbjct: 301 HGAFYAILILSVIMYAQTMVHIPEVITGLGGAALIGLSLWSSIRHN 346


>gi|227820093|ref|YP_002824064.1| hypothetical protein NGR_b18640 [Sinorhizobium fredii NGR234]
 gi|227339092|gb|ACP23311.1| integral membrane protein [Sinorhizobium fredii NGR234]
          Length = 362

 Score =  401 bits (1031), Expect = e-110,   Method: Composition-based stats.
 Identities = 165/346 (47%), Positives = 246/346 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +   +S + +F+WA L T AG + G  +GWQ T TLSG ++  ++C +LAV+EISLS
Sbjct: 1   MTQSRSQSSTLDYFKWAFLTTAAGLILGAWVGWQSTGTLSGMMTVFFVCAVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGI+IAVFGMRI+FP++IV I + I PI+A+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGIIIAVFGMRIVFPLLIVVIAANIGPIDAVILAAA 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+  AH+PI+ FGGTFLMMV L +FF+ +  +HWI ++E  M+  + I+GI+I
Sbjct: 121 RPEEYSRIMHDAHLPIAAFGGTFLMMVGLNYFFDHEKDVHWIAWIERKMARFATIRGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L   E  +FV ++   ++ F  +  +  +L +         + G   
Sbjct: 181 AFVLALILGFSTLLEGEEAVAFVHAAVYGLLTFLVVEIVGGLLDATEQTMSAAARGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTVMLVEKGTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I VLSV+M+ QT+V IPE+ TG     LI LS++SSI++ 
Sbjct: 301 HGAFYAILVLSVVMYFQTLVHIPEVITGLGGAGLIGLSLWSSIRHN 346


>gi|126462873|ref|YP_001043987.1| hypothetical protein Rsph17029_2112 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104537|gb|ABN77215.1| protein of unknown function DUF475 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 360

 Score =  399 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 160/344 (46%), Positives = 232/344 (67%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           + +   S I +F WA   TV G   G  +GWQ T T+ GT +  +IC +LAV+EISLSF+
Sbjct: 2   TTASGKSTISYFTWAFAFTVVGLALGGFLGWQTTGTIEGTATIFFICCVLAVLEISLSFD 61

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NAI+NA  L+ M+  WQ RFLTWGI+IAVFGMRIIFP++IV I + + P EA+ LA   P
Sbjct: 62  NAIVNANKLKTMTPEWQHRFLTWGIIIAVFGMRIIFPLLIVVIAAHLGPWEALKLAATQP 121

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
            +Y +I+ +AH PI+ FGGTFLMMV LT+FF+ +  +HW+ ++E   S  S I+G+++ +
Sbjct: 122 AEYSRIMHEAHTPIAAFGGTFLMMVGLTYFFDQEKDIHWVRWIEEQASRYSSIRGVEVAV 181

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFL 242
           VL  + G S +L   E   F++S+   ++ F  +  L   L           K G   FL
Sbjct: 182 VLCAVLGFSRLLEGAEQQVFINSALYGLLTFLLVEVLGGFLDHRQQALDAAAKGGFGAFL 241

Query: 243 YLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           YLE++DAS S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG
Sbjct: 242 YLEVLDASFSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVERGTLAQYRYLEHG 301

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           ++Y+I +LSVIM++QT+  IPE+ TG     LI +S++SSI+  
Sbjct: 302 AFYAILILSVIMYVQTLTHIPEVITGLGGAGLIGISLWSSIRWN 345


>gi|119383066|ref|YP_914122.1| hypothetical protein Pden_0312 [Paracoccus denitrificans PD1222]
 gi|119372833|gb|ABL68426.1| protein of unknown function DUF475 [Paracoccus denitrificans
           PD1222]
          Length = 364

 Score =  399 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 160/345 (46%), Positives = 234/345 (67%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
            +N  +   +H+F+W+ +VT  G   G  +GWQ T T+ GT++  +IC +LAV+EISLSF
Sbjct: 12  STNGTHRPTLHYFKWSFIVTALGLALGAVLGWQTTGTVGGTLTIFFICAVLAVLEISLSF 71

Query: 62  ENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYS 121
           +NAI+NA  L++M+  WQ+RFLTWGILIAVFGMRI+FP++IV I + I P +AM LA   
Sbjct: 72  DNAIVNANKLKEMTPKWQRRFLTWGILIAVFGMRIVFPLLIVVIAANIGPWQAMVLAASQ 131

Query: 122 PQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIF 181
           P +Y +I+  AH+PI+ FGGTFLMMV L+FFF+ +  +HW+ +LE  M   + ++GI++ 
Sbjct: 132 PDEYSRIMHDAHLPIAAFGGTFLMMVGLSFFFDHEKDVHWVRWLEHRMQRYATVRGIEVA 191

Query: 182 IVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLF 241
           +VL  +   S  L   +   F  S+   ++ F  +  L  +L S         K G+  F
Sbjct: 192 VVLVTVLIFSRFLEGADSQVFFHSAIWGLLTFLLVEVLGGLLDSSQEAMQAGAKGGIGAF 251

Query: 242 LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEH 301
           LYLE++DAS S DGVI +FA+T N F+I IGL IGA+YVRSMT++++++G L +Y++LEH
Sbjct: 252 LYLEVLDASFSFDGVIGAFALTHNLFVIAIGLGIGAMYVRSMTIMLVERGTLAEYRFLEH 311

Query: 302 GSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           G++Y+I  LSVIMF+Q +V IPE+ TG     LI +S +SSI+  
Sbjct: 312 GAFYAIIALSVIMFVQPLVHIPEVITGLGGATLIGISFWSSIRWN 356


>gi|221639890|ref|YP_002526152.1| hypothetical protein RSKD131_1791 [Rhodobacter sphaeroides KD131]
 gi|221160671|gb|ACM01651.1| Hypothetical Protein RSKD131_1791 [Rhodobacter sphaeroides KD131]
          Length = 360

 Score =  399 bits (1025), Expect = e-109,   Method: Composition-based stats.
 Identities = 160/344 (46%), Positives = 232/344 (67%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           + +   S I +F WA   TV G   G  +GWQ T T+ GT +  +IC +LAV+EISLSF+
Sbjct: 2   TTASGKSTISYFTWAFAFTVVGLALGGFLGWQTTGTIEGTATIFFICCVLAVLEISLSFD 61

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NAI+NA  L+ M+  WQ RFLTWGI+IAVFGMRIIFP++IV I + + P EA+ LA   P
Sbjct: 62  NAIVNANKLKTMTPEWQHRFLTWGIIIAVFGMRIIFPLLIVVIAAHLGPWEALKLAATQP 121

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
            +Y +I+ +AH PI+ FGGTFLMMV LT+FF+ +  +HW+ ++E   S  S I+G+++ +
Sbjct: 122 AEYSRIMHEAHTPIAAFGGTFLMMVGLTYFFDQEKDIHWVRWIEEQASRYSSIRGVEVAV 181

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFL 242
           VL  + G S +L   E   F++S+   ++ F  +  L   L           K G   FL
Sbjct: 182 VLCAVLGFSRLLEGAEQQVFINSALYGLLTFLLVEVLGGFLDHRQQALDAAAKGGFGAFL 241

Query: 243 YLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           YLE++DAS S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG
Sbjct: 242 YLEVLDASFSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVERGTLAQYRYLEHG 301

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           ++Y+I +LSVIM++QT+  IPE+ TG     LI +S++SSI+  
Sbjct: 302 AFYAILILSVIMYVQTLTHIPEVITGLGGAGLIGISLWSSIRWN 345


>gi|77464028|ref|YP_353532.1| hypothetical protein RSP_0459 [Rhodobacter sphaeroides 2.4.1]
 gi|77388446|gb|ABA79631.1| hypothetical protein RSP_0459 [Rhodobacter sphaeroides 2.4.1]
          Length = 360

 Score =  398 bits (1024), Expect = e-109,   Method: Composition-based stats.
 Identities = 159/344 (46%), Positives = 232/344 (67%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           + +   S I +F WA   T+ G   G  +GWQ T T+ GT +  +IC +LAV+EISLSF+
Sbjct: 2   TTASGKSTISYFTWAFAFTLVGLALGGFLGWQTTGTIEGTATIFFICCVLAVLEISLSFD 61

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NAI+NA  L+ M+  WQ RFLTWGI+IAVFGMRIIFP++IV I + + P EA+ LA   P
Sbjct: 62  NAIVNANKLKTMTPEWQHRFLTWGIIIAVFGMRIIFPLLIVVIAAHLGPWEALKLAATQP 121

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
            +Y +I+ +AH PI+ FGGTFLMMV LT+FF+ +  +HW+ ++E   S  S I+G+++ +
Sbjct: 122 AEYSRIMHEAHTPIAAFGGTFLMMVGLTYFFDQEKDIHWVRWIEEQASRYSSIRGVEVAV 181

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFL 242
           VL  + G S +L   E   F++S+   ++ F  +  L   L           K G   FL
Sbjct: 182 VLCAVLGFSRLLEGAEQQVFINSALYGLLTFLLVEVLGGFLDHRQQALDAAAKGGFGAFL 241

Query: 243 YLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           YLE++DAS S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG
Sbjct: 242 YLEVLDASFSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVERGTLAQYRYLEHG 301

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           ++Y+I +LSVIM++QT+  IPE+ TG     LI +S++SSI+  
Sbjct: 302 AFYAILILSVIMYVQTLTHIPEVITGLGGAGLIGISLWSSIRWN 345


>gi|222087106|ref|YP_002545641.1| hypothetical protein Arad_3862 [Agrobacterium radiobacter K84]
 gi|221724554|gb|ACM27710.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 366

 Score =  398 bits (1022), Expect = e-109,   Method: Composition-based stats.
 Identities = 168/346 (48%), Positives = 236/346 (68%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M   +   S++ +F WA  VT AG   G  +GW  T T  G  +  +IC +LAV+EISLS
Sbjct: 1   MTQPTSSKSVLGYFGWAFAVTAAGLALGALLGWNATGTFGGLATAFFICAVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQ RFLTWGI+IAVFGMRIIFP+ IV I + INP EA+ LA  
Sbjct: 61  FDNAIVNANKLKEMTPLWQHRFLTWGIVIAVFGMRIIFPLAIVAIAAWINPWEALKLAAA 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P+ Y +I+  AH+PI+ FGGTFLMMV LT+FFN +  +HWI F+E AM+  + IKGI+I
Sbjct: 121 EPEQYARIMHDAHLPIAAFGGTFLMMVGLTYFFNHEKDVHWIAFVEKAMARFATIKGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL +I   S++L   +  +F+ +S   ++ F  +  L   L +         K G   
Sbjct: 181 AFVLILILVFSSLLDGEDSTTFLHASIYGLLTFLLVEVLAGFLDASQKTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L  Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLAHYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +LSVIM++QT++ IPE+ TG     LI +S++SSI+  
Sbjct: 301 HGAFYAILILSVIMYVQTLMHIPEVITGLGGAALIGISLWSSIRYN 346


>gi|222107044|ref|YP_002547835.1| hypothetical protein Avi_6115 [Agrobacterium vitis S4]
 gi|221738223|gb|ACM39119.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 353

 Score =  397 bits (1021), Expect = e-108,   Method: Composition-based stats.
 Identities = 166/346 (47%), Positives = 243/346 (70%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M + +   S++ +F+WA +VT+AG   G  +GW  T TL G  S  +IC +LAV+EISLS
Sbjct: 1   MSTATSSNSVLSYFKWAFIVTIAGLALGAWLGWNMTGTLGGMASVFFICAVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQ+RFLTWGILIAVFGMRIIFP+ IV I + I PIEA+ LA  
Sbjct: 61  FDNAIVNANKLKEMTPVWQQRFLTWGILIAVFGMRIIFPLAIVAIAAQIGPIEALKLAAA 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P +Y +I+++AH+PI+ FGGTFLMMV L +FF+ +  +HWI F+E  M+  + IKGI++
Sbjct: 121 EPAEYARIMNEAHLPIAAFGGTFLMMVGLNYFFDQEKDVHWIAFIEKHMARYASIKGIEV 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL +I   S+ L   E  +F+ S+   ++ F  +  +  +L +         K GL  
Sbjct: 181 AFVLVLILLFSSFLEGAEAITFLYSAIYGLLTFLAVELVGGLLDASQQTMSAAAKGGLGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL +GA+YVRSMT++++++G L +Y+YLE
Sbjct: 241 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGVGAMYVRSMTIMLVEKGTLAEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +LSVIM+ QT+V IPE+ TG     LI +S++SSI+  
Sbjct: 301 HGAFYAILILSVIMYCQTLVHIPEVITGLGGAALIGISLWSSIRYN 346


>gi|325291647|ref|YP_004277511.1| hypothetical protein AGROH133_03244 [Agrobacterium sp. H13-3]
 gi|325059500|gb|ADY63191.1| hypothetical protein AGROH133_03244 [Agrobacterium sp. H13-3]
          Length = 368

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 154/351 (43%), Positives = 238/351 (67%), Gaps = 8/351 (2%)

Query: 4   NSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFEN 63
           ++   + + +F+WA +VT+ G + G  +GW+ T T+SGT +  +IC +LAV+EISLSF+N
Sbjct: 2   SAAQKTTLSYFKWAFIVTIVGLILGGYLGWEMTGTVSGTATIFFICAVLAVLEISLSFDN 61

Query: 64  AILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQ 123
           AI+NA  L++M+ +WQ RFLTWGILIAVFGMRI+FP++IV + + + P  A+ +A   P+
Sbjct: 62  AIVNANKLKEMTPVWQHRFLTWGILIAVFGMRIVFPLLIVVVAANVGPWTALVMAATQPE 121

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV 183
            Y +I+  AH+PI+ FGGTFLMMV L FFF+ +  +HW+ ++E   +  S +KGI+I  V
Sbjct: 122 RYAEIMRDAHLPIAAFGGTFLMMVGLNFFFDHEKDVHWVRWIEEKAAVYSSVKGIEIAFV 181

Query: 184 LSIIFGISNILPTNE--------MYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
           L ++   S I+  ++          +F  ++   ++ F  +  +  +L           K
Sbjct: 182 LVVMLAFSRIIGASDNPELGPVAANTFFHAAIWGLLTFLLVEVVGGILDRSQEVLEGAAK 241

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
            G   FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L +
Sbjct: 242 GGFGAFLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLAE 301

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           Y+YLEHG++Y+I +LSVIM++QT+  IPE+ TG     LI +S++SSI++ 
Sbjct: 302 YRYLEHGAFYAILILSVIMYVQTMFHIPEVITGLGGATLIGISLWSSIRHN 352


>gi|15887561|ref|NP_353242.1| hypothetical protein Atu0209 [Agrobacterium tumefaciens str. C58]
 gi|15155096|gb|AAK86027.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 368

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 155/351 (44%), Positives = 236/351 (67%), Gaps = 8/351 (2%)

Query: 4   NSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFEN 63
           ++   + + +F+WA +VTV G + G  +GW+ T T+ GT +  +IC +LAV+EISLSF+N
Sbjct: 2   SAAQKTTLSYFKWAFIVTVVGLILGGYLGWEMTGTIGGTATIFFICAVLAVLEISLSFDN 61

Query: 64  AILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQ 123
           AI+NA  L+ M+ +WQ RFLTWGILIAVFGMRI+FP++IV + + + P  A+ +A   P+
Sbjct: 62  AIVNANKLKDMTPVWQHRFLTWGILIAVFGMRIVFPLLIVVVAANVGPWTALVMAATQPE 121

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV 183
            Y +I+  AH+PI+ FGGTFLMMV L FFF+ +  +HW+ ++E   +  S +KGI+I  V
Sbjct: 122 RYAEIMRDAHLPIAAFGGTFLMMVGLNFFFDHEKDVHWVRWIEEKAATYSSVKGIEIAFV 181

Query: 184 LSIIFGISNILPTNE--------MYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
           L ++   S I+  ++          +F  S+   ++ F  +  +  +L           K
Sbjct: 182 LIVMLVFSRIIGASDNPELGPVAANTFFHSAIWGLLTFLLVEVVGGILDRSQEMLEGAAK 241

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
            G   FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L +
Sbjct: 242 GGFGAFLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLAE 301

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           Y+YLEHG++Y+I +LSVIM++QT+  IPE+ TG     LI +S++SSI++ 
Sbjct: 302 YRYLEHGAFYAILILSVIMYVQTMFHIPEVITGLGGATLIGISLWSSIRHN 352


>gi|146278415|ref|YP_001168574.1| hypothetical protein Rsph17025_2380 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556656|gb|ABP71269.1| protein of unknown function DUF475 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 361

 Score =  391 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 157/344 (45%), Positives = 235/344 (68%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           +++   S + +F WA L T  G   G  +GW  T T+ GT +  +IC +LAV+EISLSF+
Sbjct: 2   TSAGPKSTVSYFTWAFLFTALGLALGGYLGWATTGTIEGTATIFFICCVLAVLEISLSFD 61

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NAI+NA  L+ M+  WQ+RFLTWGILIAVFGMRI+FP++IV I +++ P EA+ LA   P
Sbjct: 62  NAIVNANKLKTMTPKWQRRFLTWGILIAVFGMRIVFPLLIVVIAASLGPWEAVKLAATQP 121

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
            +Y +I+ +AH PI+ FGGTFLMMV LT+FF+ +  +HW+ ++E   S  S I+G+++ +
Sbjct: 122 AEYSRIMHEAHTPIAAFGGTFLMMVGLTYFFDQEKDIHWVRWIEEQASRYSSIRGVEVAV 181

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFL 242
           VL  + G S +L   E   F++S+   ++ F  +  L   L           K G+  FL
Sbjct: 182 VLCAVLGFSRLLEGAEQQVFLNSAIYGLLTFLLVEVLGGFLDHRQQALDAAAKGGVGAFL 241

Query: 243 YLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           YLE++DAS S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG
Sbjct: 242 YLEVLDASFSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVERGTLAQYRYLEHG 301

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           ++Y+I +LS+IM++QT+  IPE+ TG     LI +S++SSI+  
Sbjct: 302 AFYAILILSLIMYVQTLTHIPEVITGLGGAGLIGISLWSSIRWN 345


>gi|84499490|ref|ZP_00997778.1| hypothetical protein OB2597_06165 [Oceanicola batsensis HTCC2597]
 gi|84392634|gb|EAQ04845.1| hypothetical protein OB2597_06165 [Oceanicola batsensis HTCC2597]
          Length = 357

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 160/336 (47%), Positives = 243/336 (72%), Gaps = 1/336 (0%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           I +F WA  VT AG + G  +GW  + T+ GT++  +IC +LAV+EISLSF+NAI+NA  
Sbjct: 18  ISYFFWAFAVTAAGLILGGWLGWAGSRTVEGTLTIFFICAVLAVLEISLSFDNAIVNANK 77

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ MS +WQ+RFLTWGILIAVFGMRI+FP++IV + + I P+EA+ LA   P+ Y +I+ 
Sbjct: 78  LKDMSPVWQRRFLTWGILIAVFGMRIVFPLLIVVVAADIGPVEAIRLAASEPEAYARIMH 137

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +AH+ I+ FGGTFLMMV L FFF+ +  +HW+ +LE  ++  + +KGI+I +VL ++  I
Sbjct: 138 EAHLSIAAFGGTFLMMVGLGFFFDHEKDIHWVRWLEERIARYASVKGIEIALVLGVVMAI 197

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           S +   ++ +SF+ S+   +I F  +  L  +L   +    T  + GL  FLYLE++DAS
Sbjct: 198 SQLHGGDKGHSFLVSAIWGLITFLAVEVLGGILD-RNEAMKTGAQGGLGAFLYLEVLDAS 256

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L++Y+YLEHG++Y+I +L
Sbjct: 257 FSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLSQYRYLEHGAFYAITIL 316

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +VIMFLQ+ V+IPE+ TG    +LI ++++SSI+  
Sbjct: 317 AVIMFLQSFVEIPEVITGLGGALLIGVALWSSIRWN 352


>gi|307309387|ref|ZP_07589046.1| protein of unknown function DUF475 [Sinorhizobium meliloti BL225C]
 gi|306900117|gb|EFN30736.1| protein of unknown function DUF475 [Sinorhizobium meliloti BL225C]
          Length = 365

 Score =  385 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 167/346 (48%), Positives = 246/346 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +S   + + +F+WA +VT AG L G  +GWQ T T+ G ++  +IC +LAV+EISLS
Sbjct: 1   MTGSSAQTTALGYFKWAFIVTAAGLLLGGWLGWQSTGTIGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I + I PI+A+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAAGIGPIDAVILAAS 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 RPEEYSRIMHEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L   E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSRLLEAEEAVVFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +LSV+M+ QT++ IPE+ TG     LI LS++SSI++ 
Sbjct: 301 HGAFYAILILSVVMYFQTLIHIPEVITGLGGAGLIGLSLWSSIRHN 346


>gi|307321370|ref|ZP_07600769.1| protein of unknown function DUF475 [Sinorhizobium meliloti AK83]
 gi|306893015|gb|EFN23802.1| protein of unknown function DUF475 [Sinorhizobium meliloti AK83]
          Length = 365

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 167/346 (48%), Positives = 246/346 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +S   + + +F+WA +VT AG L G  +GWQ T T+ G ++  +IC +LAV+EISLS
Sbjct: 1   MTGSSAQTTALGYFKWAFIVTAAGLLLGGWLGWQSTGTIGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I + I PI+A+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAAGIGPIDAVILAAA 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 RPEEYSRIMHEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L   E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSRLLEAEEAVIFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +LSV+M+ QT++ IPE+ TG     LI LS++SSI++ 
Sbjct: 301 HGAFYAILILSVVMYFQTLIHIPEVITGLGGAGLIGLSLWSSIRHN 346


>gi|16265042|ref|NP_437834.1| hypothetical protein SM_b21468 [Sinorhizobium meliloti 1021]
 gi|15141181|emb|CAC49694.1| conserved hypothetical membrane protein [Sinorhizobium meliloti
           1021]
          Length = 365

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 167/346 (48%), Positives = 247/346 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +S   + + +F+WA +VT AG L G  +GWQ T T+ G ++  +IC +LAV+EISLS
Sbjct: 1   MTGSSAQTTALGYFKWAFIVTAAGLLLGGWLGWQSTGTIGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I + I+PI+A+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAAGISPIDAVILAAS 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 RPEEYSRIMLEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L   E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSRLLEAEEAVVFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HG++Y+I +LSV+M+ QT++ IPE+ TG     LI LS++SSI++ 
Sbjct: 301 HGAFYAILILSVVMYFQTLIHIPEVITGLGGAGLIGLSLWSSIRHN 346


>gi|239832345|ref|ZP_04680674.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824612|gb|EEQ96180.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 385

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 147/338 (43%), Positives = 227/338 (67%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           + + +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA
Sbjct: 32  ATLRYFIWPMVFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNA 91

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L+ M+  WQ RFLTWGI+IAVFGMRIIFP+ IV +    +PI A+ LAI+ P +Y ++
Sbjct: 92  RILRDMTPEWQHRFLTWGIIIAVFGMRIIFPLAIVAVAMWTDPISALKLAIWQPDEYARV 151

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           IS++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I 
Sbjct: 152 ISESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIKAIESRMSKFASVQGVEIGVAIALII 211

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
             S  L     ++F+ ++   ++ F  +  L  VL +         + GL  F+YLE++D
Sbjct: 212 FFSYQLDAEHSHTFLIAALFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLD 271

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T N FII IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I 
Sbjct: 272 ASFSFDGVIGAFALTTNLFIIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAIL 331

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VL+VIM++QT+V IPE+ TG     LI LS  SS++  
Sbjct: 332 VLAVIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRYN 369


>gi|254710506|ref|ZP_05172317.1| hypothetical protein BpinB_09617 [Brucella pinnipedialis B2/94]
 gi|256031999|ref|ZP_05445613.1| hypothetical protein BpinM2_15384 [Brucella pinnipedialis
           M292/94/1]
 gi|261318075|ref|ZP_05957272.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|265989108|ref|ZP_06101665.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|261297298|gb|EEY00795.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|264661305|gb|EEZ31566.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 353

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/335 (43%), Positives = 225/335 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRTIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +IM++QT+V IPE+ TG     LI LS  SS++  
Sbjct: 305 IIMYVQTLVHIPEVITGLIGVALIGLSFMSSLRYN 339


>gi|254708137|ref|ZP_05169965.1| hypothetical protein BpinM_14582 [Brucella pinnipedialis
           M163/99/10]
 gi|254714499|ref|ZP_05176310.1| hypothetical protein BcetM6_14398 [Brucella ceti M644/93/1]
 gi|254717397|ref|ZP_05179208.1| hypothetical protein BcetM_13527 [Brucella ceti M13/05/1]
 gi|256160197|ref|ZP_05457891.1| hypothetical protein BcetM4_14404 [Brucella ceti M490/95/1]
 gi|256255403|ref|ZP_05460939.1| hypothetical protein BcetB_14176 [Brucella ceti B1/94]
 gi|261219226|ref|ZP_05933507.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261222606|ref|ZP_05936887.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261315639|ref|ZP_05954836.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261322287|ref|ZP_05961484.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|265998571|ref|ZP_06111128.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260921190|gb|EEX87843.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260924315|gb|EEX90883.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294977|gb|EEX98473.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261304665|gb|EEY08162.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|262553195|gb|EEZ09029.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 353

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/335 (43%), Positives = 225/335 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRTIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +IM++QT+V IPE+ TG     LI LS  SS++  
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRYN 339


>gi|161619411|ref|YP_001593298.1| hypothetical protein BCAN_A1500 [Brucella canis ATCC 23365]
 gi|254704721|ref|ZP_05166549.1| hypothetical protein Bsuib36_12542 [Brucella suis bv. 3 str. 686]
 gi|260566032|ref|ZP_05836502.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261755414|ref|ZP_05999123.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|161336222|gb|ABX62527.1| protein of unknown function DUF475 [Brucella canis ATCC 23365]
 gi|260155550|gb|EEW90630.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261745167|gb|EEY33093.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 353

 Score =  381 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/335 (43%), Positives = 225/335 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICTVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +IM++QT+V IPE+ TG     LI LS  SS++  
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRYN 339


>gi|306844362|ref|ZP_07476953.1| integral membrane protein [Brucella sp. BO1]
 gi|306275298|gb|EFM57045.1| integral membrane protein [Brucella sp. BO1]
          Length = 353

 Score =  381 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/335 (43%), Positives = 225/335 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +IM++QT+V IPE+ TG     LI LS  SS++  
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRYN 339


>gi|23502334|ref|NP_698461.1| hypothetical protein BR1465 [Brucella suis 1330]
 gi|163843717|ref|YP_001628121.1| hypothetical protein BSUIS_A1518 [Brucella suis ATCC 23445]
 gi|254702184|ref|ZP_05164012.1| hypothetical protein Bsuib55_15179 [Brucella suis bv. 5 str. 513]
 gi|254719495|ref|ZP_05181306.1| hypothetical protein Bru83_08128 [Brucella sp. 83/13]
 gi|261752754|ref|ZP_05996463.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|265984504|ref|ZP_06097239.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294852787|ref|ZP_06793460.1| hypothetical protein BAZG_01721 [Brucella sp. NVSL 07-0026]
 gi|306839274|ref|ZP_07472091.1| integral membrane protein [Brucella sp. NF 2653]
 gi|306843180|ref|ZP_07475796.1| integral membrane protein [Brucella sp. BO2]
 gi|23348314|gb|AAN30376.1| membrane protein, putative [Brucella suis 1330]
 gi|163674440|gb|ABY38551.1| protein of unknown function DUF475 [Brucella suis ATCC 23445]
 gi|261742507|gb|EEY30433.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|264663096|gb|EEZ33357.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294821376|gb|EFG38375.1| hypothetical protein BAZG_01721 [Brucella sp. NVSL 07-0026]
 gi|306286631|gb|EFM58198.1| integral membrane protein [Brucella sp. BO2]
 gi|306405821|gb|EFM62083.1| integral membrane protein [Brucella sp. NF 2653]
          Length = 353

 Score =  381 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/335 (43%), Positives = 225/335 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +IM++QT+V IPE+ TG     LI LS  SS++  
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRYN 339


>gi|85373895|ref|YP_457957.1| hypothetical protein ELI_05340 [Erythrobacter litoralis HTCC2594]
 gi|84786978|gb|ABC63160.1| conserved hypothetical membrane protein [Erythrobacter litoralis
           HTCC2594]
          Length = 352

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/341 (42%), Positives = 237/341 (69%), Gaps = 3/341 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ ++ +++  T   F      GW  T T+ GT+S ++I  +L+++E+SLSF+NA++NA
Sbjct: 3   TLLRYYTFSLAFTAVCFGLAAWYGWASTGTIWGTLSLLWIVFVLSILEVSLSFDNAVVNA 62

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M  +WQ+RFLT GILIAVFGMRI+FPI IV I + + P+EA+ L++  PQ+Y +I
Sbjct: 63  TVLREMDPVWQQRFLTIGILIAVFGMRIVFPIAIVAIAADLGPVEAITLSLNEPQEYERI 122

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +S+AH+ I+GFGG FL MV LTFFF+S+  +HWI  +E A++ +S +  ++I +VL++++
Sbjct: 123 VSEAHLGIAGFGGAFLAMVGLTFFFDSEKNVHWIGKIERAINRVSTVPAVEIGLVLALVY 182

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLE 245
           G+S +L  +E  +F++++   ++ + G+N + S++    +     G   + GL  FLYLE
Sbjct: 183 GVSTLLTADEAMTFLTAAILGLLTYIGVNAVGSLIEQRETRKKAAGEIVRSGLGGFLYLE 242

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           ++DAS S DGVI +FA++ N  +I +GL++GA++VRSMT+ +++QG L +Y+YLEHG+++
Sbjct: 243 VLDASFSFDGVIGAFALSNNMIVIALGLSVGAMFVRSMTIHLVRQGTLAQYRYLEHGAFW 302

Query: 306 SIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +I VL VIM L     IPE  TG    ILI LS+  SI+  
Sbjct: 303 AIIVLGVIMLLSAKFHIPETITGLIGAILIGLSLLWSIRFN 343


>gi|62290356|ref|YP_222149.1| hypothetical protein BruAb1_1460 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700279|ref|YP_414853.1| hypothetical protein BAB1_1485 [Brucella melitensis biovar Abortus
           2308]
 gi|189024587|ref|YP_001935355.1| Protein of unknown function DUF475 [Brucella abortus S19]
 gi|225852945|ref|YP_002733178.1| hypothetical protein BMEA_A1515 [Brucella melitensis ATCC 23457]
 gi|237815860|ref|ZP_04594857.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254694148|ref|ZP_05155976.1| hypothetical protein Babob3T_05679 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697800|ref|ZP_05159628.1| hypothetical protein Babob28_08853 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730689|ref|ZP_05189267.1| hypothetical protein Babob42_05709 [Brucella abortus bv. 4 str.
           292]
 gi|256045092|ref|ZP_05447993.1| hypothetical protein Bmelb1R_11429 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256114022|ref|ZP_05454799.1| hypothetical protein Bmelb3E_14625 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256263573|ref|ZP_05466105.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260546896|ref|ZP_05822635.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565309|ref|ZP_05835793.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260758404|ref|ZP_05870752.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260762230|ref|ZP_05874573.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|261214447|ref|ZP_05928728.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|265991521|ref|ZP_06104078.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995359|ref|ZP_06107916.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|62196488|gb|AAX74788.1| hypothetical protein BruAb1_1460 [Brucella abortus bv. 1 str.
           9-941]
 gi|82616380|emb|CAJ11441.1| Protein of unknown function DUF475 [Brucella melitensis biovar
           Abortus 2308]
 gi|189020159|gb|ACD72881.1| Protein of unknown function DUF475 [Brucella abortus S19]
 gi|225641310|gb|ACO01224.1| protein of unknown function DUF475 [Brucella melitensis ATCC 23457]
 gi|237789158|gb|EEP63369.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260095946|gb|EEW79823.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151377|gb|EEW86471.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668722|gb|EEX55662.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672662|gb|EEX59483.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260916054|gb|EEX82915.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|262766472|gb|EEZ12261.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002305|gb|EEZ14880.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093624|gb|EEZ17629.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326409488|gb|ADZ66553.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326539194|gb|ADZ87409.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 353

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/335 (43%), Positives = 225/335 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLGIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +IM++QT+V IPE+ TG     LI LS  SS++  
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRYN 339


>gi|256061520|ref|ZP_05451664.1| hypothetical protein Bneo5_14300 [Brucella neotomae 5K33]
 gi|261325528|ref|ZP_05964725.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301508|gb|EEY05005.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 353

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 145/335 (43%), Positives = 224/335 (66%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +IM++Q +V IPE+ TG     LI LS  SS++  
Sbjct: 305 IIMYVQMLVHIPEVITGLIGAALIGLSFMSSLRYN 339


>gi|17986828|ref|NP_539462.1| hypothetical protein BMEI0545 [Brucella melitensis bv. 1 str. 16M]
 gi|17982462|gb|AAL51726.1| integral membrane protein [Brucella melitensis bv. 1 str. 16M]
          Length = 353

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/335 (43%), Positives = 225/335 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLGIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +IM++QT+V IPE+ TG     LI LS  SS++  
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSMRYN 339


>gi|254689657|ref|ZP_05152911.1| hypothetical protein Babob68_05689 [Brucella abortus bv. 6 str.
           870]
 gi|256257908|ref|ZP_05463444.1| hypothetical protein Babob9C_11296 [Brucella abortus bv. 9 str.
           C68]
 gi|260755185|ref|ZP_05867533.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260884200|ref|ZP_05895814.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297248742|ref|ZP_06932460.1| hypothetical protein BAYG_01708 [Brucella abortus bv. 5 str. B3196]
 gi|260675293|gb|EEX62114.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873728|gb|EEX80797.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297175911|gb|EFH35258.1| hypothetical protein BAYG_01708 [Brucella abortus bv. 5 str. B3196]
          Length = 353

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/335 (43%), Positives = 225/335 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGTVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLGIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +IM++QT+V IPE+ TG     LI LS  SS++  
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRYN 339


>gi|256369881|ref|YP_003107392.1| hypothetical protein BMI_I1477 [Brucella microti CCM 4915]
 gi|256000044|gb|ACU48443.1| hypothetical protein BMI_I1477 [Brucella microti CCM 4915]
          Length = 353

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/335 (43%), Positives = 225/335 (67%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +IM++QT+V IPE+ TG     LI LS  SS++  
Sbjct: 305 IIMYVQTLVPIPEVITGLIGAALIGLSFMSSLRYN 339


>gi|153009036|ref|YP_001370251.1| hypothetical protein Oant_1706 [Ochrobactrum anthropi ATCC 49188]
 gi|151560924|gb|ABS14422.1| protein of unknown function DUF475 [Ochrobactrum anthropi ATCC
           49188]
          Length = 355

 Score =  379 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 147/338 (43%), Positives = 227/338 (67%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           + + +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA
Sbjct: 2   ATLRYFIWPMVFTVLGLAGAVWLGFEMTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L+ M+  WQ RFLTWGI+IAVFGMRIIFP+ IV +    +PI A+ LAI+ P +Y ++
Sbjct: 62  RILRDMTPEWQHRFLTWGIIIAVFGMRIIFPLAIVAVAMWTDPISALKLAIWQPDEYARV 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           IS++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I 
Sbjct: 122 ISESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIKAIESRMSKFASVQGVEIGVAIALII 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
             S  L     ++F+ ++   ++ F  +  L  VL +         + GL  F+YLE++D
Sbjct: 182 FFSYQLDAEHSHTFLIAALFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T N FII IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVIGAFALTTNLFIIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VL+VIM++QT+V IPE+ TG     LI LS  SS++  
Sbjct: 302 VLAVIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRYN 339


>gi|225627910|ref|ZP_03785946.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260169136|ref|ZP_05755947.1| hypothetical protein BruF5_12406 [Brucella sp. F5/99]
 gi|261758643|ref|ZP_06002352.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|225617073|gb|EEH14119.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|261738627|gb|EEY26623.1| conserved hypothetical protein [Brucella sp. F5/99]
          Length = 353

 Score =  379 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/335 (43%), Positives = 224/335 (66%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+NA+ L
Sbjct: 5   RYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVNARIL 64

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y ++I++
Sbjct: 65  RDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYARVIAE 124

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           +H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I   S
Sbjct: 125 SHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRTIESRMSKFASVQGVEIGVAIALIIFFS 184

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             L  +  ++FV      ++ F  +  L  VL +         + GL  F+YLE++DAS 
Sbjct: 185 YQLDADHSHTFVIVGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVLDASF 244

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I VL+
Sbjct: 245 SFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAILVLA 304

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +IM++QT+V IPE+ TG     LI LS  SS++  
Sbjct: 305 IIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRYN 339


>gi|87200060|ref|YP_497317.1| hypothetical protein Saro_2044 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135741|gb|ABD26483.1| protein of unknown function DUF475 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 355

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 151/340 (44%), Positives = 230/340 (67%), Gaps = 3/340 (0%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  ++ +IL T+      +  GW  T T SGT+S V+I  +L+++EISLSF+NA++NA 
Sbjct: 1   MLRFYKGSILFTLVCLALAVAYGWMQTGTASGTMSLVWIVFVLSILEISLSFDNAVVNAA 60

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M  +WQKRFLTWG++IAVFGMRI+FP+ IV I + + PIEA+NL++  P+ Y +I+
Sbjct: 61  VLEDMDEVWQKRFLTWGMVIAVFGMRIVFPLAIVAIAAGLGPIEALNLSLKDPKRYEEIV 120

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           S AHV I+GFGG FL MV L+FFF+ + ++HWI ++E  ++ +S IK  +I ++L  I+G
Sbjct: 121 SSAHVGIAGFGGAFLAMVGLSFFFDGEKEVHWIKWVEEKLAVVSNIKAAEIALLLLSIYG 180

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
           IS ILP  E  +FV +    ++ F  +  L ++L          G   + GL  FLYL +
Sbjct: 181 ISLILPPEEALTFVVAGVLGLVTFIAVEALGTILEMREEAQKAAGVVVRSGLGGFLYLNV 240

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FA++ N  II +GL+IGA++VRSMT++++++G L++Y+YLEHG++++
Sbjct: 241 LDASFSFDGVIGAFALSNNMVIIALGLSIGAMFVRSMTIMLVQKGTLSEYRYLEHGAFWA 300

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I  L  IM L     IPE  TG     LI LS++ SI++K
Sbjct: 301 IIALGAIMLLSARYHIPETVTGLIGAALIGLSLWWSIRHK 340


>gi|254780228|ref|YP_003064641.1| hypothetical protein CLIBASIA_00565 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039905|gb|ACT56701.1| hypothetical protein CLIBASIA_00565 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 346

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 346/346 (100%), Positives = 346/346 (100%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS
Sbjct: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY
Sbjct: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
           SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI
Sbjct: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
           FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL
Sbjct: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE
Sbjct: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK
Sbjct: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346


>gi|289641606|ref|ZP_06473767.1| protein of unknown function DUF475 [Frankia symbiont of Datisca
           glomerata]
 gi|289508587|gb|EFD29525.1| protein of unknown function DUF475 [Frankia symbiont of Datisca
           glomerata]
          Length = 426

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 120/376 (31%), Positives = 200/376 (53%), Gaps = 49/376 (13%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F W++ +TVAG              +     T  I  ILAV+EISLSF+NA++NA  
Sbjct: 32  LRIFGWSLAITVAGVALA---------GVLDGPKTAAIVAILAVLEISLSFDNAVINATI 82

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++M+  WQK FLT G+LIAVFGMR++FPI+IV + + + PIE  +LA+ +P +Y   + 
Sbjct: 83  LRRMNEFWQKIFLTVGVLIAVFGMRLLFPIVIVALTAHLGPIEVFDLALNNPDEYATRLH 142

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FL M+ L F F+ +  + W+ ++E  +    ++  +   + L  +  +
Sbjct: 143 DAHPAIAAFGGIFLFMIFLDFMFDPERDVQWLRWIEEPLRRAGQLDVLSAVVALVALLIV 202

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSS------------------------- 225
           +     +     +++  A I  + G+  L     +                         
Sbjct: 203 AEAFSGDATQQVLTAGVAGIATYLGVRGLGEFFEARGVGADDDDAQEAEKDTGDATAVVP 262

Query: 226 ---------------DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIV 270
                           ++  +  GK    LF+YLE++DAS S DGV+ +FAIT+  F+I 
Sbjct: 263 AGAASTAEATGGKGGPNALVLASGKAAFFLFMYLEVLDASFSFDGVVGAFAITQEIFVIA 322

Query: 271 IGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTS 330
            GL IGA+Y+RS+T+ ++++G L +Y YLEHG++Y+I  L+VI+ +    ++PEI TG  
Sbjct: 323 AGLGIGAMYIRSITVYLVRKGTLQEYVYLEHGAHYAIGALAVILAVSIETEVPEIITGLV 382

Query: 331 STILIFLSIYSSIKNK 346
               I +++ SS++ +
Sbjct: 383 GVGFIGVALVSSLRRR 398


>gi|332185742|ref|ZP_08387489.1| integral membrane TerC family protein [Sphingomonas sp. S17]
 gi|332014100|gb|EGI56158.1| integral membrane TerC family protein [Sphingomonas sp. S17]
          Length = 362

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 142/338 (42%), Positives = 217/338 (64%), Gaps = 1/338 (0%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+ +++ + L T         +G+Q T TL GT+S ++I  +L V+E+SLSF+NA++NA 
Sbjct: 2   LLKYYKGSFLFTGICLAIAAWLGFQSTGTLPGTLSVLWIVAVLGVLEVSLSFDNAVVNAT 61

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M   W++RFLTWGILIAVFGMRI+FP+ IV I + + PIEA+ LA   P  Y +II
Sbjct: 62  VLRDMDDKWRRRFLTWGILIAVFGMRIVFPLAIVAIAAHMGPIEAIKLAAGDPVRYEQII 121

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AHV ISGFGG+FL MV L FF   +   HW+  +E  ++ L +I G+   IVL  ++ 
Sbjct: 122 TSAHVGISGFGGSFLAMVGLNFFLGDEKDEHWLGVIERPLAALREISGLATGIVLLALYT 181

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-SDSSNNVTHGKHGLNLFLYLEIID 248
           IS  +P  E  +F+++    ++ +  ++ +  +L     +      + G   FLYLE++D
Sbjct: 182 ISQFIPVEEAMTFLTAGIFGLLTYIAVHAVGVLLEGDGDAATGAAARSGFAAFLYLEVLD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA++ N FII +GL IGA++VRSMT++++ +G L +Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVIGAFALSNNLFIIALGLGIGAMFVRSMTIMLVDKGTLTQYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L+ IM L    +IPE  TG     LI LS ++S+++ 
Sbjct: 302 ALAAIMLLSVRFEIPETVTGLIGATLIGLSFWASVRSN 339


>gi|240850907|ref|YP_002972307.1| hypothetical integral membrane protein [Bartonella grahamii as4aup]
 gi|240268030|gb|ACS51618.1| hypothetical integral membrane protein [Bartonella grahamii as4aup]
          Length = 350

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 150/338 (44%), Positives = 230/338 (68%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           SL+ +F +A   T+ G   G  IGW  T +++G +   +IC +L V+EISLSF+N+I+NA
Sbjct: 2   SLLRYFGFAFFFTIIGVFLGGVIGWFETESITGFLKYFFICFVLGVLEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L +M  +W++RFL WGILIAVFGMRI+FP+++V +   INPI A+ LAI+ P  Y ++
Sbjct: 62  RVLSRMDPLWRRRFLIWGILIAVFGMRIVFPLLVVVVAVGINPIAAVKLAIWEPHRYAEV 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH+ I+ FGGTFLMMV L +FF+S+ ++HW++ +E        + GI I IVL +I 
Sbjct: 122 LTDAHMGIAAFGGTFLMMVGLKYFFDSEKEVHWLNVIERPAQKFGALVGIDIAIVLILIL 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
            +S  + T +  +F+ ++   ++ F G+  +  +L +      T    G+  FLYLE++D
Sbjct: 182 FVSAQIDTEDKITFLLAALYGLLTFIGVEVVGHLLDTPQKTLTTVTHGGVGAFLYLEVLD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+ +FA + N FII IGL IGA YVRSMT+++++ G L  Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRSMTIMLVESGTLLHYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VL+VIM+LQTI+ +PE+ TG     +I +++YSSI+ K
Sbjct: 302 VLAVIMYLQTIISVPEVLTGLVGVCIIGMALYSSIRFK 339


>gi|260576197|ref|ZP_05844190.1| protein of unknown function DUF475 [Rhodobacter sp. SW2]
 gi|259021677|gb|EEW24980.1| protein of unknown function DUF475 [Rhodobacter sp. SW2]
          Length = 346

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 153/336 (45%), Positives = 234/336 (69%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +FRWA + T  G +    +GW F+ TL+G +S + I  +LAV+EISLSF+NAI+NA  
Sbjct: 1   MQYFRWAFVFTAIGLVGAFWLGWLFSGTLAGGLSFLLIGSVLAVLEISLSFDNAIVNANK 60

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++M+ +WQ RFLTWGI+IAVFGMRIIFP++IV + + I P +A+ LA  +P +Y  II 
Sbjct: 61  LKEMTPVWQHRFLTWGIIIAVFGMRIIFPLLIVVVAAHIGPWQALKLAALNPAEYASIIG 120

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +AH+ I+ FGG FLMMV L +FF+    +HWI  LE  MS  S ++GI++ IVL+++   
Sbjct: 121 EAHLSIAAFGGAFLMMVGLKYFFDEGKDVHWIATLERTMSKFSSVQGIELAIVLAVVMVF 180

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           ++++P  E+ +F+ ++ A ++ F  +  L  +L +      +  + GL  FLYLE++DAS
Sbjct: 181 ASVMPEAEVATFLYAAVAGLLTFLLVEVLGHLLDASQQVIGSAARGGLGAFLYLEVLDAS 240

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++  L +++YLEHG+++SI +L
Sbjct: 241 FSFDGVIGAFALTQNLFLIAIGLGIGAMYVRSMTIMLVERNTLAEFRYLEHGAFWSILIL 300

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           S IMF QT+  IPE+ TG      I L++ SSI+ +
Sbjct: 301 SGIMFCQTLWHIPEVVTGLLGAGFIGLALLSSIRYR 336


>gi|163868728|ref|YP_001609940.1| hypothetical protein Btr_1608 [Bartonella tribocorum CIP 105476]
 gi|161018387|emb|CAK01945.1| conserved hypothetical membrane protein [Bartonella tribocorum CIP
           105476]
          Length = 349

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 150/338 (44%), Positives = 230/338 (68%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +F +A   T+ G   G  IGW  T +++G +   +IC +L V+EISLSF+N+I+NA
Sbjct: 2   ALLRYFGFAFFFTIIGVFLGGAIGWFETGSITGFLKYFFICCVLGVLEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L +M  +W++RFL WGILIAVFGMRI+FP+++V +   INPI A+ LAI  P  Y ++
Sbjct: 62  RVLGRMDPLWRRRFLIWGILIAVFGMRIVFPLLVVVVAVGINPIAAVKLAIGEPHRYAEV 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH+ I+ FGGTFLMMV L +FF+S+ ++HW+  +E +   L  + GI I IVL +I 
Sbjct: 122 LTDAHMGIAAFGGTFLMMVGLKYFFDSEKEVHWLSVIERSAQKLGALVGIDIAIVLILIL 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
            +S  +   +  +F+ ++   ++ F G+  +  +L +      T  + GL  FLYLE++D
Sbjct: 182 FVSGQIVAEDRVTFLLAALYGLLTFIGVEAVGHLLDAPKKTLTTVAQGGLGAFLYLEVLD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+ +FA + N FII IGL IGA YVRSMT+++++ G L  Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRSMTIMLVESGTLLHYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VL+VIM+LQTI+ +PE+ TG     +I +++YSSI+ K
Sbjct: 302 VLAVIMYLQTIIPVPEVLTGLVGICIIGIALYSSIRFK 339


>gi|149184855|ref|ZP_01863173.1| hypothetical protein ED21_29093 [Erythrobacter sp. SD-21]
 gi|148832175|gb|EDL50608.1| hypothetical protein ED21_29093 [Erythrobacter sp. SD-21]
          Length = 356

 Score =  370 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 138/338 (40%), Positives = 228/338 (67%), Gaps = 3/338 (0%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            ++ +++L T   F   +  GW  T +++ T+  ++I ++L+++E+SLSF+NA++NA  L
Sbjct: 6   KYYTFSLLFTAVCFALAVWYGWSSTGSITATLGILWIVVVLSILEVSLSFDNAVVNATVL 65

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + M  +WQ+RFLT GILIAVFGMRI+FPI IV + + + P EA++L++  PQ Y +I+S 
Sbjct: 66  RDMDPVWQQRFLTIGILIAVFGMRIVFPIAIVSLAAGVGPGEAVSLSLNDPQRYEQIVSD 125

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           AHV I+GFGG FL MV LTFFF     +HWI  LE  ++  S +  ++I +VLS+++G+S
Sbjct: 126 AHVSIAGFGGAFLAMVGLTFFFEEDKDVHWIAVLERTINKFSNVPAVEIGLVLSLVYGVS 185

Query: 192 NILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEIID 248
            +L  ++  +F++++   ++ F  ++ + +++ +  +     G   K GL  FLYLE++D
Sbjct: 186 TLLSPDDAITFLTAAILGLVTFIAVHAIAAIIEAQEARKKAAGEIVKSGLGGFLYLEVLD 245

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA++ N  II +GL++GA++VRSMT+ +++ G L +Y+YLEHG++++I 
Sbjct: 246 ASFSFDGVIGAFALSNNMIIIALGLSVGAMFVRSMTIHLVRTGTLAQYRYLEHGAFWAII 305

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VL +IM L     IPE  TG    +LI LS + S+++ 
Sbjct: 306 VLGIIMLLSARWHIPETVTGLLGAVLIGLSFWWSVRHN 343


>gi|119384926|ref|YP_915982.1| hypothetical protein Pden_2194 [Paracoccus denitrificans PD1222]
 gi|119374693|gb|ABL70286.1| protein of unknown function DUF475 [Paracoccus denitrificans
           PD1222]
          Length = 348

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 149/341 (43%), Positives = 229/341 (67%), Gaps = 2/341 (0%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            S + +  W  +VT AG      +GW++  T SG ++   I  ILAV+EISLSF+NAI+N
Sbjct: 2   RSTLSYMTWPFIVTGAGLALAAFLGWEYHGTGSGALAFFLIAGILAVLEISLSFDNAIVN 61

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L++M+  WQ+RFLTWGILIAVFGMR+IFP+++V I + + P EA+ LA   PQ+Y +
Sbjct: 62  ANKLKQMTPKWQRRFLTWGILIAVFGMRVIFPLLVVVIAAHLAPWEAIRLAATQPQEYSR 121

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           II +AH+PI+ FGG+FLM+V+L +FF+    + WI  +E A+  L +I+G+++  VL  +
Sbjct: 122 IIHEAHLPIAAFGGSFLMLVALNYFFDEAKDVDWIKGVEAALRKLGEIRGMEVGFVLVCM 181

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS--SDSSNNVTHGKHGLNLFLYLE 245
             I   LP  + ++F+ ++   +I +  ++ L  VL     +       + G   FLYLE
Sbjct: 182 LVIVGQLPAEKEHAFIIAAIWGVITYLLVDMLGHVLDRWGGAPQPADMARGGFGAFLYLE 241

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           ++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L  ++YLEHG+++
Sbjct: 242 VLDASFSFDGVIGAFALTQNLFLIAIGLGIGAMYVRSMTVMLVERGTLAAFRYLEHGAFW 301

Query: 306 SIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           SIFVLS++MF+QT+  IPE+ TG      I ++  SS+  +
Sbjct: 302 SIFVLSILMFVQTLRPIPEVVTGLLGACFIGMAFLSSLAWR 342


>gi|332187491|ref|ZP_08389228.1| integral membrane TerC family protein [Sphingomonas sp. S17]
 gi|332012420|gb|EGI54488.1| integral membrane TerC family protein [Sphingomonas sp. S17]
          Length = 370

 Score =  368 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 143/345 (41%), Positives = 223/345 (64%), Gaps = 8/345 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +  +F+ + +        G  IGW  TH ++GT+  ++I ++L V+E+SLSF+NA++NA 
Sbjct: 1   MFKYFKGSFVFAAICLAIGAWIGWTLTHDIAGTLGILWIVLVLGVLEVSLSFDNAVVNAT 60

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M+ +WQ+RFLTWGI+IAVFGMRI+FP++IV I + + PI+A+ LA   P  Y +II
Sbjct: 61  VLRDMTPVWQRRFLTWGIIIAVFGMRILFPLVIVAIAARLGPIDAVVLAATDPVAYERII 120

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AHV ISGFGG FL MV LTFF + +   HWI  +E   + LS+I G+ I IVL  ++ 
Sbjct: 121 TGAHVGISGFGGAFLAMVGLTFFLDEEKDSHWIGLIERPFAGLSRISGLAIGIVLLALYS 180

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN--------NVTHGKHGLNLF 241
           IS  +P  E  +F+++    ++ +  +  + ++L  D            V   K GL  F
Sbjct: 181 ISRAIPAEEAMTFLTAGIFGLLAYIAVQAVGAILEKDDEEPTSGNAAATVAVAKSGLAAF 240

Query: 242 LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEH 301
           LYLE++DAS S DGVI +FA++ N FII +GL IGA++VRSMT++++ +G L +Y+YLEH
Sbjct: 241 LYLEVLDASFSFDGVIGAFALSNNLFIIALGLGIGAMFVRSMTVMLVDKGTLTEYRYLEH 300

Query: 302 GSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           G++Y+I  L+ IM +   V++PE  TG      I +++++S++  
Sbjct: 301 GAFYAIIALAAIMLISIRVEVPETVTGLIGAAFIGMALFASVRAN 345


>gi|319899174|ref|YP_004159267.1| hypothetical protein BARCL_1015 [Bartonella clarridgeiae 73]
 gi|319403138|emb|CBI76696.1| conserved membrane protein of unknown function [Bartonella
           clarridgeiae 73]
          Length = 350

 Score =  368 bits (944), Expect = e-100,   Method: Composition-based stats.
 Identities = 148/338 (43%), Positives = 218/338 (64%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +FRW    T+ G   G  IGW  T T+ G +   +IC +L ++EISLSF+N+I+NA
Sbjct: 2   ALLGYFRWPFFFTIIGIFWGGLIGWLETGTIVGCLKYFFICCVLGILEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L  M+ +W++RFLTWGILIAVFGMRI+FP+++V + + INPI A+ LAI+ P  Y  I
Sbjct: 62  RFLGAMNQLWRRRFLTWGILIAVFGMRIVFPLLVVAVSAWINPIAAVKLAIWDPHQYAAI 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+ FGGTFLMMV L +FF+S+ K+HW+ F+E     L     I I ++L ++ 
Sbjct: 122 LTDAHNGIAAFGGTFLMMVGLKYFFDSEKKVHWLVFIEKPAQKLGSFVKIDIIVILMLML 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
             S  +        + +    ++ F  +  + S+L S     +   K G   FLYLE++D
Sbjct: 182 FFSYQIVAENKLIVLLAMLYGLLTFLIVEAICSLLDSQKDTLIAVSKGGAGSFLYLEVLD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           +S S DGVI +FA + N FII IGL IGA YVR+MT+++ + G L  Y+YLEHG++Y+I 
Sbjct: 242 SSFSFDGVIGAFAFSHNLFIIAIGLGIGAFYVRAMTIMLFETGTLLHYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VL+VIM++Q I+ IPE  TG     +I ++ YSSI+ K
Sbjct: 302 VLAVIMYMQIIMSIPEALTGLIGVCIIGIAFYSSIRFK 339


>gi|50086415|ref|YP_047925.1| hypothetical protein ACIAD3451 [Acinetobacter sp. ADP1]
 gi|49532391|emb|CAG70103.1| putative integral membrane protein [Acinetobacter sp. ADP1]
          Length = 360

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 130/354 (36%), Positives = 206/354 (58%), Gaps = 21/354 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAIL 66
           + HFR++I  TV      L   W +TH     +ST++    I  ILAV+E+SLSF+NA++
Sbjct: 1   MKHFRFSIFFTVICL--ALSAYWGYTHGPEAGLSTMFKALTITAILAVMEVSLSFDNAVV 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L+     W+  FLT GILIAVFGMR+IFP+ IV + + +  IE   +A+  P++Y 
Sbjct: 59  NASVLRGWDHFWKMLFLTVGILIAVFGMRLIFPVAIVAVTADMGMIEVAKMALNDPKNYS 118

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           + + Q H  I+ FGGTFL+MV L FFF+     HW  ++E  +++L+ I  + +F+ L  
Sbjct: 119 ERLMQHHAEIAAFGGTFLLMVFLNFFFDDGKDTHWFKWIEAKLANLANIPAMSVFVALVA 178

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVT 232
           +  ++  +  ++      +    ++++ G+  L  +L  +              S  +  
Sbjct: 179 MLIMAAYVSDDKRLVVTMAGIWGLVVYIGVQVLSHLLGGEPEIDENGNAIGHDGSGASTG 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K G   FLYLE++DAS S DGVI +FAIT +  II++GL IGA++VRSMT+ ++++G 
Sbjct: 239 VIKAGFGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAMFVRSMTVYLVEKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y YLEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 299 LDAYIYLEHGAHYAIGALAFIMLASGTGVHVPEVVTGLIGVAFIVWAVLASIQY 352


>gi|300114608|ref|YP_003761183.1| hypothetical protein Nwat_2028 [Nitrosococcus watsonii C-113]
 gi|299540545|gb|ADJ28862.1| protein of unknown function DUF475 [Nitrosococcus watsonii C-113]
          Length = 340

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 135/339 (39%), Positives = 210/339 (61%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HFR++ LVTV G +            L G  + ++I  IL V+EISLSF+NA++NA  
Sbjct: 1   MRHFRYSFLVTVVGLIAAF---------LWGGPAGLFIAAILGVLEISLSFDNAVVNASV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M   WQ RFLTWGILIAVFGMR++FP+ IV IV+ I  +E   +A+  P  Y   + 
Sbjct: 52  LKDMDPKWQARFLTWGILIAVFGMRLVFPVAIVAIVADIGMLEVTQMALNDPDTYSAHLH 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            +HV IS FGG FL+MV L+F  +   +LHW+   E  +S + K++ I+I I L +++ +
Sbjct: 112 ASHVDISAFGGMFLLMVFLSFLLDETKELHWLGRAEEKLSRIGKLESIEIVIALGVLWAL 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV---THGKHGLNLFLYLEII 247
            + LP  E    + +  + +++F  +     +   + +         + G+  FLYLE++
Sbjct: 172 QSFLPPEEKLGAMLAGISGVMLFVIVGSASGLFEVEETGEAVAHAAKRSGVMGFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAI+K+  II++GL IGA++VRS+T+ ++++G L++Y +LEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAISKDVIIIMLGLAIGAMFVRSITVYLVRKGTLSEYVFLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L++IM   T V IPE+ TG      I LS+ SSI+ +
Sbjct: 292 GALALIMLASTKVHIPEVITGMIGAAFIGLSLLSSIRYR 330


>gi|328882227|emb|CCA55466.1| Integral membrane protein [Streptomyces venezuelae ATCC 10712]
          Length = 381

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 126/368 (34%), Positives = 204/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  +T  G +  +         L G      I  IL V+EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAITALGLVAAV---------LYGGWEAFGIVAILCVLEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            LQKM++ WQK FLT G+LIAVFGMR++FP++IV I + I PIEA++LA+     Y +++
Sbjct: 53  ILQKMNAFWQKIFLTIGVLIAVFGMRLVFPVVIVAISAKIGPIEAVDLALNDADRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ ++E  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIF-EDRDIQWLRWIERPLAKLGKVDMLSVCIALIVLLV 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLS--------------- 224
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 172 SAMTFATHAHQHGGTHVDKAQTVLISGIAGLITYLVVGGLSGYFENKLEEEEEREHEAEE 231

Query: 225 ------SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    +     GK    +FLYLE++DAS S DGVI +FA+T +  ++ +GL +GA+
Sbjct: 232 AAKRSGKKVTAVQLAGKAAFFMFLYLEVLDASFSFDGVIGAFAVTNDIVLMALGLGVGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+V++ +    +IPE+ TG+   ILI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVLLLVTIQYEIPEVITGSIGVILIAWS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|85709685|ref|ZP_01040750.1| hypothetical protein NAP1_12408 [Erythrobacter sp. NAP1]
 gi|85688395|gb|EAQ28399.1| hypothetical protein NAP1_12408 [Erythrobacter sp. NAP1]
          Length = 350

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 140/337 (41%), Positives = 224/337 (66%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ HF  ++L T      G   GW    T+ G +S ++IC +LAV+E+SLSF+NA +NA 
Sbjct: 1   MLKHFWGSLLFTAVCLALGGWYGWALHGTIGGMLSILWICAVLAVLEVSLSFDNAAVNAS 60

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M  +WQ+RFLTWGI IAVFGMRI+FPI+IV + +++ PI+A+ LA+  P +Y +I+
Sbjct: 61  ILKDMDPVWQQRFLTWGIAIAVFGMRIVFPIVIVMVAASLGPIDAVRLALSDPAEYQRIV 120

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           S AH+ + GFGG FL MV L FFF++  +L+WI  +E  ++ ++ I+ I I +VL+  + 
Sbjct: 121 SDAHIGLMGFGGAFLGMVGLKFFFDADKELNWIASIERPLAKVADIEAISIGLVLAATWA 180

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S +L   +  +F+ ++   ++ +  +  +  VL   + ++    K G   FLYLE++DA
Sbjct: 181 TSTMLADADALTFIIAAIGGLLTYLAVEIVNHVLEPPTPSSGDVAKAGFGAFLYLEVLDA 240

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA+T N  II IGL IGA++VRSMT+ ++++G +++Y+YLEHG++Y+I  
Sbjct: 241 SFSFDGVIGAFALTNNLIIIAIGLGIGAMFVRSMTIFLVRKGTMSEYRYLEHGAFYAILA 300

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+ IM++ T   IPE+ TG    +LI L+ +SS++  
Sbjct: 301 LATIMYINTFSHIPEVITGLIGAVLIGLAFWSSVRAN 337


>gi|226953622|ref|ZP_03824086.1| integral membrane protein [Acinetobacter sp. ATCC 27244]
 gi|294651866|ref|ZP_06729157.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|226835625|gb|EEH68008.1| integral membrane protein [Acinetobacter sp. ATCC 27244]
 gi|292822255|gb|EFF81167.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 360

 Score =  364 bits (936), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 123/352 (34%), Positives = 205/352 (58%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFT--HTLSGTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  T+         G+       +S  +  + I +ILA++E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTIVCLALSAYWGYTHGPEAGISTMLKALTITVILAIMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GIL+AVFGMR+IFPI+IV + + +  +E + LA+  P+ Y + 
Sbjct: 61  SVLRNWDHFWKMLFLTVGILVAVFGMRLIFPILIVAVTADMGMMEVVKLALNDPKSYSER 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           + + H  I+ FGGTFL+MV L FFF+ + + HW  ++E  ++HL+ +  + +FI L  + 
Sbjct: 121 LMEHHPEIAAFGGTFLLMVFLNFFFDDEKETHWFRWIESKLAHLASVPAMSVFIALVAML 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +   +      +    I+++ G+  L  +L  +                 +    
Sbjct: 181 IMAAHVDEAKRLVVTMAGIWGIVVYIGVKVLSHLLGGEPEVDDNGNAVTQGADGASKGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K G+  FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ ++++G L+
Sbjct: 241 KAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y +LEHG++Y+I  L+ IM    T + +PE+ TG      I  ++ +SI+ 
Sbjct: 301 AYIFLEHGAHYAIGALAFIMIASGTGLHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|49474470|ref|YP_032512.1| hypothetical protein BQ09030 [Bartonella quintana str. Toulouse]
 gi|49239974|emb|CAF26381.1| hypothetical protein BQ09030 [Bartonella quintana str. Toulouse]
          Length = 350

 Score =  364 bits (936), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 151/338 (44%), Positives = 230/338 (68%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +F WA   T+ G   G  IGW  T ++ G +   +IC +L ++EISLSF+N+I+NA
Sbjct: 2   ALLGYFGWAFFFTIIGVFLGGAIGWFETGSVIGFLKYFFICCVLGILEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L KM  +W++RFL WGILIAVFGMRI+FP+++V +   I+P+ A+ LAI+ P  Y  I
Sbjct: 62  RVLAKMDPLWRRRFLVWGILIAVFGMRIVFPLLVVAVAVGISPVAAVKLAIWEPHQYATI 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +  +HV I+ FGGTFLMMV L +FF+S+ ++HW+ F+E     L  + GI I I+L++I 
Sbjct: 122 LMDSHVAIAAFGGTFLMMVGLKYFFDSEKEVHWLAFIERPAQKLGAVGGIDIAIILTLIL 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
             S  + T +  +F+ ++   ++ F G+  + S+L S  +      K G+  FLYLEI+D
Sbjct: 182 FFSGQVVTEDKIAFLLAALYGLLTFIGVEAISSLLDSPKTTLSAVFKGGVGAFLYLEILD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+ +FA + N FII IGL+IGA YVRSMT+++++ GIL  Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVVGAFAFSHNLFIIAIGLSIGAFYVRSMTIMLVESGILLHYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +L+VIM+LQT+V +PE+ TG     +I ++  SS++ K
Sbjct: 302 ILAVIMYLQTLVSVPEVLTGLVGVGIIGMAFCSSLRFK 339


>gi|182677243|ref|YP_001831389.1| hypothetical protein Bind_0244 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633126|gb|ACB93900.1| protein of unknown function DUF475 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 348

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 146/336 (43%), Positives = 220/336 (65%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +FR ++L T+        +GW  T T+SG +ST++I ++L V+EISLSF+NAI+NA  
Sbjct: 1   MRYFRGSLLFTILCLFLAGWLGWSLTGTISGVLSTLWIALVLGVLEISLSFDNAIVNATV 60

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ +  +W++RFL WGILIAV GMRI+FP+MIV I + I P++A+ LAI  P+ Y +II+
Sbjct: 61  LRGLDPVWRRRFLIWGILIAVVGMRILFPLMIVAIAAHIGPLDALFLAILEPRHYEQIIT 120

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H+ ISGFGG FL MVSL FFF+S  ++HWI   E  ++ L  +  I   IVL  ++ +
Sbjct: 121 DVHITISGFGGAFLAMVSLKFFFDSSKRVHWIGLFEKRLARLGDLDAITHTIVLLALYAV 180

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           S +L   +    + +    ++ F G+  + +VL           + GL+ FLYLE++DAS
Sbjct: 181 SRLLAPEDAAELIVAGIFGLVTFVGVEVIGNVLGGPGGRTGEVARVGLSGFLYLEVLDAS 240

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGV+ +FA+T N F+I +GL IGA++VRSMT++++ +G L++Y+YLEHG++Y+I  L
Sbjct: 241 FSFDGVVGAFALTNNLFVIALGLGIGAMFVRSMTVMLVDRGTLSEYRYLEHGAFYAILAL 300

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           + +M L    DIPE+ TG  S  LI LS+  SI   
Sbjct: 301 AGVMLLSARYDIPEVVTGLISACLIGLSLLGSILYN 336


>gi|49475870|ref|YP_033911.1| hypothetical protein BH11410 [Bartonella henselae str. Houston-1]
 gi|49238678|emb|CAF27925.1| hypothetical protein BH11410 [Bartonella henselae str. Houston-1]
          Length = 352

 Score =  363 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 151/337 (44%), Positives = 225/337 (66%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+ +  W    T+ G   G  IGW  T ++ G +   +IC +L V+EISLSF+N+I+NA+
Sbjct: 3   LVGYLGWPFFFTIIGVFLGGAIGWFETGSVIGFLKYFFICCVLGVLEISLSFDNSIINAR 62

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L++M  +W++RFL WGILIAVFGMR++FP+++V I   INPI A+ LAI+ P  Y  ++
Sbjct: 63  VLERMDPLWRRRFLVWGILIAVFGMRLVFPLLVVAIAVGINPIAAVKLAIWEPHHYAAVL 122

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  H+ I+ FGGTFLMMV L +FF+ + ++HW+ F+E     L  + GI I IVL +I  
Sbjct: 123 TDVHLAIAAFGGTFLMMVGLKYFFDPEKEVHWLVFIERPAQKLGALVGIDIAIVLVLILF 182

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  + T +   F+ +S   ++IF  +  + S+L +  +   T  K G   F YLEI+DA
Sbjct: 183 FSGQVVTEDKMVFLLASLYGLLIFIAVEAVSSLLDAPKTALTTVAKGGAGAFFYLEILDA 242

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGV+ +FA + N FII IGL+IGA YVRSMT+++++ GIL  Y+YLEHG++Y+I V
Sbjct: 243 SFSFDGVVGAFAFSHNLFIIAIGLSIGAFYVRSMTIMLVESGILLHYRYLEHGAFYAILV 302

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+VIM+LQT++ IPE+ TG     +I ++ YSS++ K
Sbjct: 303 LAVIMYLQTLLSIPEVLTGLVGVCIIGMAFYSSLRFK 339


>gi|292493000|ref|YP_003528439.1| hypothetical protein Nhal_2992 [Nitrosococcus halophilus Nc4]
 gi|291581595|gb|ADE16052.1| protein of unknown function DUF475 [Nitrosococcus halophilus Nc4]
          Length = 340

 Score =  363 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 134/339 (39%), Positives = 212/339 (62%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF+++ LVT  G +            L G  + ++I  IL+++E+SLSF+NA++NA  
Sbjct: 1   MRHFKYSFLVTAVGLIAAF---------LWGGPTGLFIAAILSILEVSLSFDNAVVNASV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M   WQ RFLTWGILIAVFGMR++FPI IV +V+ I  +E   +A+  P+ Y   + 
Sbjct: 52  LKDMDPKWQARFLTWGILIAVFGMRLVFPIAIVAVVADIEMLEVTQMALNDPETYSTHLL 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            +HV IS FGG FL+MV L+F  +   +LHW+  +E  ++ + K++ I+I I L++++G+
Sbjct: 112 ASHVEISAFGGMFLLMVFLSFLLDETKELHWLGIVEEKLAGIGKLESIEIVIALAVLWGL 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV---THGKHGLNLFLYLEII 247
             +LP  E  S + S  + I++F  +     +   +             GL  FLYLE++
Sbjct: 172 QGVLPPEEKLSALLSGISGIMLFVLVGSASGLFEEEEKGEAVVHAARHSGLMGFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAITK+  II++GL +GA++VRS+T+ ++++G L++Y +LEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAITKDVIIIMLGLAVGAMFVRSITVYLVRKGTLDEYVFLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L+ IM   T V IPE+ TG      I LS+ SS++ +
Sbjct: 292 GALAFIMLASTKVHIPEVITGLIGAAFIGLSLVSSVRYR 330


>gi|121602667|ref|YP_989241.1| hypothetical protein BARBAKC583_0961 [Bartonella bacilliformis
           KC583]
 gi|120614844|gb|ABM45445.1| putative membrane protein [Bartonella bacilliformis KC583]
          Length = 350

 Score =  363 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 150/337 (44%), Positives = 224/337 (66%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L  +F+WA   T+ G   G  IGW  T+++ G +   +IC  L ++EISLSF+N+I+NA+
Sbjct: 3   LFRYFKWAFSFTIIGVCLGGVIGWFETNSIIGILKYFFICCTLGILEISLSFDNSIVNAR 62

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +M+ +W +RFLTWGI+IAVFGMRIIFP+++V   + I+PI A+ LAI+ P  Y  I+
Sbjct: 63  ILGRMNQLWSRRFLTWGIIIAVFGMRIIFPLLVVAFAAWISPIAAVKLAIWEPDQYATIL 122

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + +H  I+ FGGTFLMMV L +FF+ + K+HW+ F+E     L  + GI I IVL +I  
Sbjct: 123 TDSHAGIAAFGGTFLMMVGLKYFFDPEKKVHWLPFIEKPAQKLGFLVGIDIAIVLILILF 182

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  + T +  + + +    ++ F  +  + + L S      T  K GL  FLYLEI+DA
Sbjct: 183 FSGQVVTADKLTVLLAMLYGLLTFLVVGAVGAFLDSKEMTLTTTAKGGLGSFLYLEILDA 242

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGV+ +FA + N FII IGL+IGA YVRSMT+++++ G L +Y+YLEHG++Y+I +
Sbjct: 243 SFSFDGVVGAFAFSHNLFIIAIGLSIGAFYVRSMTVMLVETGTLLRYRYLEHGAFYAILI 302

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+VIM++Q I+ +PEI TG     +I ++ YSS++ K
Sbjct: 303 LAVIMYMQIIMPVPEILTGFIGIFVIGMAFYSSLRFK 339


>gi|29832348|ref|NP_826982.1| hypothetical protein SAV_5805 [Streptomyces avermitilis MA-4680]
 gi|29609467|dbj|BAC73517.1| putative integral membrane protein [Streptomyces avermitilis
           MA-4680]
          Length = 381

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 127/368 (34%), Positives = 204/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +         + G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAV---------IYGGWTAFGIVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KMS+ WQK FLT G+LIAVFGMR++FP++IV + +  +PIEA+NLA+     Y +++
Sbjct: 53  ILKKMSAFWQKIFLTVGVLIAVFGMRLVFPVVIVAVTAKKSPIEAVNLALTDKDQYQQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F  +  + W+ ++E  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIF-EERDIQWLRWIERPLAKLGKVDMLSVCIALVVLLV 171

Query: 190 ISNILP----------TNEMYSFVSSSTAAIIIFYGINFLESVLSS-------------- 225
            S               ++  + + S  A +I +  +  L                    
Sbjct: 172 SSMTFAVHAHQHGGAHVDKAQTVLISGIAGLITYMVVGGLSGYFEDKLEEEEEREHEEEE 231

Query: 226 -------DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                       V  G+    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAARTGKKKPAVVLAGQAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    ILI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIQYEIHEVITGLVGVILIAWS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|262377227|ref|ZP_06070452.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262307965|gb|EEY89103.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 361

 Score =  361 bits (927), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 127/355 (35%), Positives = 204/355 (57%), Gaps = 21/355 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAIL 66
           + HF ++I  ++     GL   W +TH     + T+     I  ILA++E+SLSF+NA++
Sbjct: 1   MKHFGFSIAFSIVCL--GLSAYWGYTHGPDAGLQTMLTALTITAILAIMEVSLSFDNAVV 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  +E + LA+  P++Y 
Sbjct: 59  NASVLRGWDHFWKMLFLTVGILIAVFGMRLIFPVVIVAVTADLGFMEVVRLALNDPKEYS 118

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
             +   H  I+ FGG FL+MV L FF + +   HW   +E  +S+L+ +  + +FI L  
Sbjct: 119 ARLMAHHPEIAAFGGAFLLMVFLNFFLDEEKDTHWFRRVERRLSNLANVPAMSVFIALVA 178

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS--------------SDSSNNVT 232
           +  ++  +   +  +   +    I+I+ G+  L  +L                ++     
Sbjct: 179 LLIMAANVDEAKRLAVTMAGIWGIVIYIGVQVLSHMLGGEPEVDEEGNAIRHDENGVPTG 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K G+  FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ +++QG 
Sbjct: 239 VVKAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEQGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+ Y YLEHG++Y+I  L+ IM    T + +PE+ TG      I  ++++SI+ K
Sbjct: 299 LDAYIYLEHGAHYAIGALAFIMIASGTGLHVPEVVTGLIGVAFIVWAVFASIQYK 353


>gi|297197254|ref|ZP_06914651.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|297146654|gb|EFH28266.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 376

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 131/366 (35%), Positives = 202/366 (55%), Gaps = 37/366 (10%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
             ++  FRWA  VT  G   G+         L    +   I  ILAV+EISLSF+NA++N
Sbjct: 3   PVILKTFRWAFAVTALGLAAGV---------LYDGWAAFGIVAILAVLEISLSFDNAVVN 53

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + +NP +A+ LA+     Y +
Sbjct: 54  AGILKKMNTFWQKIFLTVGVLIAVFGMRLVFPVVIVAITAKLNPYDAVQLALTDKDRYQQ 113

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +++ AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L ++
Sbjct: 114 LVTDAHPAIAAFGGMFLLMIFLDFIF-EDRDIKWLAWLERPLAKLGKVDMLSVCIALVVL 172

Query: 188 FGISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL-------------- 223
              +    T          ++  + + S  A +I +  +  L                  
Sbjct: 173 LITAFTFATHAHQHGGAHADKAQTVLISGVAGLITYLVVGGLSGYFENRLEDEEEREEEA 232

Query: 224 ---SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
                  S     G+    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YV
Sbjct: 233 QQSGGTGSPVKLAGQAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYV 292

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
           RS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +     I EI TG    ILI  S +
Sbjct: 293 RSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILMVTIQYQINEIITGLVGVILIGWSFW 352

Query: 341 SSIKNK 346
           SS++  
Sbjct: 353 SSVRRN 358


>gi|21220834|ref|NP_626613.1| hypothetical protein SCO2366 [Streptomyces coelicolor A3(2)]
 gi|8246807|emb|CAB92842.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 380

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 127/368 (34%), Positives = 202/368 (54%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVFY---------GGWTAFGIVAILSIMEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I +++ PIEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTVGILIAVFGMRLVFPVVIVAISASLGPIEAVDLALTDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIF-EDRDIKWLAWLERPLAKLGKVDMLSVCIALVVLLV 171

Query: 190 ISNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVLSS-------------- 225
            +               ++  + + +  A +I +  +  L                    
Sbjct: 172 SAITFGAHAHQHGGAHADKAETVLLAGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEE 231

Query: 226 -------DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAARTGKPKSAVRLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I EI TG     LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIQYEIHEIITGLVGVALIGWS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FFSSVRRN 359


>gi|296283953|ref|ZP_06861951.1| hypothetical protein CbatJ_10031 [Citromicrobium bathyomarinum
           JL354]
          Length = 352

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 136/340 (40%), Positives = 221/340 (65%), Gaps = 2/340 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ H+  ++L T+  F+      W    ++      ++I ++L+++EISLSF+NA++NA
Sbjct: 3   TLLRHYWGSLLFTLVCFIAAGFYAWNAGGSVGSVAHVLWIVLVLSILEISLSFDNAVVNA 62

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M   WQ+RFLTWGILIAVFGMRI+FP+ IV + + ++P+ A++L++  P+ Y  I
Sbjct: 63  TVLREMDEKWQRRFLTWGILIAVFGMRIVFPLAIVAVAANLDPLSAIDLSLNDPERYEAI 122

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +S AHV I+GFGG FL MV L FFF+    + WI  LE+A+   S+I+  +I I+L +++
Sbjct: 123 VSSAHVGIAGFGGAFLTMVGLNFFFDGDKDVDWIRGLELALRRFSEIRAAEIGILLLMLY 182

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG--KHGLNLFLYLEI 246
           GIS +LP  E   F+++    ++ +  ++ + +VL       +  G  + GL  FLYLE+
Sbjct: 183 GISTMLPEGEAMVFLTAGILGLVTYIAVDAIGTVLDKVERRKMAEGAVRSGLGGFLYLEV 242

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FA++ N  II +GL+IGA++VRSMT+ +++ G L KY++LEHG++++
Sbjct: 243 LDASFSFDGVIGAFALSNNMLIIALGLSIGALFVRSMTVHLVRAGTLTKYRFLEHGAFWA 302

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I  L +IM L     I E  TG    +LI +S+  S++  
Sbjct: 303 IIALGLIMLLSAKFHISESITGLIGAVLIGISLLWSMRYN 342


>gi|297199370|ref|ZP_06916767.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|297147381|gb|EDY59331.2| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 382

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 125/368 (33%), Positives = 204/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +         L G      +  IL+++EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAV---------LYGGWEGFGVVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQ+ FLT G+LIAVFGMR++FP++IV I + + PIEA++LA+ +   Y +++
Sbjct: 53  ILKKMNAFWQRIFLTVGVLIAVFGMRLVFPVVIVAISAKMGPIEAVDLALNNKDHYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ ++E  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIF-EDRDIQWLRWIERPLAKLGKVDMLSVCIALVVLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSSD------------- 226
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 172 TAFTFATHAHQHGGAHVDKAQTVLISGIAGLITYMVVGGLSGYFEDKLEEDEEREHEEEE 231

Query: 227 --------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S  +  GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 RAEREGKSKSAVLMAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I EI TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILMVTIQYEIHEIITGLVGVLLIGWS 351

Query: 339 IYSSIKNK 346
             SS++  
Sbjct: 352 FLSSVRRN 359


>gi|256788010|ref|ZP_05526441.1| hypothetical protein SlivT_26287 [Streptomyces lividans TK24]
 gi|289771898|ref|ZP_06531276.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289702097|gb|EFD69526.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 380

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 127/368 (34%), Positives = 202/368 (54%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVFY---------GGWTAFGIVAILSIMEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I +++ PIEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAISASLGPIEAVDLALTDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIF-EDRDIKWLAWLERPLAKLGKVDMLSVCIALVVLLV 171

Query: 190 ISNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVLSS-------------- 225
            +               ++  + + +  A +I +  +  L                    
Sbjct: 172 SAITFGAHAHQHGGAHADKAETVLLAGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEE 231

Query: 226 -------DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAARTGKPKSAVRLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I EI TG     LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIQYEIHEIITGLVGVALIGWS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FFSSVRRN 359


>gi|256789886|ref|ZP_05528317.1| hypothetical protein SlivT_35853 [Streptomyces lividans TK24]
          Length = 368

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 125/371 (33%), Positives = 203/371 (54%), Gaps = 45/371 (12%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FRWA  VT  G   G+         L    + + I  IL+V+EISLSF+NA++NA  
Sbjct: 1   MKTFRWAFAVTALGLAAGV---------LYDGWTALGIVAILSVLEISLSFDNAVINAGI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+KM++ WQ+ FLT GI+IAVFGMR++FP++IV + + ++P  A++LA+     Y ++++
Sbjct: 52  LKKMNAFWQRIFLTVGIVIAVFGMRLVFPVVIVAVSARLSPWSAVHLALTDKDRYQELVT 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FLMM+ L F F  +  + W+ +LE  ++ L ++  + + I L ++   
Sbjct: 112 DAHPSIAAFGGMFLMMIFLDFVF-EERDIKWLGWLERPLAKLGRVDMLSVCIALVVLLVS 170

Query: 191 SNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVL----------------- 223
           +               ++  + + +  A +I +  +  L                     
Sbjct: 171 ATTFGAHAHQHGGTHADKAETVLLAGVAGLITYMVVGGLSGFFEQRLEDEEEREQEAEKR 230

Query: 224 --------SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
                       S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL I
Sbjct: 231 AEKDAERAGRPGSPVKLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGI 290

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA+YVRS+T+ +++QG L+ Y YLEHG++Y+I  LS+I+ +    +I EI TG    +LI
Sbjct: 291 GAMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSLILLVTIQYEINEIVTGLVGVVLI 350

Query: 336 FLSIYSSIKNK 346
             S +SS++  
Sbjct: 351 GASFWSSVRRN 361


>gi|262373717|ref|ZP_06066995.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262311470|gb|EEY92556.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 360

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 124/352 (35%), Positives = 203/352 (57%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFT--HTLSGTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  TV         G+       ++  +  + I  ILAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTVVCLALSAYWGYTHGPEAGIATMLKALTITAILAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR++FP++IV + + +  +E + LA+  P+ Y   
Sbjct: 61  SVLRNWDHFWKMIFLTVGILIAVFGMRLVFPVVIVAVTADMGMMEVVKLALNDPKSYSAR 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           + + H  I+ FGGTFL+MV L FFF+ + + HW  ++E  +SHL+ +  + +FI L  + 
Sbjct: 121 LMEHHAEIAAFGGTFLLMVFLNFFFDDEKETHWFRWIESKLSHLASVPAMSVFIALVAML 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +  ++      +    I+++ G+  L  +L  +              +       
Sbjct: 181 IMAANVEESKRLVVTMAGIWGIVVYIGVQVLSHLLGGEPEIDEHGNAVMHDGNGAASGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K G   FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ ++++G L+
Sbjct: 241 KAGFGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y +LEHG++Y+I  L+ IM    T + +PE+ TG      I  ++ +SI+ 
Sbjct: 301 AYIFLEHGAHYAIGALAFIMIASGTGLHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|289773769|ref|ZP_06533147.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289703968|gb|EFD71397.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 370

 Score =  359 bits (923), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 126/372 (33%), Positives = 204/372 (54%), Gaps = 45/372 (12%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  FRWA  VT  G   G+         L    + + I  IL+V+EISLSF+NA++NA 
Sbjct: 2   LLKTFRWAFAVTALGLAAGV---------LYDGWTALGIVAILSVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQ+ FLT GI+IAVFGMR++FP++IV + + ++P  A++LA+     Y +++
Sbjct: 53  ILKKMNAFWQRIFLTVGIVIAVFGMRLVFPVVIVAVSARLSPWSAVHLALTDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FLMM+ L F F  +  + W+ +LE  ++ L ++  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLMMIFLDFVF-EERDIKWLGWLERPLAKLGRVDMLSVCIALVVLLV 171

Query: 190 ISNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +               ++  + + +  A +I +  +  L                    
Sbjct: 172 SATTFGAHAHQHGGTHADKAETVLLAGVAGLITYMVVGGLSGFFEQRLEDEEEREQEAEK 231

Query: 224 ---------SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT 274
                        S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL 
Sbjct: 232 RAEKDAERAGRPGSPVKLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLG 291

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA+YVRS+T+ +++QG L+ Y YLEHG++Y+I  LS+I+ +    +I EI TG    +L
Sbjct: 292 IGAMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSLILLVTIQYEINEIVTGLVGVVL 351

Query: 335 IFLSIYSSIKNK 346
           I  S +SS++  
Sbjct: 352 IGASFWSSVRRN 363


>gi|254382840|ref|ZP_04998196.1| integral membrane protein [Streptomyces sp. Mg1]
 gi|194341741|gb|EDX22707.1| integral membrane protein [Streptomyces sp. Mg1]
          Length = 373

 Score =  359 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 128/370 (34%), Positives = 199/370 (53%), Gaps = 41/370 (11%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
             ++  F W+  VT  G +  +           G  +   I  IL V+EISLSF+NA++N
Sbjct: 2   PVVLKTFGWSFAVTALGLVAAVFY---------GGWTAFGIVAILTVLEISLSFDNAVVN 52

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + I PIEA++LA+     Y +
Sbjct: 53  AGILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVVIVAISAKIGPIEAVDLALNDKNMYEQ 112

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +++ AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L KI  +   I L ++
Sbjct: 113 LVTDAHPSIAAFGGMFLLMIFLDFIF-EDRDIKWLAWLERPLAKLGKIDMLSACIALIVL 171

Query: 188 FGISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLS------------- 224
              S               ++  + + S    +I +  +  L                  
Sbjct: 172 VITSMTFAANAHQHGGVHVDKAQTVLVSGILGLITYMVVGGLSGYFENKLEEEEEAEHEA 231

Query: 225 --------SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIG 276
                      S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IG
Sbjct: 232 EEEAKKTGKPVSAVAMAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIG 291

Query: 277 AIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIF 336
           A+YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI 
Sbjct: 292 AMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIQYEINEVITGLVGVVLIG 351

Query: 337 LSIYSSIKNK 346
            S +SS++  
Sbjct: 352 WSFWSSVRRN 361


>gi|282861709|ref|ZP_06270773.1| protein of unknown function DUF475 [Streptomyces sp. ACTE]
 gi|282563525|gb|EFB69063.1| protein of unknown function DUF475 [Streptomyces sp. ACTE]
          Length = 383

 Score =  359 bits (922), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 128/368 (34%), Positives = 206/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G      I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVFY---------GGWQAFGIVAILSILEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + + PIEA++L+  +P  Y +++
Sbjct: 53  ILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVVIVAISAKLGPIEAVDLSFNNPDRYKELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FLMM+ L F F     + W+ ++E  ++ L K+  + + + L ++  
Sbjct: 113 TDAHPSIAAFGGMFLMMIFLDFIF-EDRDIQWLRWIERPLAKLGKVDMLSVCVALIVLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            S  + T          ++  + + S  A +I +  +  L                    
Sbjct: 172 ASMTVATHAHQHGGGHADKASTVLLSGIAGLITYLVVGGLSGFFENKLEEEEEREQEAEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                   +S  +  GK    +FLYLE++DAS S DGVI +FAIT    ++ +GL IGA+
Sbjct: 232 EAKKSGKPASAVLLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNEIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  LSVI+ +    +I EI TG    +LI  +
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSVILLITIQYEINEIITGLVGVVLIAWA 351

Query: 339 IYSSIKNK 346
            +SS+++ 
Sbjct: 352 FWSSVRHN 359


>gi|319407522|emb|CBI81170.1| conserved membrane hypothetical protein [Bartonella sp. 1-1C]
          Length = 344

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 153/338 (45%), Positives = 220/338 (65%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +FRWA   T+ G L G  IGW  T T+ G     +IC +L ++EISLSF+N+I+NA
Sbjct: 2   ALLGYFRWAFFFTIIGILGGALIGWLETGTIVGCFKYFFICCVLGILEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L KM+ +W+ RFLTWGILIAVFGMRIIFP+++V + + INPI A+ LAI+ P  Y  I
Sbjct: 62  RFLGKMNQLWRDRFLTWGILIAVFGMRIIFPLLVVAVAAWINPIAAVQLAIWEPHQYAAI 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +  AH  I+ FGGTFLMMV L +FF+ + K+HW+ F+E     LS    I I I+L ++ 
Sbjct: 122 LMDAHNSIAAFGGTFLMMVGLKYFFDPEKKVHWLTFIEKPAQRLSSFVRIDIIIILILML 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
             S  +      + + +    ++ F  +    S+L S  +  +T  K G  LFLYLE++D
Sbjct: 182 FFSGQIIAENKLTVLLAMLYGLLTFLFVEATCSLLDSQKNTLITVSKGGAGLFLYLEVLD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+ +FA + N FII IGL IGA YVR++T+++ + G L  Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRAITIMLFETGTLLHYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VL+VIM+ Q I+ IPE  TG     +I ++ YSS++ K
Sbjct: 302 VLAVIMYTQIIISIPEALTGLIGICIIGMAFYSSLRFK 339


>gi|148558899|ref|YP_001259351.1| hypothetical protein BOV_1419 [Brucella ovis ATCC 25840]
 gi|148370156|gb|ABQ60135.1| putative membrane protein [Brucella ovis ATCC 25840]
          Length = 319

 Score =  358 bits (920), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 136/305 (44%), Positives = 208/305 (68%)

Query: 42  TISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIM 101
            +S   IC +L+V+EISLSF+NAI+NA+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ 
Sbjct: 1   MVSVFIICAVLSVLEISLSFDNAIVNARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLA 60

Query: 102 IVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHW 161
           IV I    +PI A+ LAI+ P +Y ++I+++H  I+ FGGTFL+MV + +FF+ +  +HW
Sbjct: 61  IVAIAMWTDPISALKLAIWQPNEYARVIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHW 120

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
           I  +E  M   + ++G++I + +++I   S  L  +  ++FV +    ++ F  +  L  
Sbjct: 121 IRMIESRMPKFASVQGVEIGVAIALIIFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGE 180

Query: 222 VLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
           VL +         + GL  F+YLE++DAS S DGVI +FA+T N F+I IGL IGA YVR
Sbjct: 181 VLDATQEQMDMVHRGGLGAFIYLEVLDASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVR 240

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYS 341
           S+T++++++  L +Y+YLEHG++Y+I VL++IM++QT+V IPE+ TG     LI LS  S
Sbjct: 241 SLTIMLVERKTLGQYRYLEHGAFYAILVLAIIMYVQTLVHIPEVITGLIGAALIGLSFMS 300

Query: 342 SIKNK 346
           S++  
Sbjct: 301 SLRYN 305


>gi|21219096|ref|NP_624875.1| hypothetical protein SCO0562 [Streptomyces coelicolor A3(2)]
 gi|6013085|emb|CAB57414.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 370

 Score =  358 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 126/372 (33%), Positives = 203/372 (54%), Gaps = 45/372 (12%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  FRWA  VT  G   G+         L    + + I  IL+V+EISLSF+NA++NA 
Sbjct: 2   LLKTFRWAFAVTALGLAAGV---------LYDGWTALGIVAILSVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQ+ FLT GI+IAVFGMR++FP++IV + + ++P  A++LA+     Y +++
Sbjct: 53  ILKKMNAFWQRIFLTVGIVIAVFGMRLVFPVVIVAVSARLSPWSAVHLALTDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FLMM+ L F F     + W+ +LE  ++ L ++  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLMMIFLDFVF-EDRDIKWLGWLERPLAKLGRVDMLSVCIALVVLLV 171

Query: 190 ISNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +               ++  + + +  A +I +  +  L                    
Sbjct: 172 SATTFGAHAHQHGGAHADKAETVLLAGVAGLITYMVVGGLSGFFEQRLEDEEEREQEAEK 231

Query: 224 ---------SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT 274
                        S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL 
Sbjct: 232 RAEKDAERAGRPGSPVKLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLG 291

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA+YVRS+T+ +++QG L+ Y YLEHG++Y+I  LS+I+ +    +I EI TG    +L
Sbjct: 292 IGAMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSLILLVTIQYEINEIVTGLVGVVL 351

Query: 335 IFLSIYSSIKNK 346
           I  S +SS++  
Sbjct: 352 IGASFWSSVRRN 363


>gi|294677262|ref|YP_003577877.1| hypothetical protein RCAP_rcc01725 [Rhodobacter capsulatus SB 1003]
 gi|294476082|gb|ADE85470.1| protein of unknown function DUF475, transmembrane [Rhodobacter
           capsulatus SB 1003]
          Length = 344

 Score =  358 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 150/339 (44%), Positives = 228/339 (67%), Gaps = 1/339 (0%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            S + +F WA   T  G    + +G+ + HT  G +S  ++  +LAV+EISLSF+NAI+N
Sbjct: 2   RSTLQYFSWAFGFTAVGLALAMWLGFTYEHTTHGALSFFFVACVLAVLEISLSFDNAIIN 61

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L +M+  WQ+RFLTWGILIAVFGMRI+FP++IV I + I PIEA+ +A   P +Y +
Sbjct: 62  ANKLGQMTPEWQRRFLTWGILIAVFGMRILFPLLIVVIAAGIGPIEALRIAATQPAEYSR 121

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           II +AH+ I+ FGG FLMMV+L++F +   ++HW   LE  +S  + I+GI++  +L+I+
Sbjct: 122 IIGEAHLSIAAFGGAFLMMVALSYFVDESKEVHWFVALEKRLSSWASIRGIEVGFLLAIV 181

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              +  LP     +F+ ++   ++ F  +  L  VL   +S +    K GL  FLYLE++
Sbjct: 182 LAFAWWLPVKTEGTFLVAACTGLLTFLAVEGLGQVLD-KASLSGDVAKGGLGAFLYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T+N F+I IGL IGA YVRSMT++++++  L++++YLEHG+++SI
Sbjct: 241 DASFSFDGVIGAFALTQNLFLIAIGLGIGAFYVRSMTVMLVERQALSEFRYLEHGAFWSI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VLSV MF QT++ +PE  TG    + I LS+ SS++ +
Sbjct: 301 LVLSVAMFAQTLMHVPEWATGLLGVVFIGLSLMSSLRWR 339


>gi|302551108|ref|ZP_07303450.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302468726|gb|EFL31819.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 381

 Score =  358 bits (919), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 127/368 (34%), Positives = 204/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +         L G  + + +  IL+V+EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAV---------LFGGWTALGVVAILSVLEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + P+EA+NLA+   + Y +++
Sbjct: 53  ILKKMNAFWQKIFLTVGILIAVFGMRLVFPVVIVAISAQLGPLEAVNLALNDKEQYQQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIF-EDRDIKWLAWLERPLAKLGKVDMLSVCIALIVLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSS-------------- 225
            +               ++  + + S  A +I +  +  L                    
Sbjct: 172 SALTFAANAHQHGGAHVDKAETVLLSGIAGLITYMIVGGLSGYFEDKLEEEEEREQEAEE 231

Query: 226 -------DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAERTGKPRSAVALAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+V++ +     I EI TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVLLLVTIQYQINEIITGLIGVVLIAAS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|319406022|emb|CBI79653.1| conserved membrane hypothetical protein [Bartonella sp. AR 15-3]
          Length = 350

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 150/338 (44%), Positives = 224/338 (66%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +F+WA   TV G L G  IGW  T T+ G++   +IC IL ++EISLSF+N+I+N 
Sbjct: 2   ALLGYFKWAFFFTVIGMLLGAFIGWLETGTIVGSLKYFFICCILGILEISLSFDNSIINV 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L++M+ +W++RFLTWG+LIAVFGMRIIFP+++V I + INPI A+ LAI+ P  Y  I
Sbjct: 62  RFLKEMNQLWRRRFLTWGVLIAVFGMRIIFPLLVVAIAAWINPIAAIKLAIWDPHRYAAI 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +  AH  I+ FG TFLMMV L +FF+S+ K+HW+ F+E     L     I I I+L ++ 
Sbjct: 122 LMDAHKGIAAFGATFLMMVGLKYFFDSEKKIHWLVFIEKPAQKLGSFVQIDIIIILMLML 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
            IS  +      + + S    ++ F  +  + S+L S  +  +   K G   FLYLE++D
Sbjct: 182 FISEQIVAENKLTVLFSMLYGLVTFLLVEAICSLLDSQKNTLIAVAKGGAGSFLYLEVLD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+ +FA + N FII IGL IGA YVR+MT+++ + G L  Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRAMTIMLFETGTLLHYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +L++IM+++ I+ IPE+ TG     +I ++ YSSI+ K
Sbjct: 302 ILAMIMYIEIIMSIPEVLTGFIGVCIIGMAFYSSIRFK 339


>gi|302534235|ref|ZP_07286577.1| integral membrane protein [Streptomyces sp. C]
 gi|302443130|gb|EFL14946.1| integral membrane protein [Streptomyces sp. C]
          Length = 379

 Score =  358 bits (918), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 127/370 (34%), Positives = 201/370 (54%), Gaps = 41/370 (11%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
             ++  F W+  VT  G +  +           G  +   I  IL+++EISLSF+NA++N
Sbjct: 2   PVVLKTFGWSFAVTALGLVAAVFY---------GGWTAFGIVAILSILEISLSFDNAVVN 52

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + I PIEA++LA+   + Y +
Sbjct: 53  AGILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVVIVAISAKIGPIEAVDLAMTDKEMYKQ 112

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +++ AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L KI  +   I L ++
Sbjct: 113 LVTDAHPSIAAFGGMFLLMIFLDFIF-EDRDIKWLAWLERPLAKLGKIDMLSACIALIVL 171

Query: 188 FGISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLS------------- 224
              S               ++  + + S    +I +  +  L                  
Sbjct: 172 VITSMTFAANAHQHGGTHVDKAQTVLVSGVLGLITYMIVGGLSGYFENKLEEEEEAEHEA 231

Query: 225 --------SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIG 276
                      S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IG
Sbjct: 232 EEAAKKSGKPVSAVAMAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIG 291

Query: 277 AIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIF 336
           A+YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI 
Sbjct: 292 AMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIQYEINEVITGLVGVVLIA 351

Query: 337 LSIYSSIKNK 346
            S +SS++  
Sbjct: 352 WSFWSSVRRN 361


>gi|239979237|ref|ZP_04701761.1| hypothetical protein SalbJ_07364 [Streptomyces albus J1074]
 gi|291451115|ref|ZP_06590505.1| integral membrane protein [Streptomyces albus J1074]
 gi|291354064|gb|EFE80966.1| integral membrane protein [Streptomyces albus J1074]
          Length = 380

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 123/368 (33%), Positives = 204/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +         L G  +   +  IL+++EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAV---------LYGGWAGFGVVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + I PIEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAISAKIGPIEAVDLAMTDKDHYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F    ++ W+ ++E  ++ L ++  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLNFLF-EDREIKWLTWIERPLAKLGRVDMLSVCIALIVLLI 171

Query: 190 ISNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVLSS-------------- 225
            +               ++  + + +  A +I +  +  L S                  
Sbjct: 172 SAMTFGSQAHQHGGTHADKAETVLLAGIAGLITYLIVGGLSSFFEDKLEEGEEREHEAEE 231

Query: 226 -------DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAKRQGKPVSAVKLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ ++++G L+ Y YLEHG++Y+I  L+ I+ +     I E+ TG    +LI +S
Sbjct: 292 YVRSLTVYLVREGTLDDYVYLEHGAHYAIGALAAILLVTIRFQISEMITGLIGVVLIGVS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|307323185|ref|ZP_07602395.1| protein of unknown function DUF475 [Streptomyces violaceusniger Tu
           4113]
 gi|306890674|gb|EFN21650.1| protein of unknown function DUF475 [Streptomyces violaceusniger Tu
           4113]
          Length = 382

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 127/368 (34%), Positives = 204/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVFY---------GGWTGFGIVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + I PIEA+ LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGVLIAVFGMRLVFPVVIVAISAKIGPIEAVRLALDDKDKYQQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F  + ++ W+ +LE  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIF-EEREIKWLGWLERPLAKLGKVDMLSVCIALIVLLV 171

Query: 190 ISNILP----------TNEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +              T++  + + +  A +I +  +  L                    
Sbjct: 172 SAMTFATNAHQHGGIHTDKTETVLIAGVAGVITYLIVAGLSGYFENKLEEEEEREHEAEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                       V  GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAKKSGKKVPAVVMAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYIYLEHGAHYAIGALAVILLVTIQYEIHEVITGLVGVVLIAWS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FFSSVQRN 359


>gi|294812440|ref|ZP_06771083.1| Putative integral membrane protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294325039|gb|EFG06682.1| Putative integral membrane protein [Streptomyces clavuligerus ATCC
           27064]
          Length = 383

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 127/370 (34%), Positives = 203/370 (54%), Gaps = 41/370 (11%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
             ++  F W+  VT  G +  +         L G  +   +  IL+V+EISLSF+NA++N
Sbjct: 2   PVVLKTFGWSFAVTALGLVAAV---------LYGGWTAFGVVAILSVLEISLSFDNAVVN 52

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+KM++ WQK FLT GILIAVFGMR++FP++IV + + +  IEA++LA+     Y +
Sbjct: 53  AGILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAVSANLGLIEAVDLALNDKDKYQQ 112

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +++ AH  I+ FGG FL+M+ L F F    ++ W+ +LE  ++ L K+  + + I L I+
Sbjct: 113 LVTDAHPSIAAFGGMFLLMIFLDFVF-EDREIKWLGWLERPLAKLGKVDMLSVCIALVIL 171

Query: 188 FGISNILP----------TNEMYSFVSSSTAAIIIFYGINFLESVL-------------- 223
              S               ++  + + S  A +I +  +  L                  
Sbjct: 172 LISSMTFAKNAHQHGGGHADKAETVLLSGVAGLITYLIVGGLSGFFEGRLEAEEEREHEA 231

Query: 224 -------SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIG 276
                      S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IG
Sbjct: 232 EENARRSGKKVSAVAIGGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIG 291

Query: 277 AIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIF 336
           A+YVRS+T+ +++QG L++Y YLEHG++Y+I  LS+I+ +    +I E+ TG     LI 
Sbjct: 292 AMYVRSLTVYLVRQGTLDEYVYLEHGAHYAIGALSIILLITIQYEIHELITGFIGVALIG 351

Query: 337 LSIYSSIKNK 346
            S +SS++  
Sbjct: 352 WSFWSSVRRN 361


>gi|182438928|ref|YP_001826647.1| hypothetical protein SGR_5135 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326779584|ref|ZP_08238849.1| protein of unknown function DUF475 [Streptomyces cf. griseus
           XylebKG-1]
 gi|178467444|dbj|BAG21964.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326659917|gb|EGE44763.1| protein of unknown function DUF475 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 383

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 128/368 (34%), Positives = 204/368 (55%), Gaps = 40/368 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G      I +IL+V+EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVFY---------GGWQAFGIVLILSVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV + + + PIEA++L+   P  Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAVSAQLGPIEAIDLSFNDPDRYKELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F+    +HW+ ++E  ++ L K+  + + + L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIFDEDRDIHWLRWIERPLAKLGKVDMLSVCVALIVLLI 172

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 173 TATTFATQAHQHGGGHADKASTVMLSGIAGLITYLVVGGLSGFFEGKLEEEEEREHEAEE 232

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    +     GK    LFLYLE++DAS S DGVI +FAIT    ++ +GL IGA+
Sbjct: 233 EAKEKGKPVTGVALAGKAAFFLFLYLEVLDASFSFDGVIGAFAITNEIVLMALGLGIGAM 292

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ ++++G L+ Y YLEHG++Y+I  LS+I+ +     I E  TG+   ILI LS
Sbjct: 293 YVRSLTVYLVREGTLDDYVYLEHGAHYAIGALSIILLITIQFQINEFITGSVGVILIALS 352

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 353 FWSSVRRN 360


>gi|290960799|ref|YP_003491981.1| integral membrane protein [Streptomyces scabiei 87.22]
 gi|260650325|emb|CBG73441.1| putative integral membrane protein [Streptomyces scabiei 87.22]
          Length = 381

 Score =  356 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 127/368 (34%), Positives = 201/368 (54%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +         L    +   +  IL+V+EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAV---------LYDGWTAFGVVAILSVLEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + ++PIEA++LA+     Y + +
Sbjct: 53  ILKKMNAFWQKIFLTVGILIAVFGMRLVFPVVIVAISAKVSPIEAVDLALTDKDQYQQYV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  +   I + ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIF-EDRDIKWLSWLERPLAKLGKVDMLSACIAMIVLLV 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLS--------------- 224
            S    T          ++  + + S  A +I +  +  L                    
Sbjct: 172 TSMTFATNAHQHGGAHVDKAQTVLISGLAGLITYLIVGGLSGFFENKLEEEEEREHEEEE 231

Query: 225 ------SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 AAERAGKPRSAVALAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+ I+ +    +I E  TG+   ILI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAAILLVTIQYEINEFITGSIGVILIAWS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|152967254|ref|YP_001363038.1| hypothetical protein Krad_3310 [Kineococcus radiotolerans SRS30216]
 gi|151361771|gb|ABS04774.1| protein of unknown function DUF475 [Kineococcus radiotolerans
           SRS30216]
          Length = 380

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 125/365 (34%), Positives = 207/365 (56%), Gaps = 32/365 (8%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  +RW+ +VT  G +     G        G    + + +IL+++EISLSF+NA++NA 
Sbjct: 2   ILKTYRWSFVVTALGLVLAAWYGLSAH---LGIGQAIALVLILSILEISLSFDNAVVNAT 58

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY-----SPQD 124
            L++MS  W+K FL+ GI+IAVFGMR++FPI++V + + + PIE + LA+      +P  
Sbjct: 59  ILERMSDFWRKIFLSVGIIIAVFGMRLVFPIVLVSVTAGLGPIEVIRLALEGGDPETPGT 118

Query: 125 YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL 184
           Y   + +AH  I+ FGG FL+M+ L F F  + + HW+  +E A+  + K+  +++ +  
Sbjct: 119 YGYELHEAHPTIASFGGMFLLMLFLNFIF-GEKEHHWLGPIERALEKVGKLDYVQVIVAG 177

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-------------------- 224
           +++  ++    T    + ++S  A I+ +  +N L  + +                    
Sbjct: 178 AVLLVVAETFATEHGRTVLASGLAGIVTYLLVNGLGELFNVEDHVEHEDPATTSAGTTAS 237

Query: 225 ---SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
                S      GK    LFLYLE++DAS S DGVI +FAIT +  II IGL +GA+Y+R
Sbjct: 238 GVNGPSGAARATGKAAFFLFLYLEVLDASFSFDGVIGAFAITSDPVIIAIGLGVGAMYIR 297

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYS 341
           SMT+ ++++G L +Y YLE+G+ ++I  L+VI+ L   V+IPE+ TG      I  S+ S
Sbjct: 298 SMTVHLVEEGTLAQYPYLENGALWAIGALAVILLLSIEVEIPEVVTGLIGLAFIVASLIS 357

Query: 342 SIKNK 346
           SI+  
Sbjct: 358 SIRYN 362


>gi|239940900|ref|ZP_04692837.1| hypothetical protein SrosN15_07875 [Streptomyces roseosporus NRRL
           15998]
 gi|239987378|ref|ZP_04708042.1| hypothetical protein SrosN1_08742 [Streptomyces roseosporus NRRL
           11379]
 gi|291444335|ref|ZP_06583725.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
 gi|291347282|gb|EFE74186.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
          Length = 383

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 129/368 (35%), Positives = 205/368 (55%), Gaps = 40/368 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G      I  IL+V+EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAIFY---------GGWQAFGIVAILSVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV + + + PIEA++L+   P  Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAVSAKLGPIEAIDLSFNDPDKYKELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F+    +HW+ ++E  ++ L K+  + + + L I+  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIFDEDRDIHWLRWIERPLAKLGKVDMLSVCVALIILLI 172

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 173 TAMTFATQAHQHGGGHVDKSATVMLSGIAGLITYLIVGGLSGFFEGKLEEEEEREHEAEE 232

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    +     GK    LFLYLE++DAS S DGVI +FAIT    ++ +GL IGA+
Sbjct: 233 EAKKKGKPVTGVALAGKAAFFLFLYLEVLDASFSFDGVIGAFAITNEIVLMALGLGIGAM 292

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ ++++G L+ Y YLEHG++Y+I  LS+I+ +    +I E+ TG+   ILI LS
Sbjct: 293 YVRSLTVYLVREGTLDDYVYLEHGAHYAIGALSIILLITIQHEINELITGSVGVILIALS 352

Query: 339 IYSSIKNK 346
            +SS+K  
Sbjct: 353 FWSSVKRN 360


>gi|319408838|emb|CBI82495.1| conserved membrane hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 346

 Score =  356 bits (913), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 150/338 (44%), Positives = 225/338 (66%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +FRWA   T+ G   G  +GW  T +L G +   +IC +L ++EISLSF+N+I+NA
Sbjct: 2   ALLGYFRWAFFFTIIGVFGGGFVGWFETGSLIGFLKYFFICCVLGILEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L KM  +W +RFLTWGILIAVFGMRIIFP++IV   + I+PI A+ LA++ P  Y +I
Sbjct: 62  RILGKMDQLWSRRFLTWGILIAVFGMRIIFPLLIVAFAAWISPIAAVKLALWEPHQYAEI 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AHV I+ FGGTFLMMV L +FF+ + ++HW+ F+E     +    G+ I IVL ++ 
Sbjct: 122 LANAHVGIAAFGGTFLMMVGLKYFFDPKKEVHWLAFIEKPAQKVGSFVGVDIAIVLILML 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
                + T    + + +    ++ F  +  + S+L S  +  VT  K G+  FLYLEI+D
Sbjct: 182 FFLGQITTENKLTVLFAMLYGLLTFLVVEAVSSLLDSQKNTLVTIAKGGVGSFLYLEILD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+S+FA + N FII IGL IGA YVR++T+++++ G L  Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVMSAFAFSHNLFIIAIGLGIGAFYVRAITIMLVETGTLLHYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VL+VIM++Q I+ +PE  TG     ++ ++ YSSI+ K
Sbjct: 302 VLAVIMYIQIIMPVPEALTGLIGVCILGVAFYSSIRFK 339


>gi|50085094|ref|YP_046604.1| hypothetical protein ACIAD1956 [Acinetobacter sp. ADP1]
 gi|49531070|emb|CAG68782.1| conserved hypothetical protein; putative membrane protein
           [Acinetobacter sp. ADP1]
          Length = 356

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 127/349 (36%), Positives = 201/349 (57%), Gaps = 14/349 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFT--HTLSGTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I+ T+         G        LS  +  + I  +LAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIIFTIICLALSAWWGLTHGPNAGLSMMLKVLLITTVLAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+K FLT GIL+AVFGMR+IFP++IV + + +  IE   LA+  P+ Y + 
Sbjct: 61  SVLRNWDEFWKKLFLTVGILVAVFGMRLIFPLLIVGVTADMGMIEVAKLALNDPKTYSEK 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +   H  I+ FGG FLM+V L F F+     HW H+LE  +S+L+ I  + +F+ L  + 
Sbjct: 121 LLAHHAEIAAFGGMFLMLVFLNFLFDDGKDTHWFHWLETHLSNLANIPAMSVFVSLIALL 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG-----------KHG 237
            ++  +P  +    + +    I+++ G+  L  +L   S ++ T             K G
Sbjct: 181 IMAAFVPEQQKLIVIMAGIWGIVVYIGVQVLGHLLEGSSEDDETDEKQVSGTSTNIVKAG 240

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           +  FLYLE++DAS S DGVI +FAIT +  +I++GL IGA++VRSMT+ ++++G L  + 
Sbjct: 241 IGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAMFVRSMTIYLVEKGTLEAFI 300

Query: 298 YLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           YLEHG++Y+I  L+ IM    T   +PE+ TG      I  ++ SSI  
Sbjct: 301 YLEHGAHYAIGALAAIMLYTGTGGHVPEVVTGLIGVAFIIWAVLSSIAY 349


>gi|295839202|ref|ZP_06826135.1| integral membrane protein [Streptomyces sp. SPB74]
 gi|197695653|gb|EDY42586.1| integral membrane protein [Streptomyces sp. SPB74]
          Length = 375

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 129/368 (35%), Positives = 207/368 (56%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +TV G +              G  +   +  ILAV+EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFGITVLGLVAAAFY---------GGWTAFGVVAILAVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV + + INP++A++LAI +   Y +++
Sbjct: 53  ILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVLIVAVTAKINPVDAVDLAINNKDHYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + + L ++  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIF-EDRDIKWLGWLERPLAKLGKVDMLSVCVALILLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLS--------------- 224
            S  + T          ++  + + S  A +I +  +  L                    
Sbjct: 172 ASMTVATHAHVHGGGHVDKAETVLLSGIAGLITYLIVGGLSGFFENKLEDEEEAEEEREE 231

Query: 225 ------SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE+IDAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAAKSGKPRSAVALAGKGAFFMFLYLEVIDASFSFDGVIGAFAITNDIILMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           Y+RS+T+ +++QG L+ Y YLEHG++Y+I  LSV++ +    +IPE+ TG    +LI  S
Sbjct: 292 YIRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSVLLLVTIRYEIPEVVTGLIGVVLIAAS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVQRN 359


>gi|254389103|ref|ZP_05004333.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|326440736|ref|ZP_08215470.1| hypothetical protein SclaA2_06698 [Streptomyces clavuligerus ATCC
           27064]
 gi|197702820|gb|EDY48632.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
          Length = 381

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 127/368 (34%), Positives = 203/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +         L G  +   +  IL+V+EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAV---------LYGGWTAFGVVAILSVLEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV + + +  IEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAVSANLGLIEAVDLALNDKDKYQQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F    ++ W+ +LE  ++ L K+  + + I L I+  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFVF-EDREIKWLGWLERPLAKLGKVDMLSVCIALVILLI 171

Query: 190 ISNILP----------TNEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            S               ++  + + S  A +I +  +  L                    
Sbjct: 172 SSMTFAKNAHQHGGGHADKAETVLLSGVAGLITYLIVGGLSGFFEGRLEAEEEREHEAEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 NARRSGKKVSAVAIGGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L++Y YLEHG++Y+I  LS+I+ +    +I E+ TG     LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDEYVYLEHGAHYAIGALSIILLITIQYEIHELITGFIGVALIGWS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|319404526|emb|CBI78131.1| conserved membrane hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 344

 Score =  355 bits (912), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 152/338 (44%), Positives = 221/338 (65%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ +FRWA   T+ G L G  IGW  T T+ G     +IC +L ++EISLSF+N+I+NA
Sbjct: 2   ALLGYFRWAFFFTIIGILGGGLIGWLETGTIVGCFKYFFICCVLGILEISLSFDNSIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
           + L KM+ +W+ RFLTWGILIAVFGMRIIFP+++V + + INPI A+ LAI+ P  Y  I
Sbjct: 62  RFLGKMNQLWRHRFLTWGILIAVFGMRIIFPLLVVAVAAWINPIAAVQLAIWEPHQYAAI 121

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++  H  I+ FGGTFLMMV L +FF+ + K+HW+ F+E     LS    I I I+L ++ 
Sbjct: 122 LTDTHDSIAAFGGTFLMMVGLKYFFDPEKKVHWLTFIEKPAQRLSSFVRIDIIIILILML 181

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
             S  +      + + +    ++ F  +    S+L S  +  +T  K G  LFLYLE++D
Sbjct: 182 FFSGQIVAENKLTVLLAMLYGLLTFLIVEATCSLLDSQKNTLITVSKGGAGLFLYLEVLD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+ +FA + N FII IGL IGA YVR++T+++ + G L  Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRAITIMLFETGTLLHYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VL+VIM++Q I+ IPE  TG     +I ++ YSS++ K
Sbjct: 302 VLAVIMYMQIIISIPEALTGLIGICIIGMAFYSSLRFK 339


>gi|182439985|ref|YP_001827704.1| hypothetical protein SGR_6192 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178468501|dbj|BAG23021.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
          Length = 382

 Score =  354 bits (910), Expect = 9e-96,   Method: Composition-based stats.
 Identities = 122/368 (33%), Positives = 206/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +         L G  +   +  IL+++EIS+SF+NA++NA 
Sbjct: 2   ILKTFGWSFAVTALGLVVAV---------LYGGWAAFGVVAILSILEISVSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQ+ FLT G+LIAVFGMR++FP++IV I + + P+EA++LAI   + Y +++
Sbjct: 53  ILKKMNAFWQRIFLTIGVLIAVFGMRLVFPVVIVAISAKVGPVEAVDLAINDAERYEQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++   KI    + + L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFVF-EDRDIKWLGWLERPLAKFGKIDMASVCVALIVLAI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSSD------------- 226
            +    T          ++  + + S    +I +  +  L     +              
Sbjct: 172 SAMTFATQAHQHGGTHVDKASTVLLSGVFGLITYLVVGGLSGFFENKLEEEEEREHEAEE 231

Query: 227 --------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                   +   +  GK    +FLYLE++DAS S DGVI++FAIT +  ++ +GL IGA+
Sbjct: 232 EARRSGRNAPVVLMAGKAAFFMFLYLEVLDASFSFDGVIAAFAITNDIVLMSLGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +     IPE+ TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYIYLEHGAHYAIGALAVILMISIRYQIPEVVTGLIGVLLIAGS 351

Query: 339 IYSSIKNK 346
            +SS+++ 
Sbjct: 352 FWSSVRHN 359


>gi|294629126|ref|ZP_06707686.1| integral membrane protein [Streptomyces sp. e14]
 gi|292832459|gb|EFF90808.1| integral membrane protein [Streptomyces sp. e14]
          Length = 379

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 125/367 (34%), Positives = 201/367 (54%), Gaps = 41/367 (11%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F W+  +TV G +  +           G  +   +  ILAV+EISLSF+NA++NA  
Sbjct: 1   MKTFGWSFAITVLGLIAAVFY---------GGWTAFGVVAILAVLEISLSFDNAVVNAGI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + + PIEA++LA      Y ++++
Sbjct: 52  LKKMNAFWQKIFLTVGVLIAVFGMRLVFPVVIVAITAKMGPIEAVHLAFSDKDRYQQLVT 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FL+M+ L F F     + W+ ++E  ++ L K+  + + I L ++   
Sbjct: 112 DAHPAIAAFGGMFLLMIFLDFIF-EDRDIQWLRWIERPLAKLGKVDMLSVCIALIVLLIT 170

Query: 191 SNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL----------------- 223
           S    T          ++  + + +  A +I +  +  L                     
Sbjct: 171 SFTFATHAHQHGGGHVDKAQTVLIAGIAGLITYMVVGGLSGFFEDRLEDEEEREHEEEEA 230

Query: 224 ----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIY 279
                      V  G+    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+Y
Sbjct: 231 AARSGKQKPAIVLAGQAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVMMALGLGIGAMY 290

Query: 280 VRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSI 339
           VRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +     I E+ TG    +LI  S 
Sbjct: 291 VRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILMVTIQYQINEVITGLVGVVLIAWSF 350

Query: 340 YSSIKNK 346
           +SS++  
Sbjct: 351 WSSVRRN 357


>gi|302560847|ref|ZP_07313189.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302478465|gb|EFL41558.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 379

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 127/368 (34%), Positives = 203/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +         L G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAV---------LFGGWTAFGIVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + PIEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAISAQLGPIEAVDLALSDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L I+  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIF-EDRDIKWLAWLERPLAKLGKVDMLSVCIALVILLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 172 SAMTFATNAHQHGGGHADKAETVLLSGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    +     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 KAERAGKPRTGVALAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L++I+ +     I E+ TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALALILLVTIQYQIHELITGLIGVVLIGAS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|326780652|ref|ZP_08239917.1| protein of unknown function DUF475 [Streptomyces cf. griseus
           XylebKG-1]
 gi|326660985|gb|EGE45831.1| protein of unknown function DUF475 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 387

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 122/370 (32%), Positives = 206/370 (55%), Gaps = 41/370 (11%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
             ++  F W+  VT  G +  +         L G  +   +  IL+++EIS+SF+NA++N
Sbjct: 5   TVILKTFGWSFAVTALGLVVAV---------LYGGWAAFGVVAILSILEISVSFDNAVVN 55

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+KM++ WQ+ FLT G+LIAVFGMR++FP++IV I + + P+EA++LAI   + Y +
Sbjct: 56  AGILKKMNAFWQRIFLTIGVLIAVFGMRLVFPVVIVAISAKVGPVEAVDLAINDAERYEQ 115

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +++ AH  I+ FGG FL+M+ L F F     + W+ +LE  ++   KI    + + L ++
Sbjct: 116 LVTDAHPSIAAFGGMFLLMIFLDFVF-EDRDIKWLGWLERPLAKFGKIDMASVCVALIVL 174

Query: 188 FGISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSSD----------- 226
              +    T          ++  + + S    +I +  +  L     +            
Sbjct: 175 AISAMTFATQAHQHGGTHVDKASTVLLSGVFGLITYLVVGGLSGFFENKLEEEEEREHEA 234

Query: 227 ----------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIG 276
                     +   +  GK    +FLYLE++DAS S DGVI++FAIT +  ++ +GL IG
Sbjct: 235 EEEARRSGRNAPVVLMAGKAAFFMFLYLEVLDASFSFDGVIAAFAITNDIVLMSLGLGIG 294

Query: 277 AIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIF 336
           A+YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +     IPE+ TG    +LI 
Sbjct: 295 AMYVRSLTVYLVRQGTLDDYIYLEHGAHYAIGALAVILMISIRYQIPEVVTGLIGVLLIA 354

Query: 337 LSIYSSIKNK 346
            S +SS+++ 
Sbjct: 355 GSFWSSVRHN 364


>gi|320011014|gb|ADW05864.1| protein of unknown function DUF475 [Streptomyces flavogriseus ATCC
           33331]
          Length = 383

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 127/368 (34%), Positives = 203/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G      +  IL+V+EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVFY---------GGWQAFGVVAILSVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + + PIEA++L+   P  Y +++
Sbjct: 53  ILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVVIVAISAQLGPIEAIDLSFNDPDRYKELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ ++E  ++ L K+  + + + L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIF-EDRDIQWLRWIERPLAKLGKVDMLSVCVALIVLLV 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 172 SAMTFATHAHQHGGGHADKASTVMLSGIAGLITYLVVGGLSGFFENKLEEEEEREQEAEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S  +  GK    +FLYLE++DAS S DGVI +FAIT    ++ +GL IGA+
Sbjct: 232 EAKKAGKPVSGVLLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNEIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  LSVI+ +    +I E+ TG+   ILI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSVILLVTIQYEINELITGSVGVILIGWS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|77164520|ref|YP_343045.1| hypothetical protein Noc_1007 [Nitrosococcus oceani ATCC 19707]
 gi|254434206|ref|ZP_05047714.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
 gi|76882834|gb|ABA57515.1| Protein of unknown function DUF475 [Nitrosococcus oceani ATCC
           19707]
 gi|207090539|gb|EDZ67810.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
          Length = 333

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 134/339 (39%), Positives = 211/339 (62%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF+++ LVTVAG +            L G  + ++I  IL V+EISLSF+NA++NA  
Sbjct: 1   MRHFKYSFLVTVAGLVAAF---------LWGGPAGLFIAAILGVLEISLSFDNAVVNASV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M   WQ RFLTWGILIAVFGMR++FP+ IV IV+ I  +E   +A+  P  Y   + 
Sbjct: 52  LKDMDPKWQARFLTWGILIAVFGMRLVFPVAIVAIVADIGILEVTQMALNDPDAYSAHLL 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            +HV IS FGG FL+MV L+F  +   +LHW   +E  ++ + K++ I+I I L +++ +
Sbjct: 112 ASHVDISAFGGMFLLMVFLSFLLDETKELHWWGLVEEKLAGIGKLESIEIVIALGVLWAL 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV---THGKHGLNLFLYLEII 247
            + LP  E    + +  + +++F  +     +   + +         + G+  FLYLE++
Sbjct: 172 QSFLPPEEKLDAMLAGISGVMLFVIVGSASGLFEVEETGEAVTHAAKRSGVMGFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAI+K+  II++GL IGA++VRS+T+ ++++G L++Y +LEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAISKDVIIIMLGLAIGAMFVRSITVYLVRKGTLSEYVFLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L++IM   T V IPE+ TG      I LS+ SSI+ +
Sbjct: 292 GALALIMLASTKVHIPEVVTGLIGAAFIGLSLLSSIRYR 330


>gi|329934789|ref|ZP_08284830.1| Integral membrane protein [Streptomyces griseoaurantiacus M045]
 gi|329305611|gb|EGG49467.1| Integral membrane protein [Streptomyces griseoaurantiacus M045]
          Length = 379

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 125/368 (33%), Positives = 202/368 (54%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +T  G +  +              +   I  ILAV+EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAITALGLVAAVFYD---------GWTGFGIVAILAVLEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + +NP +A++LA    + Y +++
Sbjct: 53  VLKKMNAFWQKIFLTIGVLIAVFGMRLVFPVVIVAITAKLNPWDAVDLAFSDKERYQQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L  +  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIF-EDRDIKWLAWLERPLAKLGKVDMLSVCIALIALLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            S  +            ++  + + S  A +I +  +  L                    
Sbjct: 172 SSMTVAAHAHQHGGVHVDKGQTVLLSGIAGLITYMIVGGLSGYFEDRLEEQEEREHEEEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S  +  G+    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 AAERSGRKKSPVLLAGQAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVMMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIQYEINEVITGLVGVVLIAWS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|310817114|ref|YP_003965078.1| hypothetical protein EIO_2703 [Ketogulonicigenium vulgare Y25]
 gi|308755849|gb|ADO43778.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 348

 Score =  352 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 147/338 (43%), Positives = 227/338 (67%), Gaps = 2/338 (0%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFT-HTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           + +F+W  +VT  G +    +GW      +S  +S +++ I+LA++EISLSF+NAI+NA 
Sbjct: 5   LKYFKWPFIVTATGLILSFWLGWNSGPGGMSPALSFLFVGIVLAILEISLSFDNAIVNAN 64

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M+ +WQ+RFLTWGILIAVFGMR++FP++IV + + I PIEA+ LA      Y  II
Sbjct: 65  KLKDMTPVWQRRFLTWGILIAVFGMRVVFPVLIVVVAARIGPIEAIWLAATDEAQYAAII 124

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           ++AH  I+ FG TFLMMV L FF NS+  +HWI   E  ++H S ++G ++ +VL I+  
Sbjct: 125 NEAHPSIAAFGSTFLMMVGLKFFMNSEKDVHWIGGFERWLNHFSSVRGFEVALVLVIVMI 184

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            SN +P  E  +F++S+   ++ F  +  +  +L    +   T  K G   FLYLE++DA
Sbjct: 185 FSNFVPEGEELTFLTSAIYGLLTFLIVEVIGHLLDEQQAALSTAAKGGFGAFLYLEVLDA 244

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++  L +++YLEHG++YSI +
Sbjct: 245 SFSFDGVIGAFALTQNLFLIAIGLGIGAMYVRSMTIMLVERQTLAQFRYLEHGAFYSILI 304

Query: 310 LSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIKNK 346
           LSVIM +QT+ + +PE+ TG      I  ++++SI+  
Sbjct: 305 LSVIMLIQTLHIHVPEVITGLLGAGFIATALWASIRYN 342


>gi|302518790|ref|ZP_07271132.1| integral membrane protein [Streptomyces sp. SPB78]
 gi|302427685|gb|EFK99500.1| integral membrane protein [Streptomyces sp. SPB78]
          Length = 375

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 130/368 (35%), Positives = 208/368 (56%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +TV G +              G  +   +  ILAV+EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFGITVLGLVAAAFY---------GGWTAFGVVAILAVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV + + INP++A++LAI +   Y  ++
Sbjct: 53  ILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVLIVAVTAKINPVDAVDLAINNKDHYQALV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FLMM+ L F F   + + W+ +LE  ++ L K+  + + + L ++  
Sbjct: 113 TDAHPAIAAFGGMFLMMIFLDFIF-EDHDIKWLGWLERPLAKLGKVDMLSVCVALILLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSSD------------- 226
            S  + T          ++  + + S  A +I +  +  L     +              
Sbjct: 172 ASMTVATHAHVHGGGHVDKAETVLLSGIAGLITYLIVGGLSGFFENKLEDEEEREEEREE 231

Query: 227 --------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE+IDAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAVKGGTSRSAVALAGKGAFFMFLYLEVIDASFSFDGVIGAFAITNDIILMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           Y+RS+T+ +++QG L+ Y YLEHG++Y+I  LSV++ +    +IPE+ TG    +LI  S
Sbjct: 292 YIRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSVLLLVTIRYEIPEVVTGLIGVVLIAAS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|329849078|ref|ZP_08264106.1| integral membrane protein TerC family protein [Asticcacaulis
           biprosthecum C19]
 gi|328844141|gb|EGF93710.1| integral membrane protein TerC family protein [Asticcacaulis
           biprosthecum C19]
          Length = 378

 Score =  352 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 131/339 (38%), Positives = 211/339 (62%), Gaps = 2/339 (0%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTL-SGTISTVYICIILAVVEISLSFENAILNA 68
           ++ +F  +I  TV   +    +G+  +  + S  +  V++  +L V+E SLS +NA++NA
Sbjct: 1   MLKNFYGSIAFTVVSLILAGVLGYYQSGGMASAVLQMVFLACVLGVMETSLSLDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M  +WQ+RFLTWGILIAVFGMRIIFPI+IV I + + P EA  +AI   + Y  I
Sbjct: 61  SILKDMDPVWQRRFLTWGILIAVFGMRIIFPILIVSISAMVTPWEATRIAIMDHERYETI 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH+ ISGFGG FLM+V L FFF+   + HW+ F+E  ++ L+KI      +   +I 
Sbjct: 121 VTGAHIGISGFGGAFLMLVGLNFFFDDDREHHWLGFIERPLAALAKIPFSPYIVTALLIG 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLES-VLSSDSSNNVTHGKHGLNLFLYLEII 247
           G+S ++   E  +F+ +  + ++ F+ +      V   +  +     + G   F+YLE +
Sbjct: 181 GLSFMVHGEEQKTFLIAGLSGVVTFFAVQKFGDWVGGGEKDHTGAVVRTGAGGFIYLEFL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT +  +I +GL IGA++VRSMT+ +++ G L ++++LE G++Y+I
Sbjct: 241 DASFSFDGVIGAFAITNDIILIALGLGIGAMFVRSMTIALVRGGHLAEFRFLEAGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L+ IM L   + IPE+ TG    I+I +S++ SI++K
Sbjct: 301 IALASIMLLSIKLHIPEVVTGLIGAIIIGVSLWVSIEHK 339


>gi|58424690|gb|AAW73727.1| integral membrane protein [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 381

 Score =  351 bits (901), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 125/347 (36%), Positives = 215/347 (61%), Gaps = 6/347 (1%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           S  L   +   FR ++LV           G     T  G    +++C++L+V+E+SLSF+
Sbjct: 28  SARLGVPMFREFRMSLLVAAVCLGVAAWWG---HTTALGLWQALWLCLVLSVLEVSLSFD 84

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NA++NA  L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +     M +A+  P
Sbjct: 85  NAVVNAGVLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLAPVMQMALKEP 144

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
           + Y ++++  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + +
Sbjct: 145 ERYSQVLTDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIV 204

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLN 239
            +S++ G    LP     S + +    I+++  +  ++++  ++ S +   G   + G+ 
Sbjct: 205 AVSVLLGTKLFLPEGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIA 264

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
            FLYLE++DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +L
Sbjct: 265 AFLYLEVLDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFL 324

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           EHG++Y+I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 325 EHGAHYAIGVLAIIMLVGTVHHVPEVLTGLIGVAFIAASVWSSIRYR 371


>gi|331697380|ref|YP_004333619.1| hypothetical protein Psed_3595 [Pseudonocardia dioxanivorans
           CB1190]
 gi|326952069|gb|AEA25766.1| protein of unknown function DUF475 [Pseudonocardia dioxanivorans
           CB1190]
          Length = 571

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 115/374 (30%), Positives = 197/374 (52%), Gaps = 49/374 (13%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F W+           +         + G +  + +C IL V+EISLSF+NA++NA  
Sbjct: 3   LRIFGWSY---------AVTAAALVVAFVYGGVEALVLCAILGVLEISLSFDNAVVNATV 53

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQDY 125
           L++MS+ WQ+ FLT GI+IAVFGMR++FP++IV I + +NP+EA  LA+       P  Y
Sbjct: 54  LERMSAFWQRIFLTVGIVIAVFGMRLVFPLLIVGITANLNPVEAFRLALEQRPESDPTSY 113

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
             ++++A+  I+ FGG FL+M+ L + F ++  + W+ +LE  ++ + ++  + I + + 
Sbjct: 114 AHLLNEAYPSIAAFGGMFLLMLFLDWLF-AERDVRWLSWLERPLARIGQLNRLSIILAVV 172

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV-------------- 231
            +  ++  L  +     + + T  ++ +  +N L  +       +               
Sbjct: 173 ALVVLAGTLAADPA-KVLVAGTLGLVTYLLVNGLGDLFEQAGGADAIASSGEEAGDGAEE 231

Query: 232 ------------------THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
                               GK G  LFLYLE++DA+ S DGVI +FAIT +  II +GL
Sbjct: 232 GGNGAAAARPGGPSGLAKAAGKAGFFLFLYLEVLDAAFSFDGVIGAFAITTDPIIIALGL 291

Query: 274 T-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSST 332
             IGA++VRS+T+ ++++G L  Y YLEHG++++I  LSVI+ +     + E+ TG    
Sbjct: 292 GLIGAMFVRSLTVFLVRKGTLADYVYLEHGAHWAIGALSVILLVGIGYHVDEVVTGLIGV 351

Query: 333 ILIFLSIYSSIKNK 346
             I  +  SS+   
Sbjct: 352 AFIGAAFVSSVIRN 365


>gi|318058639|ref|ZP_07977362.1| hypothetical protein SSA3_11895 [Streptomyces sp. SA3_actG]
 gi|318077136|ref|ZP_07984468.1| hypothetical protein SSA3_10533 [Streptomyces sp. SA3_actF]
          Length = 379

 Score =  350 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 130/372 (34%), Positives = 208/372 (55%), Gaps = 45/372 (12%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +TV G +              G  +   +  ILAV+EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFGITVLGLVAAAFY---------GGWTAFGVVAILAVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV + + INP++A++LAI +   Y  ++
Sbjct: 53  ILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVLIVAVTAKINPVDAVDLAINNKDHYQALV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FLMM+ L F F   + + W+ +LE  ++ L K+  + + + L ++  
Sbjct: 113 TDAHPAIAAFGGMFLMMIFLDFIF-EDHDIKWLGWLERPLAKLGKVDMLSVCVALILLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSSD------------- 226
            S  + T          ++  + + S  A +I +  +  L     +              
Sbjct: 172 ASMTVATHAHVHGGGHVDKAETVLLSGIAGLITYLIVGGLSGFFENKLEDEEEREEEREE 231

Query: 227 ------------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT 274
                        S     GK    +FLYLE+IDAS S DGVI +FAIT +  ++ +GL 
Sbjct: 232 EREEEAVKGGTSRSAVALAGKGAFFMFLYLEVIDASFSFDGVIGAFAITNDIILMALGLG 291

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA+Y+RS+T+ +++QG L+ Y YLEHG++Y+I  LSV++ +    +IPE+ TG    +L
Sbjct: 292 IGAMYIRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSVLLLVTIRYEIPEVVTGLIGVVL 351

Query: 335 IFLSIYSSIKNK 346
           I  S +SS++  
Sbjct: 352 IAASFWSSVRRN 363


>gi|239933245|ref|ZP_04690198.1| hypothetical protein SghaA1_33788 [Streptomyces ghanaensis ATCC
           14672]
 gi|291441593|ref|ZP_06580983.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291344488|gb|EFE71444.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 363

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 125/367 (34%), Positives = 201/367 (54%), Gaps = 40/367 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  FRW  +VT  G   G          L    + + +  ILAV+E+SLSF+NA++NA 
Sbjct: 2   LLKTFRWTFVVTALGLAAGA---------LYDGWTALGLVAILAVLEVSLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L++++  WQK FLT GILIAVFGMR++FPI+IV + + + P +A++LA+     Y +++
Sbjct: 53  ILKRLNVFWQKIFLTVGILIAVFGMRLLFPIVIVAVSARLTPSQAVHLALTDKARYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F   ++  W+  +E  ++ L +I  + + I L+++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFVF-EDHETKWLGPVERLLAKLGRIDMLSVCIALAVLLV 171

Query: 190 ISNILP----------TNEMYSFVSSSTAAIIIFYGINFLESVLSSD------------- 226
            S               ++  + + S  A +I +  +  L                    
Sbjct: 172 TSMTFAAHAHQHGGVHADKAQTVLVSGIAGLITYLVVGGLSGFFEDRLAARENESRAEQR 231

Query: 227 -------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIY 279
                   S     GK     FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+Y
Sbjct: 232 PEGVGGGRSAVALAGKAAFFTFLYLEVLDASFSFDGVIGAFAITNDIILMALGLGIGAMY 291

Query: 280 VRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSI 339
           VRS+T+ +++QG L+ Y YLEHG++Y+I  L++I+ +    +I +I TG     LI  S 
Sbjct: 292 VRSLTVYLVRQGTLDDYVYLEHGAHYAIGALALILLVSIQYEINDIVTGLIGVTLICASF 351

Query: 340 YSSIKNK 346
           YSS+++ 
Sbjct: 352 YSSVRHN 358


>gi|21224631|ref|NP_630410.1| hypothetical protein SCO6313 [Streptomyces coelicolor A3(2)]
 gi|13872777|emb|CAC37534.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 363

 Score =  349 bits (895), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 121/337 (35%), Positives = 190/337 (56%), Gaps = 34/337 (10%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G  +   I  IL+V+EISLSF+NA++NA  L+KM++ WQK FLT GILIAVFGMR++FP+
Sbjct: 9   GGWTAFGIVAILSVMEISLSFDNAVVNAGILKKMNAFWQKIFLTVGILIAVFGMRLVFPV 68

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV I   + PIEA++LA+     Y ++++ AH  I+ FGG FL+M+ L F F     + 
Sbjct: 69  VIVAIS--LGPIEAVDLALTDKDRYQELVTDAHPSIAAFGGMFLLMIFLDFVF-EDRGIK 125

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNIL----------PTNEMYSFVSSSTAAI 210
           W+ +LE  ++ L ++  + + I L ++   +               ++  + + +  A +
Sbjct: 126 WLAWLERPLAKLGRVDMLSVCIALVVLLVSATTFGAHAHQHGGAHADKAETVLLAGIAGL 185

Query: 211 IIFYGINFLESVLSS---------------------DSSNNVTHGKHGLNLFLYLEIIDA 249
           I +  +  L                             S     GK    +FLYLE++DA
Sbjct: 186 ITYMIVGGLSGYFEDKLEEEEEREHEEEEEAARTGKPKSAVRLAGKAAFFMFLYLEVLDA 245

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG L+ Y YLEHG++Y+I  
Sbjct: 246 SFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGA 305

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+VI+ +    +I EI TG     LI  S +SS++  
Sbjct: 306 LAVILLVTIQYEIHEIITGLVGVALIGWSFFSSVRRN 342


>gi|302557720|ref|ZP_07310062.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302475338|gb|EFL38431.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 371

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 127/368 (34%), Positives = 203/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +         L G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAV---------LFGGWTAFGIVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + PIEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAISAQLGPIEAVDLALSDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L I+  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIF-EDRDIKWLAWLERPLAKLGKVDMLSVCIALVILLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 172 SAMTFATNAHQHGGGHADKAETVLLSGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    +     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 KAERAGKPRTGVALAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L++I+ +     I E+ TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALALILLVTIQYQIHELITGLIGVVLIGAS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|302562519|ref|ZP_07314861.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302480137|gb|EFL43230.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 366

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 123/367 (33%), Positives = 200/367 (54%), Gaps = 40/367 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  FRWA  VT  G + G+         L    + + +  ILAV+E+SLSF+NA++NA 
Sbjct: 2   LLKTFRWAFAVTALGLVAGV---------LYDGWTALGLVAILAVLEVSLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+++++ WQ+ FLT GILIAVFGMR++FPI+IV + + + P +A++LA+     Y +++
Sbjct: 53  ILKRLNAFWQRMFLTIGILIAVFGMRLLFPIVIVTVSARLAPSQAVHLALTDKDRYQQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F    +  W+  LE  ++ L +I  + + + L ++  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIF-EDRETKWLGPLERPLARLGRIDMLSVCLALCVLLV 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSSD------------- 226
            S               ++  + + S  A +I +  +  L                    
Sbjct: 172 TSLTFAAHAHQHGGTHADKAQTVLVSGIAGLITYLVVGGLSGFFEGRLADEESRRQREER 231

Query: 227 -------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIY 279
                   S     G+     FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+Y
Sbjct: 232 SGGAGGGGSTLALSGRAAFFTFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMY 291

Query: 280 VRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSI 339
           VRS+T+ +++QG L+ Y YLEHG++Y+I  L++I+ +     I ++ TG     LI  S 
Sbjct: 292 VRSLTVYLVRQGTLDDYVYLEHGAHYAIGALALILLVSIQYQINDVVTGLIGVTLIGASF 351

Query: 340 YSSIKNK 346
           YSS++  
Sbjct: 352 YSSVRRN 358


>gi|93004828|ref|YP_579231.1| hypothetical protein Pcryo_2516 [Psychrobacter cryohalolentis K5]
 gi|92395390|gb|ABE76293.1| protein of unknown function DUF475 [Psychrobacter cryohalolentis
           K5]
          Length = 354

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 121/348 (34%), Positives = 203/348 (58%), Gaps = 14/348 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF    + T          G+     + G I+T+ I  ILAV+EISLSF+NA++NA  
Sbjct: 1   MRHFYLDFIFTAIALAIAAWWGYS-HGGMGGLIATLSITAILAVMEISLSFDNAVVNASV 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+     W+K FLT GILIAVFGMR++FPI+IV + + +  ++ ++LA+  P++Y   + 
Sbjct: 60  LKGWDEFWKKIFLTVGILIAVFGMRLVFPIVIVAVTADLGMMQVIDLALNDPKEYSARLM 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F F+   ++HW  +LE  ++ L K+  + +F+ L ++   
Sbjct: 120 AHHAEISAFGGIFLLLVFLNFIFDD-KEVHWFDWLESRLAKLGKVDAMSVFVALIVLMIA 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD------------SSNNVTHGKHGL 238
            +     +  + + +    I+++ G+  +  +L  D             +      K G+
Sbjct: 179 VSFANPEQSAAVLIAGIWGILVYLGVQVVSGMLEGDLEEELDAQGNSTGAATSAIMKGGI 238

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
             FLYLE++DAS S DGVI +FAIT +  +I++GL IGA++VRSMT+ ++ +G L+++ Y
Sbjct: 239 IGFLYLEVLDASFSFDGVIGAFAITNDVIVIMLGLAIGAMFVRSMTIFLVDKGTLDEFVY 298

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           LEHG++Y+I  L++IM L     +PE+ TG      I  ++ +S+K++
Sbjct: 299 LEHGAHYAIGALAIIMLLSVKFHVPELITGLIGIAFIGWALLASLKHR 346


>gi|325920185|ref|ZP_08182144.1| hypothetical protein XGA_1089 [Xanthomonas gardneri ATCC 19865]
 gi|325549325|gb|EGD20220.1| hypothetical protein XGA_1089 [Xanthomonas gardneri ATCC 19865]
          Length = 346

 Score =  346 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 122/339 (35%), Positives = 211/339 (62%), Gaps = 5/339 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR + LVT          G     T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSFLVTAVCLGVAAWWG---HTTSMGLWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + ++++  
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVTVLLC 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN--VTHGKHGLNLFLYLEII 247
               LP     S + +    I+++  +  ++++  S+ S +      + G+  FLYLE++
Sbjct: 178 TKLFLPDAVFQSVLFAGLGGILLYLLVGSVDALFESEESEDGMGPAKRSGIAAFLYLEVL 237

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I
Sbjct: 238 DASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAI 297

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 GVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 336


>gi|326570893|gb|EGE20917.1| hypothetical protein E9S_04142 [Moraxella catarrhalis BC7]
          Length = 358

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 128/354 (36%), Positives = 203/354 (57%), Gaps = 20/354 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF + I+ T    +     G+     +S     + I  ILA++EISLSF+NA++NA  
Sbjct: 1   MRHFLFDIIFTFVCLVIAAWWGYS-HGGISEMFLALGITAILAIMEISLSFDNAVVNASI 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+  +  W+K FLT GILIAVFGMR+IFPI IV + + +   E ++LA+ +P  Y + ++
Sbjct: 60  LKGWNDFWKKIFLTVGILIAVFGMRLIFPIAIVAVTANLGMGEVIHLALNNPVQYAEHLN 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F F     +HW  +LE  +   SK+  + +F+ L ++   
Sbjct: 120 AHHAEISAFGGMFLLLVFLNFMF-GDKDVHWFKWLESRLVKFSKVDAMSVFVALVVLMIS 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---------------- 234
            + +   +    + +    I+++ G++ L ++L  D  + V                   
Sbjct: 179 MSWVEEAKQGVVMVAGIWGILVYLGVSVLSALLEGDGDDKVAVYDAKGREITNTAGVSST 238

Query: 235 --KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K G+  FLYLE++DAS S DGVI +FAIT +  +I+IGL IGA++VRSMT+ ++ +G 
Sbjct: 239 ILKGGIAGFLYLEVLDASFSFDGVIGAFAITNDVIVIMIGLAIGAMFVRSMTIYLVNKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+ + YLEHG++Y+I  L++IM L T   +PEI TG      I LS+++SI+  
Sbjct: 299 LSDFIYLEHGAHYAIGALAIIMLLSTRFHVPEIITGLIGVAFIVLSVFNSIQYN 352


>gi|296113354|ref|YP_003627292.1| hypothetical protein MCR_1135 [Moraxella catarrhalis RH4]
 gi|295921048|gb|ADG61399.1| conserved hypothetical protein [Moraxella catarrhalis RH4]
 gi|326559695|gb|EGE10106.1| hypothetical protein E9M_08618 [Moraxella catarrhalis 46P47B1]
 gi|326560335|gb|EGE10723.1| hypothetical protein E9G_07104 [Moraxella catarrhalis 7169]
 gi|326562006|gb|EGE12336.1| hypothetical protein E9K_08302 [Moraxella catarrhalis 103P14B1]
 gi|326566345|gb|EGE16495.1| hypothetical protein E9Q_07959 [Moraxella catarrhalis BC1]
 gi|326570155|gb|EGE20200.1| hypothetical protein E9U_04630 [Moraxella catarrhalis BC8]
 gi|326574500|gb|EGE24442.1| hypothetical protein E9Y_06042 [Moraxella catarrhalis 101P30B1]
 gi|326575912|gb|EGE25835.1| hypothetical protein E9W_03090 [Moraxella catarrhalis CO72]
 gi|326576376|gb|EGE26285.1| hypothetical protein EA1_05452 [Moraxella catarrhalis O35E]
          Length = 358

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 127/354 (35%), Positives = 202/354 (57%), Gaps = 20/354 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF + I+ T    +     G+     +S     + I  ILA++EISLSF+NA++NA  
Sbjct: 1   MRHFLFDIIFTFVCLVIAAWWGYS-HGGISEMFLALGITAILAIMEISLSFDNAVVNASI 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+  +  W+K FLT GILIAVFGMR+IFPI IV + + +   E ++LA+ +P  Y + ++
Sbjct: 60  LKGWNDFWKKIFLTVGILIAVFGMRLIFPIAIVAVTANLGMGEVIHLALNNPVQYAEHLN 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F F     +HW  +LE  +   SK+  + +F+ L ++   
Sbjct: 120 AHHAEISAFGGMFLLLVFLNFMF-GDKDVHWFKWLESRLVKFSKVDAMSVFVALVVLMIS 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---------------- 234
            + +   +    + +    I+++ G++ L ++L  D  +                     
Sbjct: 179 MSWVEEAKQGVVMVAGIWGILVYLGVSVLSALLEGDGDDKAAVYDAKGREITNTAGVSST 238

Query: 235 --KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K G+  FLYLE++DAS S DGVI +FAIT +  +I+IGL IGA++VRSMT+ ++ +G 
Sbjct: 239 ILKGGIAGFLYLEVLDASFSFDGVIGAFAITNDVIVIMIGLAIGAMFVRSMTIYLVNKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+ + YLEHG++Y+I  L++IM L T   +PEI TG      I LS+++SI+  
Sbjct: 299 LSDFIYLEHGAHYAIGALAIIMLLSTRFHVPEIITGLIGVAFIVLSVFNSIQYN 352


>gi|21233409|ref|NP_639326.1| hypothetical protein XCC3987 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66770374|ref|YP_245136.1| hypothetical protein XC_4077 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188993574|ref|YP_001905584.1| hypothetical protein xccb100_4179 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21115249|gb|AAM43208.1| integral membrane protein [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66575706|gb|AAY51116.1| integral membrane protein [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167735334|emb|CAP53548.1| integral membrane protein [Xanthomonas campestris pv. campestris]
          Length = 347

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 122/340 (35%), Positives = 212/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR + LVT          G     +  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSFLVTAICLGLAAWWG---HTSSMGIWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M+  W+K FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNEFWRKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+   KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDQDRKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP     S + +    I+++  +  ++++  ++ S + + G   + G+  FLYLE+
Sbjct: 178 TKLFLPDAVFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|262204555|ref|YP_003275763.1| hypothetical protein Gbro_4752 [Gordonia bronchialis DSM 43247]
 gi|262087902|gb|ACY23870.1| protein of unknown function DUF475 [Gordonia bronchialis DSM 43247]
          Length = 380

 Score =  345 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 120/371 (32%), Positives = 201/371 (54%), Gaps = 44/371 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F  + +VT+   +            L G    + + +IL ++E+SLSF+NA++NA 
Sbjct: 2   VVRIFGISFVVTIGAMIIAF---------LYGGWQALILTVILGILEVSLSFDNAVINAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD----- 124
            L++MS  WQK FLT GILIAVFGMR++FP+ IV + S + P++A++LA+  P D     
Sbjct: 53  VLRRMSEFWQKIFLTIGILIAVFGMRLVFPLAIVWMASGLGPVQALDLALNPPPDDAAYF 112

Query: 125 ------YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                 Y  II+ AH  I+ FGG FL+M+ L F    + ++ W+ ++E  +  + K++ +
Sbjct: 113 PNGDPSYETIITDAHPQIAAFGGMFLLMLFLGFVL-EEKEITWLSWIERPLERIGKLEML 171

Query: 179 KIFIVLSIIFGISNILPT-NEMYSFVSSSTAAIIIFYGINFLESVL-------------- 223
           ++ I   ++   +  +    E  + + +    +I +  +N L  +               
Sbjct: 172 EVVIATGLLIITAEYIAAPEERSTVMIAGALGMITYIAVNGLGELFKVDNVVDDEDADPA 231

Query: 224 -------SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-I 275
                     S      GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL  I
Sbjct: 232 PENAKRSGGPSDLAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGLGLI 291

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA++VRS+T+ ++++G L++Y YLEHG++++I  L+ I+       + E+ TG    +LI
Sbjct: 292 GAMFVRSLTVYLVRKGTLSEYVYLEHGAHWAIGALAFILLYSIGTHVNEVITGLVGVVLI 351

Query: 336 FLSIYSSIKNK 346
             +  SSI  +
Sbjct: 352 GAAFASSIVRR 362


>gi|262370905|ref|ZP_06064229.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262314267|gb|EEY95310.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 359

 Score =  345 bits (885), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 123/356 (34%), Positives = 204/356 (57%), Gaps = 21/356 (5%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAI 65
           ++ HF ++I+ T+      L   W FTH     + T++    I  ILAV+E+SLSF+NA+
Sbjct: 1   MMKHFGFSIIFTIVCL--ALSAYWGFTHGPEAGLKTMFTALTITAILAVMEVSLSFDNAV 58

Query: 66  LNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDY 125
           +NA  L+     W+  FLT GIL+AVFGMR+IFP+ IV + + +  +E + LA+  P+ Y
Sbjct: 59  VNASVLRGWDHFWKTLFLTVGILVAVFGMRLIFPVAIVAVTADMGFVEVVQLALNDPKTY 118

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + +   H  I+ FGG FL++V L FF + +   HW  +LE  +++L+ +  + +F+ L 
Sbjct: 119 SQRLMDHHPEIAAFGGAFLLLVFLNFFLDEEKDTHWFRWLERRLANLANVPAMSVFLALI 178

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNV 231
            +  ++  +   +      +    I+++ G+  L  +L  +              +    
Sbjct: 179 ALLVMAANVDEAKRLVVTMAGIWGIVVYIGVQVLSHLLGGEPEVDEDGNAVTHDANGATT 238

Query: 232 THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
              K G+  FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ ++++G
Sbjct: 239 GVVKAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEKG 298

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L+ Y +LEHG++Y+I  L+ IM    T + +PE+ TG      I  ++ +SI+ K
Sbjct: 299 TLDAYVFLEHGAHYAIGALAFIMLASGTGLHVPEVVTGLIGVAFIVWAVIASIQYK 354


>gi|255320296|ref|ZP_05361481.1| integral membrane protein [Acinetobacter radioresistens SK82]
 gi|262380493|ref|ZP_06073647.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|255302735|gb|EET81967.1| integral membrane protein [Acinetobacter radioresistens SK82]
 gi|262297939|gb|EEY85854.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 360

 Score =  344 bits (884), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 130/355 (36%), Positives = 201/355 (56%), Gaps = 21/355 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAIL 66
           + HFR++I  TV      L   W +TH     I T++    I  ILAV+E+SLSF+NA++
Sbjct: 1   MKHFRFSIFFTVVCL--ALSAYWGYTHGPQAGIETMFKALTITAILAVMEVSLSFDNAVV 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  +E + LA+  P  Y 
Sbjct: 59  NASVLRNWDHFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGLMEVVRLALNDPTAYS 118

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           + +   H  I+ FGG FL++V L FF +     HW  +LE  ++ L+ +  + +FI L  
Sbjct: 119 QRLMDHHAEIAAFGGAFLLLVFLNFFLDEGKDTHWFRWLERRLTSLASVPAMSVFIALIA 178

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVT 232
           +  ++  +   +      +    I+I+ G+  L  +L  +              +     
Sbjct: 179 LLVVAANVDETKRLVVTMAGIWGIVIYIGVQVLSHLLGGEPEIDEEGNAVTHDSTGAATG 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K G   FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ ++++G 
Sbjct: 239 VVKAGFGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+ Y YLEHG++Y+I  L++IM    T V IPE+ TG      I  ++ +SI+ +
Sbjct: 299 LDAYIYLEHGAHYAIGALAIIMLASGTGVHIPEVVTGLIGVAFIVWAVLASIQYR 353


>gi|302545763|ref|ZP_07298105.1| integral membrane protein [Streptomyces hygroscopicus ATCC 53653]
 gi|302463381|gb|EFL26474.1| integral membrane protein [Streptomyces himastatinicus ATCC 53653]
          Length = 392

 Score =  344 bits (884), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 129/380 (33%), Positives = 202/380 (53%), Gaps = 53/380 (13%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G      +              + I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTAGGLALAGVLW---------GWKGLAIVGILSILEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + PIEA+NLAI   + Y  ++
Sbjct: 53  ILRKMNAFWQKIFLTVGILIAVFGMRLVFPVVIVAITAKLGPIEAVNLAINDKEKYEHLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F  +  + W+ +LE  +S L K+      I L+++  
Sbjct: 113 TGAHPAIAAFGGMFLLMIFLDFIF-EERDIRWLGWLEKPLSKLGKLDTFSAVIALAVLLV 171

Query: 190 ISNILPTNEMY-------SFVSSSTAAIIIFYGINFLESVLSSD---------------- 226
            +  + T+  +       + + S  A ++ +  +N +                       
Sbjct: 172 TATTVATDVAHGGGDKSATVLLSGVAGLMTYLIVNGISGFFEDKLEEDEDEEDGEGGADG 231

Query: 227 --------------------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNF 266
                               ++     GK    +FLYLE+IDAS S DGVI +FAIT + 
Sbjct: 232 EDEADEKKPAENGGGRGSSGATVVGLAGKAAFFMFLYLEVIDASFSFDGVIGAFAITNDI 291

Query: 267 FIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIF 326
           F + +GL IGA+Y+RS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+      +I E+ 
Sbjct: 292 FEMALGLGIGAMYIRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLATIKFEINELI 351

Query: 327 TGTSSTILIFLSIYSSIKNK 346
           TG+    LI  S +SS+   
Sbjct: 352 TGSVGIALIGASYWSSVIRN 371


>gi|111024984|ref|YP_707404.1| integral membrane protein [Rhodococcus jostii RHA1]
 gi|110823963|gb|ABG99246.1| possible integral membrane protein [Rhodococcus jostii RHA1]
          Length = 389

 Score =  344 bits (884), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 117/369 (31%), Positives = 200/369 (54%), Gaps = 39/369 (10%)

Query: 7   YASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAIL 66
              ++  F  +  VTV   +            + G    V + +IL+++EISLSF+NA++
Sbjct: 8   RFVVLRIFGLSFAVTVISLIIAA---------IYGGPQAVLLVVILSILEISLSFDNAVI 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD-- 124
           NA  L++MS  WQK FLT GI+IAVFGMR++FP++IV + S + P+ A++LA+  P D  
Sbjct: 59  NATVLRRMSEFWQKIFLTVGIVIAVFGMRLVFPLVIVWLASGLGPVAALDLALNPPADGA 118

Query: 125 ---------YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                    Y  +++ AH  I+ FGG FL+M+ L F    + ++ W+ +LE  ++   K+
Sbjct: 119 AYFPDGSASYETLLTDAHPQIAAFGGMFLLMLFLGFIL-EEREITWLSWLEKPLARAGKL 177

Query: 176 KGIKIFIVLSIIFGISNILPTNEMY-SFVSSSTAAIIIFYGINFLESVLSSDSSNN---- 230
             + + I  +++   +  +   +   + + +    ++ +  +N L  + ++   +     
Sbjct: 178 DQLAVIIAGALLLITAAYIAPEDTVSTVMIAGVLGMVTYIAVNGLGELFNTPEGDEDGEL 237

Query: 231 ------------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGA 277
                          GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL  +GA
Sbjct: 238 VEGSKGGPTELAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITSDPIIIALGLGFVGA 297

Query: 278 IYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFL 337
           ++VRS+T+ ++++G L+ Y YLEHG++++I  L+VI+ +     + E  TG     LI  
Sbjct: 298 MFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALAVILLVSIGYHVNENVTGLVGVALIGA 357

Query: 338 SIYSSIKNK 346
           +  SSI   
Sbjct: 358 AFISSIIRN 366


>gi|297194579|ref|ZP_06911977.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197722494|gb|EDY66402.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 381

 Score =  344 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 129/367 (35%), Positives = 200/367 (54%), Gaps = 40/367 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G                       I +IL+++EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLAFAAWQW---------GWEAFGIVLILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + PIEA+ LA+  P  Y  ++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAISAKVGPIEAVQLAMDQPDRYEDLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F  + +  W+ +LE  ++ L K+  + + I L ++  
Sbjct: 113 TDAHAAIAAFGGMFLLMIFLDFIF-EEREHKWLAWLERPLAKLGKVDMLSVCIALIVLLL 171

Query: 190 ISNILPT---------NEMYSFVSSSTAAIIIFYGINFLESVL----------------- 223
            +    T         ++  + + S  A +I +  +  L                     
Sbjct: 172 TAITFATNAHTSTGHADKSATVLLSGVAGLITYLVVGGLSGYFEDKLEEEEEREHEEEEK 231

Query: 224 ----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIY 279
                   S     GK    LFLYLE++DAS S DGVI +FAIT + F + +GL IGA+Y
Sbjct: 232 AKREGKPVSAVGLAGKAAFFLFLYLEVLDASFSFDGVIGAFAITNHIFWMALGLGIGAMY 291

Query: 280 VRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSI 339
           VRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S 
Sbjct: 292 VRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLITIQHEISELITGFIGVVLIAASF 351

Query: 340 YSSIKNK 346
           +SS++  
Sbjct: 352 WSSLRRN 358


>gi|78049718|ref|YP_365893.1| hypothetical protein XCV4162 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325927514|ref|ZP_08188752.1| hypothetical protein XPE_2776 [Xanthomonas perforans 91-118]
 gi|78038148|emb|CAJ25893.1| putative membrane protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|325542107|gb|EGD13611.1| hypothetical protein XPE_2776 [Xanthomonas perforans 91-118]
          Length = 347

 Score =  344 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 122/340 (35%), Positives = 214/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR + +VT          G     +  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSFVVTAICLGLAAWWG---HTSSMGIWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP     S + +    I+++  +  ++++  ++ S + + G   + G+  FLYLE+
Sbjct: 178 TKLFLPEAIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|93005600|ref|YP_580037.1| hypothetical protein Pcryo_0770 [Psychrobacter cryohalolentis K5]
 gi|93006611|ref|YP_581048.1| hypothetical protein Pcryo_1787 [Psychrobacter cryohalolentis K5]
 gi|92393278|gb|ABE74553.1| protein of unknown function DUF475 [Psychrobacter cryohalolentis
           K5]
 gi|92394289|gb|ABE75564.1| protein of unknown function DUF475 [Psychrobacter cryohalolentis
           K5]
          Length = 355

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 122/349 (34%), Positives = 206/349 (59%), Gaps = 15/349 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF    + T    +     G+     + G I+T+ I  ILAV+EISLSF+NA++NA  
Sbjct: 1   MRHFYLDFIFTAIALMVAAWWGYS-HGGMGGLITTLSITAILAVMEISLSFDNAVVNASV 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+     W+K FLT GILIAVFGMR++FPI+IV + + +  ++ ++LA+  P++Y   + 
Sbjct: 60  LKGWDEFWKKIFLTVGILIAVFGMRLVFPIVIVAVTADLGMMQVIDLALNDPKEYSARLM 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F F+   ++HW ++LE  ++ L K+  + +F+ L ++   
Sbjct: 120 AHHAEISAFGGIFLLLVFLNFIFDD-KEVHWFNWLESRLAKLGKVDAMSVFVALIVLMFA 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-------------SDSSNNVTHGKHG 237
            +     +  + + +    I+++ G+  +  +L              S ++      K G
Sbjct: 179 VSWASAEQASAVLIAGVWGILVYLGVQVISGMLEGDLEEDLENEEKGSGAAATSAIMKGG 238

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           +  FLYLE++DAS S DGVI +FAIT +  +I++GL IGA++VRSMT+ ++ +G L+++ 
Sbjct: 239 IIGFLYLEVLDASFSFDGVIGAFAITNDVIVIMLGLAIGAMFVRSMTIFLVDKGTLDEFI 298

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           YLEHG++Y+I  L++IM L     +PEI TG      I  ++ +S+K++
Sbjct: 299 YLEHGAHYAIGALAIIMLLSVKFHVPEIITGLIGIAFIGWALLASLKHR 347


>gi|78778040|ref|YP_394355.1| hypothetical protein Suden_1846 [Sulfurimonas denitrificans DSM
           1251]
 gi|78498580|gb|ABB45120.1| Protein of unknown function DUF475 [Sulfurimonas denitrificans DSM
           1251]
          Length = 341

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 128/339 (37%), Positives = 206/339 (60%), Gaps = 4/339 (1%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F+++ + T    L  L  G+      S  +S + + +ILA +E+SLSF+NA++NA  
Sbjct: 1   MSYFKFSFIFTFIALLISLWWGYHL-GGWSSALSMMLVTLILASMEVSLSFDNAVVNASI 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+     W+K FLT GILIAVFGMR++FP++IV   + +  +E  NLA+ +P +Y   + 
Sbjct: 60  LKTWDEYWKKLFLTVGILIAVFGMRLLFPLVIVAQTADMGILEVWNLALDNPVEYSSKLI 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F  + +  +HWI  +E  +  L KI+ I IF+ + ++   
Sbjct: 120 AHHAEISAFGGVFLLLVFLNFMLDEEKNIHWIEIIEKKLGLLGKIEAISIFVSIVVLMFF 179

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN---VTHGKHGLNLFLYLEII 247
           +  +   +  + +++    II++  ++ L  VL  +        T  K  +  FLYLE++
Sbjct: 180 ATFVEEGQKLAVLNAGLWGIIVYVSVDILGFVLEKEDEKKHISSTVKKGSIGGFLYLEVL 239

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAITK+  +I++GL IGA++VRS+T+ ++++G L+ Y YLEHG++Y+I
Sbjct: 240 DASFSFDGVIGAFAITKDIVVIMLGLGIGAMFVRSITIYLVEKGTLDSYIYLEHGAHYAI 299

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            +L+ IM       IPE+FTG      I LS+YSSIK +
Sbjct: 300 GILAFIMLFGMKFHIPELFTGLVGVAFILLSLYSSIKYR 338


>gi|315122332|ref|YP_004062821.1| hypothetical protein CKC_02920 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495734|gb|ADR52333.1| hypothetical protein CKC_02920 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 384

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 249/346 (71%), Positives = 299/346 (86%), Gaps = 1/346 (0%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           MK N     +IHHFRWAILVT+ G L  +GIGW+ +HTLSGT   +YICIILA++EISLS
Sbjct: 1   MKINPFQIDIIHHFRWAILVTIIGILLSIGIGWETSHTLSGTSEILYICIILAIIEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
            +NAILNAKN+QKMS +WQ+RFLTWGI+IAVFGMRI+FPI+IVCIV+TINPIEA+ +AI+
Sbjct: 61  CDNAILNAKNIQKMSPLWQRRFLTWGIVIAVFGMRIVFPIIIVCIVATINPIEAVKIAIF 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
           SPQDYLKIIS AH+PI+GFGGTFLMMVSLTFFFN    +HWI+FLEI MS+LS+I+GIK 
Sbjct: 121 SPQDYLKIISDAHIPIAGFGGTFLMMVSLTFFFNRNKNIHWINFLEIPMSYLSRIRGIKF 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSS-NNVTHGKHGLN 239
           F+VL +I GIS IL   ++Y  + SST A++ FY INFLES+LS D+   +V   KHGL+
Sbjct: 181 FLVLLLIIGISCILSIRDIYILIFSSTFALMTFYAINFLESILSGDNQTKSVAQKKHGLS 240

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
           LFLYLEIIDASLS DGVISSFAITKNFFII+IGLTIGA+YVRSMT+LMLK+G+L KYKYL
Sbjct: 241 LFLYLEIIDASLSFDGVISSFAITKNFFIIIIGLTIGAVYVRSMTVLMLKKGMLQKYKYL 300

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           EHGS+YSIFVLS++MFLQT++++PEIFTGTSS +LI LSIYSSIKN
Sbjct: 301 EHGSFYSIFVLSIVMFLQTVINVPEIFTGTSSVLLIILSIYSSIKN 346


>gi|111019440|ref|YP_702412.1| integral membrane protein [Rhodococcus jostii RHA1]
 gi|110818970|gb|ABG94254.1| possible integral membrane protein [Rhodococcus jostii RHA1]
          Length = 389

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 117/369 (31%), Positives = 200/369 (54%), Gaps = 39/369 (10%)

Query: 7   YASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAIL 66
              ++  F  +  VTV   +            + G    V + +IL+++EISLSF+NA++
Sbjct: 8   RFVVLRIFGLSFAVTVISLIIAA---------IYGGPQAVLLVVILSILEISLSFDNAVI 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD-- 124
           NA  L++MS  WQK FLT GI+IAVFGMR++FP++IV + S + P+ A++LA+  P D  
Sbjct: 59  NATVLRRMSEFWQKIFLTVGIVIAVFGMRLVFPLVIVWLASGLGPVAALDLALNPPADGA 118

Query: 125 ---------YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                    Y  +++ AH  I+ FGG FL+M+ L F    + ++ W+ +LE  ++   K+
Sbjct: 119 AYFPDGSASYETLLTDAHPQIAAFGGMFLLMLFLGFIL-EEREITWLSWLEKPLARAGKL 177

Query: 176 KGIKIFIVLSIIFGISNILPTNEMY-SFVSSSTAAIIIFYGINFLESVLSSDSSNN---- 230
             + + I  +++   +  +   +   + + +    ++ +  +N L  + ++   +     
Sbjct: 178 DQLAVIIAGALLLITAAYIAPEDTVSTVMIAGVLGMVTYIAVNGLGELFNTPEGDEDGEL 237

Query: 231 ------------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGA 277
                          GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL  +GA
Sbjct: 238 VEGSKGGPTELAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITSDPIIIALGLGFVGA 297

Query: 278 IYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFL 337
           ++VRS+T+ ++++G L+ Y YLEHG++++I  L+VI+ +     + E  TG     LI  
Sbjct: 298 MFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALAVILLVSIGYHVNENVTGLVGVALIGA 357

Query: 338 SIYSSIKNK 346
           +  SSI   
Sbjct: 358 AFISSIVRN 366


>gi|54027543|ref|YP_121785.1| hypothetical protein nfa55690 [Nocardia farcinica IFM 10152]
 gi|54019051|dbj|BAD60421.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 373

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 125/361 (34%), Positives = 204/361 (56%), Gaps = 34/361 (9%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F  + LVTVA  +            L G  + +++C IL ++E+SLSF+NA++NA 
Sbjct: 2   VLRIFGLSGLVTVASLVVAF---------LYGGPTALFLCAILGILEVSLSFDNAVINAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------- 122
            L++MS  WQK FLT GILIAVFGMR++FP+ IV + + +NP++A++LA+  P       
Sbjct: 53  VLRRMSEFWQKIFLTIGILIAVFGMRLVFPLAIVWVTAGLNPVDALDLALNPPAGDAPYF 112

Query: 123 ----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                 Y  +++ AH  I+ FGG FL M+ L F F    ++ W+ +LE  ++   K+  +
Sbjct: 113 PDGSPSYETLLTDAHPQIAAFGGMFLAMLFLNFIF-EDREITWLSWLERPLARAGKLDML 171

Query: 179 KIFIVLSIIFGISNIL-PTNEMYSFVSSSTAAIIIFYGINFLESVL-----------SSD 226
            + +    +   +  L P ++  + + +    +II+  ++ L S+            S  
Sbjct: 172 AVVVSGVGLVLTAEFLAPDDKRATVLMAGLLGMIIYIAVDGLGSMFHTEELEEEAEKSGP 231

Query: 227 SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTL 285
           S      GK G  LFLYLE++DAS S DGVI +FAIT +  +I +GL  IGA++VRS+T+
Sbjct: 232 SDLAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITSDPILIALGLGLIGAMFVRSITV 291

Query: 286 LMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            ++++G L++Y YLEHG++++I  L+ I+ +   V I EI TG      I  +  SS+  
Sbjct: 292 YLVRKGTLSEYVYLEHGAHWAIGALAAILLVSIGVHINEIITGLVGVAFIGAAFISSVLR 351

Query: 346 K 346
            
Sbjct: 352 N 352


>gi|299768440|ref|YP_003730466.1| hypothetical protein AOLE_00950 [Acinetobacter sp. DR1]
 gi|298698528|gb|ADI89093.1| hypothetical protein AOLE_00950 [Acinetobacter sp. DR1]
          Length = 360

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 134/354 (37%), Positives = 206/354 (58%), Gaps = 21/354 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAIL 66
           + HFR++I  TV      L   W FTH     +ST+     I  ILAV+E+SLSF+NA++
Sbjct: 1   MKHFRFSIFFTVVCL--ALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVV 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   LA+  P+ Y 
Sbjct: 59  NASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKLALNDPKTYS 118

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  +S L+ +  + +FI L  
Sbjct: 119 ERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLSSLASVPAMSVFIALIA 178

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVT 232
           +  ++  +  ++  +   +    I+++ G+  L  +L  +              S     
Sbjct: 179 LIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASG 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G 
Sbjct: 239 VVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 299 LDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|226361590|ref|YP_002779368.1| hypothetical protein ROP_21760 [Rhodococcus opacus B4]
 gi|226240075|dbj|BAH50423.1| hypothetical membrane protein [Rhodococcus opacus B4]
          Length = 389

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 117/369 (31%), Positives = 199/369 (53%), Gaps = 39/369 (10%)

Query: 7   YASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAIL 66
              ++  F  +  VTV   +            L G    V + +IL+++EISLSF+NA++
Sbjct: 8   RFVVLRIFGLSFAVTVISIIIAA---------LYGGPQAVLLVVILSILEISLSFDNAVI 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD-- 124
           NA  L++MS  WQK FLT GI+IAVFGMR++FP++IV + S + P+ A++LA+  P D  
Sbjct: 59  NATVLRRMSEFWQKIFLTVGIVIAVFGMRLVFPLVIVWLASGLGPVAALDLALNPPADGA 118

Query: 125 ---------YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                    Y  +++ AH  I+ FGG FL+M+ L F    + ++ W+ +LE  ++   K+
Sbjct: 119 AYFPDGSASYETLLTDAHPQIAAFGGMFLLMLFLGFIL-EEREITWLSWLEKPLARAGKL 177

Query: 176 KGIKIFIVLSIIFGISNILPTNEMY-SFVSSSTAAIIIFYGINFLESVLSSDSSNN---- 230
             + + +   ++   +  +   +   + + +    ++ +  +N L  + ++   +     
Sbjct: 178 DQLAVVVAGVLLLITAAYIAPEDTVSTVMIAGVLGMVTYIAVNGLGELFNTPEEDEDGEP 237

Query: 231 ------------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGA 277
                          GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL  +GA
Sbjct: 238 VAGSTGGPTELAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITSDPIIIALGLGFVGA 297

Query: 278 IYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFL 337
           ++VRS+T+ ++++G L+ Y YLEHG++++I  L+VI+ +     + E  TG     LI  
Sbjct: 298 MFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALAVILLVSIGYHVNENVTGLVGVALIGA 357

Query: 338 SIYSSIKNK 346
           +  SSI   
Sbjct: 358 AFISSIVRN 366


>gi|169794396|ref|YP_001712189.1| hypothetical protein ABAYE0201 [Acinetobacter baumannii AYE]
 gi|215481951|ref|YP_002324133.1| hypothetical protein ABBFA_000192 [Acinetobacter baumannii
           AB307-0294]
 gi|294838231|ref|ZP_06782914.1| hypothetical protein A60131_09868 [Acinetobacter sp. 6013113]
 gi|294860311|ref|ZP_06798080.1| hypothetical protein A6013_17096 [Acinetobacter sp. 6013150]
 gi|301345191|ref|ZP_07225932.1| hypothetical protein AbauAB0_03084 [Acinetobacter baumannii AB056]
 gi|301510682|ref|ZP_07235919.1| hypothetical protein AbauAB05_03864 [Acinetobacter baumannii AB058]
 gi|301595810|ref|ZP_07240818.1| hypothetical protein AbauAB059_08357 [Acinetobacter baumannii
           AB059]
 gi|169147323|emb|CAM85184.1| putative integral membrane protein [Acinetobacter baumannii AYE]
 gi|213987743|gb|ACJ58042.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
 gi|322509715|gb|ADX05169.1| Putative integral membrane protein [Acinetobacter baumannii 1656-2]
          Length = 360

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 130/354 (36%), Positives = 206/354 (58%), Gaps = 21/354 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAIL 66
           + HFR++I  TV      L   W FTH     +ST+     I  ILAV+E+SLSF+NA++
Sbjct: 1   MKHFRFSIFFTVVCL--ALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVV 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  +E   +A+  P+ Y 
Sbjct: 59  NASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVVEVAKMALNDPKTYS 118

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  
Sbjct: 119 ERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIA 178

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVT 232
           +  ++  +  ++  +   +    I+++ G+  L  +L  +              S     
Sbjct: 179 LIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASG 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G 
Sbjct: 239 VVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 299 LDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|325284560|ref|YP_004264023.1| hypothetical protein Deipr_2032 [Deinococcus proteolyticus MRP]
 gi|324316049|gb|ADY27163.1| protein of unknown function DUF475 [Deinococcus proteolyticus MRP]
          Length = 351

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 135/337 (40%), Positives = 205/337 (60%), Gaps = 4/337 (1%)

Query: 13  HFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQ 72
            F +A LVT+         G+     L      + I ++L V+EISLSF+NA++NA  L+
Sbjct: 7   FFGFASLVTLVCLAVAAWDGYTRGGGLDAMWQALAIAVLLGVLEISLSFDNAVVNATVLR 66

Query: 73  KMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQA 132
            MS  WQ+RFLTWGILIAVFGMR IFPI+IV + + +   E +  A  +P+ Y + + +A
Sbjct: 67  TMSQKWQQRFLTWGILIAVFGMRFIFPILIVALSAGLGFGEVVREAFANPELYAEHLERA 126

Query: 133 HVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISN 192
           HV IS FGG FLMMV L +F ++   +HW+   E  ++   K+  I+  IV  ++  + +
Sbjct: 127 HVTISAFGGAFLMMVFLKYFMDAAKDVHWLRRAERLLARAGKLDSIQGIIVGVLLLALVH 186

Query: 193 I-LPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASL 251
             +   E +S +S+    ++++  ++ + ++   D       G  G + FLYLEI+DAS 
Sbjct: 187 YTVAPAEQFSALSAGLVGLLVYLMMDTVSNLFEVDGLTE-KSGAAGASAFLYLEILDASF 245

Query: 252 SLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
           SLDGVI +FA+TK+  +I  GLTIGAI+VRS+T++M+K+G L  Y++LEHG++Y I  L+
Sbjct: 246 SLDGVIGAFALTKDVVLIAAGLTIGAIFVRSLTIMMVKKGTLEAYRFLEHGAHYGIGALA 305

Query: 312 VIMFLQTI--VDIPEIFTGTSSTILIFLSIYSSIKNK 346
            IM L     V IPE+ TG      I L+I+SS++  
Sbjct: 306 TIMLLSMNRDVHIPELVTGLIGAGFIGLAIWSSLQAN 342


>gi|121583381|ref|YP_973812.1| hypothetical protein Pnap_4653 [Polaromonas naphthalenivorans CJ2]
 gi|120596635|gb|ABM40070.1| protein of unknown function DUF475 [Polaromonas naphthalenivorans
           CJ2]
          Length = 359

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 124/347 (35%), Positives = 216/347 (62%), Gaps = 5/347 (1%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           +N+    ++ HF+ +  +T+     G   G+    T +G +  +++  ILAV+E+SLSF+
Sbjct: 5   TNACQYLIMKHFKISFFITLILLGLGAFWGYGLGGT-TGALQALFVVSILAVMEVSLSFD 63

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NA++NA  L+  +  WQK FLT GI+IAVFGMR++FPI+IV I + +  ++ M +A+ +P
Sbjct: 64  NAVVNASVLRTWNPFWQKLFLTVGIIIAVFGMRLVFPILIVSIATGLGLLDVMTMALNTP 123

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
           ++Y + ++  H  ++ FGG+FL++V L F F+ +  LHW+ ++E  +      +G+   +
Sbjct: 124 EEYSRHLTANHAQVAAFGGSFLLLVFLNFLFDQEKDLHWLGWIEEKLGKHGN-EGLSTLV 182

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV---THGKHGLN 239
            +  +FG   ++P  +  S + +  + I ++  ++FL  +L ++  + V      +  + 
Sbjct: 183 AMLAVFGCMTLVPEVQKLSVLMAGISGIAVYLAVSFLSGLLEAEEHDPVIGTAIKRGSIG 242

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
            FLYLE++DAS S DGVI +FAIT +  II++GL IGA++VRSMT+ ++ +G L ++ YL
Sbjct: 243 GFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAMFVRSMTVFLVHKGTLEEFVYL 302

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           EHG++Y+I +L++IM       I E FTG S    I LS++SS+  K
Sbjct: 303 EHGAHYAIGILALIMLASVKFHISEWFTGLSGVAFICLSLWSSVHYK 349


>gi|239503872|ref|ZP_04663182.1| hypothetical protein AbauAB_16296 [Acinetobacter baumannii AB900]
 gi|260557949|ref|ZP_05830162.1| major facilitator family transporter [Acinetobacter baumannii ATCC
           19606]
 gi|260408740|gb|EEX02045.1| major facilitator family transporter [Acinetobacter baumannii ATCC
           19606]
          Length = 360

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 131/354 (37%), Positives = 206/354 (58%), Gaps = 21/354 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAIL 66
           + HFR++I  TV      L   W FTH     +ST+     I  ILAV+E+SLSF+NA++
Sbjct: 1   MKHFRFSIFFTVVCL--ALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVV 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y 
Sbjct: 59  NASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKMALNDPKTYS 118

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  
Sbjct: 119 ERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIA 178

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVT 232
           +  ++  +  ++  +   +    I+++ G+  L  +L  +              S     
Sbjct: 179 LIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASG 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G 
Sbjct: 239 VVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 299 LDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|193078634|gb|ABO13678.2| putative integral membrane protein [Acinetobacter baumannii ATCC
           17978]
          Length = 360

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 130/354 (36%), Positives = 206/354 (58%), Gaps = 21/354 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAIL 66
           + HFR++I  TV      L   W FTH     +ST+     I  ILAV+E+SLSF+NA++
Sbjct: 1   MKHFRFSIFFTVVCL--ALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVV 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y 
Sbjct: 59  NASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKMALNDPKTYS 118

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  
Sbjct: 119 ERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIA 178

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVT 232
           +  ++  +  ++  +   +    I+++ G+  L  +L  +              +     
Sbjct: 179 LIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGTGAASG 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G 
Sbjct: 239 VVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 299 LDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|261403113|ref|YP_003247337.1| protein of unknown function DUF475 [Methanocaldococcus vulcanius
           M7]
 gi|261370106|gb|ACX72855.1| protein of unknown function DUF475 [Methanocaldococcus vulcanius
           M7]
          Length = 341

 Score =  341 bits (876), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 140/340 (41%), Positives = 215/340 (63%), Gaps = 10/340 (2%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
             LI++F+++I  T+   +            L G    +Y+ IIL ++E+SLSF+NA++N
Sbjct: 4   KELINNFKFSIFFTIICLILAF---------LWGNFIGLYVAIILGILEVSLSFDNAVVN 54

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L++M   WQK FLT GILIAVFGMR+ FP++IV I S INPI+ +N+A+ +P +Y  
Sbjct: 55  ATVLKRMDEYWQKMFLTVGILIAVFGMRLTFPLVIVSIASHINPIDVVNMALNNPSEYAM 114

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
            + +AH  IS FGG FL+MV L +F N +   HWI  +E  ++ L K++ I+I I L I+
Sbjct: 115 HLKEAHPLISAFGGAFLLMVFLKYFLNEEKDTHWIGLIEKPLAKLGKLESIEIVIALFIL 174

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG-KHGLNLFLYLEI 246
                I+P++E  + + S    II++  ++ +   +       V    K GL LFLYLE+
Sbjct: 175 LLALKIVPSSEQLTVLISGILGIIVYVLVDSIGEYMQEKEQEMVNSAIKGGLILFLYLEL 234

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  +I +GL IGA++VRS+T+ ++K+G L++Y YLEHG+ Y+
Sbjct: 235 LDASFSFDGVIGAFAITRDIILIALGLGIGAMFVRSLTVYLVKKGTLDEYIYLEHGAMYA 294

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I  L+++MF+     IPE  TG+   +LI L++ SSI   
Sbjct: 295 IGTLAMLMFIGIRYHIPEYITGSIGALLIGLALVSSIIYN 334


>gi|71065324|ref|YP_264051.1| hypothetical protein Psyc_0764 [Psychrobacter arcticus 273-4]
 gi|71038309|gb|AAZ18617.1| uncharacterized transmembrane protein [Psychrobacter arcticus
           273-4]
          Length = 355

 Score =  341 bits (876), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 125/349 (35%), Positives = 206/349 (59%), Gaps = 15/349 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF    + T    +     G+     + G I+T+ I  ILAV+EISLSF+NA++NA  
Sbjct: 1   MRHFYLDFIFTAIALMVAAWWGYS-HGGMGGLITTLSITAILAVMEISLSFDNAVVNASV 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+     W+K FLT GILIAVFGMR++FPI+IV + + +  +E +NLA+Y P++Y   + 
Sbjct: 60  LKGWDEFWKKIFLTVGILIAVFGMRLVFPIVIVAVTADLGMMEVINLALYQPEEYSARLM 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F F+   ++HW H+LE  ++ L K+  + +F+ L ++   
Sbjct: 120 AHHAEISAFGGIFLLLVFLNFIFDD-KEVHWFHWLESRLAKLGKVDAMSVFVALIVLMFA 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-------------SDSSNNVTHGKHG 237
            +     +  + + +    I+++ G+  +  +L              S ++      K G
Sbjct: 179 VSWANAEQGSAVLIAGVWGILVYLGVQVISGMLEGDLEEDLENEENGSGAAATSAIMKGG 238

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           +  FLYLE++DAS S DGVI +FAIT +  +I++GL IGA++VRSMT+ ++ +G L+++ 
Sbjct: 239 IIGFLYLEVLDASFSFDGVIGAFAITNDVIVIMLGLAIGAMFVRSMTIFLVDKGTLDEFI 298

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           YLEHG++Y+I  L++IM L     +PE+ TG      I  ++ +S+K +
Sbjct: 299 YLEHGAHYAIGALAIIMLLSVKFHVPELITGLIGIAFIGWALLASLKYR 347


>gi|294664798|ref|ZP_06730122.1| integral membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292605429|gb|EFF48756.1| integral membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 347

 Score =  341 bits (875), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 122/340 (35%), Positives = 214/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV           G     +  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSLLVAAICLGLAAWWG---HTSSMGIWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP     S + +    I+++  +  ++++  ++ S + + G   + G+  FLYLE+
Sbjct: 178 TKLFLPDGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|21244793|ref|NP_644375.1| hypothetical protein XAC4076 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21110492|gb|AAM38911.1| integral membrane protein [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 347

 Score =  341 bits (875), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 123/340 (36%), Positives = 215/340 (63%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV V         G     +  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSLLVAVICLGLAAWWG---HTSSMGIWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP     S + +    I+++  +  ++++  ++ S + + G   + G+  FLYLE+
Sbjct: 178 TKLFLPDGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|169634711|ref|YP_001708447.1| hypothetical protein ABSDF3394 [Acinetobacter baumannii SDF]
 gi|169153503|emb|CAP02662.1| putative integral membrane protein [Acinetobacter baumannii]
          Length = 360

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 133/354 (37%), Positives = 205/354 (57%), Gaps = 21/354 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAIL 66
           + HFR++I  TV      L   W FTH     +ST+     I  ILAV+E+SLSF+NA++
Sbjct: 1   MKHFRFSIFFTVVCL--ALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVV 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L+     W+  FLT GILIAVFGMR++FP++IV + + +  IE   LA+  P+ Y 
Sbjct: 59  NASVLRNWDPFWKMIFLTVGILIAVFGMRLVFPVVIVAVTADMGVIEVAKLALNDPKTYS 118

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +FI L  
Sbjct: 119 ERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFIALIA 178

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVT 232
           +  ++  +      + V +    I+++ G+  L  +L  +              S     
Sbjct: 179 LIVMAAYVDEVHRLAVVMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASG 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G 
Sbjct: 239 VVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 299 LDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|84622095|ref|YP_449467.1| integral membrane protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|84366035|dbj|BAE67193.1| integral membrane protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 347

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 123/340 (36%), Positives = 214/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV           G     T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFREFRMSLLVAAVCLGVAAWWG---HTTALGLWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P+ Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPERYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP     S + +    I+++  +  ++++  ++ S +   G   + G+  FLYLE+
Sbjct: 178 TKLFLPEGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVHHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|294625677|ref|ZP_06704299.1| integral membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292600046|gb|EFF44161.1| integral membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 347

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 122/340 (35%), Positives = 214/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV           G     +  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSLLVAAICLGLAAWWG---HTSSMGIWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLIGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP     S + +    I+++  +  ++++  ++ S + + G   + G+  FLYLE+
Sbjct: 178 TKLFLPDGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVYHVPEVLTGLIGVGFIAASVWSSIRYR 337


>gi|257454294|ref|ZP_05619560.1| integral membrane protein [Enhydrobacter aerosaccus SK60]
 gi|257448311|gb|EEV23288.1| integral membrane protein [Enhydrobacter aerosaccus SK60]
          Length = 357

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 120/350 (34%), Positives = 209/350 (59%), Gaps = 16/350 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF + I+ T          G+     +S  +S +++ +ILAV+EISLSF+NA++NA  
Sbjct: 1   MRHFYFDIVFTTIALAIAAWWGFS-HGGVSTMMSALFVTLILAVMEISLSFDNAVVNASV 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+     W+  FLT G+LIAVFGMR++FPI+IV + + +  ++ +N+A+ +P++Y   + 
Sbjct: 60  LKTWDKFWKMIFLTVGMLIAVFGMRLVFPIVIVAVTADMGMMDVINMALNNPKEYSAKLI 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           + H  I+ FGG FL++V L F F+ + ++ W  +LE  ++   K+  + +F+ L+++   
Sbjct: 120 EHHAEIAAFGGMFLLLVFLNFIFD-EKEVMWFEWLERKLARFGKVDAMSVFVALALLMMA 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH-------------GKHG 237
              +      + +++    I+I+   N L S+L     ++ +               K G
Sbjct: 179 LFWVDPARKAAVLTAGVFGILIYLATNVLSSLLEGADDDDESTPDVIEGKEVAGAIAKGG 238

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           +  FLYLE++DAS S DGVI +FAIT +  II++GL IGA++VRSMT+ ++++G L+++ 
Sbjct: 239 IAGFLYLEVLDASFSFDGVIGAFAITNDVIIIMLGLAIGAMFVRSMTIFLVEKGTLDEFV 298

Query: 298 YLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           YLEHG++Y+I  L+VIM L    +++PEI TG      I  ++ +SI  +
Sbjct: 299 YLEHGAHYAIGALAVIMLLATVHIEVPEIVTGLIGIAFIVWAVINSISYR 348


>gi|297160887|gb|ADI10599.1| hypothetical protein SBI_07479 [Streptomyces bingchenggensis BCW-1]
          Length = 386

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 124/374 (33%), Positives = 203/374 (54%), Gaps = 47/374 (12%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT AG      +              + I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTAAGLALAGVLW---------GWKGLAIVGILSILEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + P+EA++LAI +   Y  ++
Sbjct: 53  VLRKMNAFWQKIFLTVGILIAVFGMRLVFPVIIVAITAKMGPLEAVDLAINNKDKYEHLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F  +  + W+ +LE  ++ L K++ + I + L ++  
Sbjct: 113 TAAHPAIAAFGGMFLLMIFLDFIF-EERDIKWLGWLERPLAKLGKLETLSIVVALLVLLV 171

Query: 190 ISNILPTNEMY-------SFVSSSTAAIIIFYGINFLESVLSSD---------------- 226
            +    T+  +       + + +  A ++ +  +  +                       
Sbjct: 172 TAMTFATDVAHGGGDKTATVLLAGVAGLLTYLIVGGISGYFEDKLEEEEEEVEEAEEAER 231

Query: 227 --------------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG 272
                         ++     GK    LFLYLE+IDAS S DGVI +FAIT + F + +G
Sbjct: 232 AEKAASGAQKGSQGATVVGLAGKAAFFLFLYLEVIDASFSFDGVIGAFAITNDIFEMALG 291

Query: 273 LTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSST 332
           L IGA+Y+RS+T+ ++++G L+ Y YLEHG++Y+I  L+ I+ +    +I E+ TG    
Sbjct: 292 LGIGAMYIRSLTVYLVRKGTLDDYVYLEHGAHYAIGALAAILLITIKYEIHEVITGLIGI 351

Query: 333 ILIFLSIYSSIKNK 346
           +LI  S +SS+   
Sbjct: 352 VLIGASYWSSVVRN 365


>gi|42523881|ref|NP_969261.1| hypothetical protein Bd2441 [Bdellovibrio bacteriovorus HD100]
 gi|39576088|emb|CAE80254.1| conserved hypothetical membrane protein [Bdellovibrio bacteriovorus
           HD100]
          Length = 355

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 134/336 (39%), Positives = 218/336 (64%), Gaps = 1/336 (0%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + + T  G +    +G  +  T+   +  ++I  ILA++EISLSF+NAI+NA  
Sbjct: 13  MKYFTGSFVFTFFGLIASYFVGHYYGGTVGAGLQALFIATILAILEISLSFDNAIVNAVV 72

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++M+ +W+ RFLTWG+LIAVFGMR++FP++IV  ++ +NP EA+ +A   P DY K++ 
Sbjct: 73  LKEMTPVWRHRFLTWGMLIAVFGMRLVFPLLIVTFMADVNPWEALVIAATKPDDYAKMML 132

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLS-KIKGIKIFIVLSIIFG 189
            AH+ ++ FGG+FL+MV+L +F++    LHWI F+E    ++  K++ I++ + L I+  
Sbjct: 133 DAHLQVAAFGGSFLLMVALKYFYDGSKDLHWIPFIEKPTRYIGSKVEAIEVCLSLIILIL 192

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
           I+N L   E   F+ +  A +I +  ++ + S L +         K    +FLYLE++DA
Sbjct: 193 ITNFLKQEEALPFLMAGMAGLITYVIVDGIGSWLEASDDQIKDVHKASAGMFLYLEVLDA 252

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGV+ +FAIT N FII+IGL+IGA +VRS+T++ +++  L K+ +LEHG++Y+I +
Sbjct: 253 SFSFDGVVGAFAITHNLFIIMIGLSIGAFFVRSLTIMFVEKEALTKFAFLEHGAFYAIGL 312

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L++IM     + IPE FTG S  I+I  S   S+K 
Sbjct: 313 LAMIMLADPFLHIPEWFTGLSGGIIILTSFIWSLKK 348


>gi|260550235|ref|ZP_05824448.1| major facilitator family transporter [Acinetobacter sp. RUH2624]
 gi|260406763|gb|EEX00243.1| major facilitator family transporter [Acinetobacter sp. RUH2624]
          Length = 360

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 132/354 (37%), Positives = 207/354 (58%), Gaps = 21/354 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAIL 66
           + HFR++I  TV          W FTH     +ST++    I  ILAV+E+SLSF+NA++
Sbjct: 1   MKHFRFSIFFTVVCLALAAY--WGFTHGPEAGVSTMFKALTITAILAVMEVSLSFDNAVV 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y 
Sbjct: 59  NASVLRGWDHFWKMIFLTVGILIAVFGMRLIFPVLIVSMTADMGFIEVAKMALNDPKTYS 118

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           + +   H  IS FGGTFL++V L FFF+ + + HW  +LE+ +S L+ +  + +FI L  
Sbjct: 119 ERLMAHHAEISAFGGTFLLLVFLNFFFDEEKETHWFRWLEVKLSDLANVPAMSVFIALIA 178

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVT 232
           +  ++  +  +E  +   +    I+++ G+  L  +L  +              S     
Sbjct: 179 LIVMAGYVEDHERLAVTMAGVWGIVVYIGVQVLSHLLGGEPEIDEDGNAVMQDGSGAASG 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGA++VRSMT+ ++++G 
Sbjct: 239 VIKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAMFVRSMTVYLVEKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y +LEHG++Y+I  L+ IM    T + IPE+ TG      I  ++ +SI+ 
Sbjct: 299 LDAYVFLEHGAHYAIGALAFIMIASGTGLHIPEVVTGLIGVAFIAWAVIASIQY 352


>gi|117164786|emb|CAJ88335.1| putative integral membrane protein [Streptomyces ambofaciens ATCC
           23877]
          Length = 366

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 124/368 (33%), Positives = 204/368 (55%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  FRWA  VT  G   G+         L    +   +  ILAV+E+SLSF+NA++NA 
Sbjct: 2   LVKTFRWAFAVTALGLAAGV---------LYEGWTAFGLVAILAVLEVSLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KMS+ WQK FLT GI+IAVFGMR++FP++IV + + ++P  A++LA+   + Y +++
Sbjct: 53  ILKKMSAFWQKIFLTVGIVIAVFGMRLVFPVVIVAVSARLSPWSAVHLALTDKERYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F      ++ W+  LE A++ L K+  + + + L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFVL-EDREIKWLGPLERALAKLGKVDMLSVCVALIVLLV 171

Query: 190 ISNI----------LPTNEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +            +  ++  + + +    +I +  +  L                    
Sbjct: 172 SAITFGAHAHQHGGIHADKAETVLLAGIGGLITYMVVGGLSGFFEDRLEREEERERDAET 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                  + S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 AAARSGGNRSAVALTGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIEYEINEVVTGLIGVVLIGAS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|320334757|ref|YP_004171468.1| hypothetical protein Deima_2163 [Deinococcus maricopensis DSM
           21211]
 gi|319756046|gb|ADV67803.1| protein of unknown function DUF475 [Deinococcus maricopensis DSM
           21211]
          Length = 354

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 139/342 (40%), Positives = 212/342 (61%), Gaps = 5/342 (1%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            SL   F +A +VTV   +     G   T  +S  +S   I  IL V+E+SLSF+NA++N
Sbjct: 2   PSLTKEFGFAGIVTVICLVVAALYG-LRTGGVSQALSYFLIAAILGVMELSLSFDNAVVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+ MS +WQ+RFLTWGILIAVFGMR +FPI+IV +V+ +   E +NLA  +P  Y  
Sbjct: 61  ATVLRNMSEVWQRRFLTWGILIAVFGMRFLFPIVIVAVVAGLGFGEVINLAFTNPPAYAH 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV-LSI 186
            + +AH+PIS FGG FLM+V L +  +     HW+  +E  +S L ++  I++FI  + +
Sbjct: 121 HLEEAHIPISAFGGAFLMLVFLKYLIDPDKDTHWLAPIERRLSKLGRLDTIQVFITGVLL 180

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
           +  +   +P+ E +S + +    I+ +  ++ L  +  +D+          ++ FLYLE+
Sbjct: 181 LLLVHFAVPSAEKFSALLAGVIGILTYVLVDALGGLFDADNLAADAAKAGAIS-FLYLEV 239

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS SLDGVI +FAIT++  +I  GLTIGA++VRS+TL+++ +G L  Y+YLEHG++Y 
Sbjct: 240 LDASFSLDGVIGAFAITQDIVVIAAGLTIGAVFVRSITLMLVHRGTLQAYRYLEHGAHYG 299

Query: 307 IFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I  L++IM L     V IPE+ TG      I LSI+SS++  
Sbjct: 300 IGALAIIMLLSMNPNVHIPEVVTGLIGVGFIVLSIWSSLRYN 341


>gi|122879022|ref|YP_199112.6| hypothetical protein XOO0473 [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 347

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 123/340 (36%), Positives = 213/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV           G     T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFREFRMSLLVAAVCLGVAAWWG---HTTALGLWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +     M +A+  P+ Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLAPVMQMALKEPERYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP     S + +    I+++  +  ++++  ++ S +   G   + G+  FLYLE+
Sbjct: 178 TKLFLPEGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVHHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|78066974|ref|YP_369743.1| hypothetical protein Bcep18194_A5505 [Burkholderia sp. 383]
 gi|77967719|gb|ABB09099.1| protein of unknown function DUF475 [Burkholderia sp. 383]
          Length = 359

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 124/341 (36%), Positives = 208/341 (60%), Gaps = 10/341 (2%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            NS    ++  F+  + +TV   +    +         G +  + I  +L+V+EISLS +
Sbjct: 15  QNSNTPIMLKDFKIPLSLTVLALVAAYFL---------GGVKDMLIVAVLSVLEISLSLD 65

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NA++NA  L+  S  W+ RF+ +G+ +AVFGMR++FP++IV ++  I   +A+ LAI SP
Sbjct: 66  NAVVNASVLKNWSEKWRNRFMVFGLPVAVFGMRLVFPLLIVAVIGHIGMWDALKLAIESP 125

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
           + Y  I++ AH  +S FGG FL+MV   F  +++   HWI FLE  MSHL +I  +++ +
Sbjct: 126 EQYASILTSAHHQVSAFGGAFLLMVFFKFMLDTEKDEHWIGFLEGPMSHLGRITALEVAL 185

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFL 242
            L+II   S  +P  E  +F+ +    +I F   + +  ++  + +      + G+  F+
Sbjct: 186 TLAIIIIASLYVPAAEQVAFLLAGAFGVISFVIAHGIGDLIGGEETGTRVV-REGVAGFM 244

Query: 243 YLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           YLE++D+S S DGVI +FA++ N F+I +GL +GA Y+R MTL++LK+G L +Y+YLEHG
Sbjct: 245 YLEVLDSSFSFDGVIGAFALSNNIFLIALGLGVGAAYIREMTLVLLKKGTLAQYRYLEHG 304

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           ++++I  L+ IMFL    ++PE+ TG     +I  +++SSI
Sbjct: 305 AFWAIGALATIMFLGVKFEVPEVITGLVGAAMIAAAVWSSI 345


>gi|294841470|ref|ZP_06786153.1| hypothetical protein A6014_06386 [Acinetobacter sp. 6014059]
          Length = 360

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 132/354 (37%), Positives = 205/354 (57%), Gaps = 21/354 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAIL 66
           + HFR++I  TV      L   W FTH     +ST+     I  ILAV+E+SLSF+NA++
Sbjct: 1   MKHFRFSIFFTVVCL--ALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVV 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y 
Sbjct: 59  NASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKMALNDPKTYS 118

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  
Sbjct: 119 ERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIA 178

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVT 232
           +  ++  +      + V +    I+++ G+  L  +L  +              S     
Sbjct: 179 LIVMAAYVDEVHRLAVVMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASG 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G 
Sbjct: 239 VVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 299 LDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|239931533|ref|ZP_04688486.1| hypothetical protein SghaA1_25160 [Streptomyces ghanaensis ATCC
           14672]
 gi|291439909|ref|ZP_06579299.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291342804|gb|EFE69760.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 379

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 124/368 (33%), Positives = 202/368 (54%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +            L G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAF---------LFGGWTAFGIVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV + + + PIEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAVSAQLGPIEAVDLALSDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F    ++ W+ +LE  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIF-EDREIKWLAWLERPLAKLGKVDMLSVCIALIVLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 172 SATAFATQAHQHGGTHVDKAETVLLSGIAGLITYLVVGGLSGFFEGKLEEEEEREHEEEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 KAAREGKPRSAVALAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+ ++ +    ++ E+ TG     LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAALLLITIRYEVNELITGFIGVFLIGAS 351

Query: 339 IYSSIKNK 346
            +SS++  
Sbjct: 352 FWSSVRRN 359


>gi|262280447|ref|ZP_06058231.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258225|gb|EEY76959.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 360

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 133/354 (37%), Positives = 205/354 (57%), Gaps = 21/354 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAIL 66
           + HFR++I  TV      L   W FTH     +ST+     I  ILAV+E+SLSF+NA++
Sbjct: 1   MKHFRFSIFFTVVCL--ALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVV 58

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L+     W+  FLT GILIAVFGMR+IFP+ IV + + +  IE   LA+  P+ Y 
Sbjct: 59  NASVLRNWDPFWKMLFLTVGILIAVFGMRLIFPVAIVAVTADMGMIEVAKLALNDPKTYS 118

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           + +   H  IS FGGTFL++V L FFF+ + + HW  +LE  +S L+ +  + +FI L  
Sbjct: 119 ERLMAHHAEISAFGGTFLLLVFLNFFFDEEKETHWFRWLEAKLSSLASVPAMSVFIALIA 178

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVT 232
           +  ++  +  ++      +    I+++ G+  L  +L  +              S     
Sbjct: 179 MLIMAANVDESQRLVVTMAGIWGIVVYIGVEVLSHMLGGEPEIDEDGNAIMKDGSGAASG 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K G+  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G 
Sbjct: 239 VVKAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++++SI+ 
Sbjct: 299 LDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVFASIQY 352


>gi|15807218|ref|NP_295948.1| hypothetical protein DR_2226 [Deinococcus radiodurans R1]
 gi|6460030|gb|AAF11774.1|AE002055_6 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 349

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 136/335 (40%), Positives = 210/335 (62%), Gaps = 5/335 (1%)

Query: 13  HFRWAILVTVAGFLCGLGIGWQ-FTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
            F +A LVTV         G+    HTL+   + + I ++L V+EISLSF+NA++NA  L
Sbjct: 7   FFGFATLVTVICLAIAAWDGYARGGHTLAALANALVIAVLLGVLEISLSFDNAVVNASVL 66

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQ 131
           + MS  WQKRFL WGILIAVFGMR IFPI+IV + S +   E +  A  +P  Y + + +
Sbjct: 67  RTMSEKWQKRFLLWGILIAVFGMRFIFPIVIVALTSGLGMGEVIREAFGNPDIYAEHLEK 126

Query: 132 AHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGIS 191
           AHV IS FGG FLMMV L +F +   + HW+  LE  +  + K+  ++  IV +++  ++
Sbjct: 127 AHVAISAFGGAFLMMVFLKYFMDPDKEEHWLTPLERPLGRIGKLDTVQAVIVGALLLILT 186

Query: 192 N-ILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           +  +   E +  +++    ++++  ++ + ++  +D+      G  GL  FLYLEI+DAS
Sbjct: 187 HLFVAPAEQFQALTAGLVGLLVYLVMDAIGNLFETDNLAT-KAGAAGLASFLYLEILDAS 245

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            SLDGVI +FA+TK+  +I  GLTIGAI+VRS+T++M+K+G L  Y++LEHG++Y I  L
Sbjct: 246 FSLDGVIGAFALTKDIVLIAAGLTIGAIFVRSLTVMMVKKGTLEAYRFLEHGAHYGIGAL 305

Query: 311 SVIMFLQTI--VDIPEIFTGTSSTILIFLSIYSSI 343
           +VIM L     + IPE+ TG      I L++++S+
Sbjct: 306 AVIMLLSMNRDIHIPEVVTGLIGAGFIVLAVWASL 340


>gi|86742357|ref|YP_482757.1| hypothetical protein Francci3_3676 [Frankia sp. CcI3]
 gi|86569219|gb|ABD13028.1| protein of unknown function DUF475 [Frankia sp. CcI3]
          Length = 390

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 125/365 (34%), Positives = 194/365 (53%), Gaps = 38/365 (10%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F W++ +TV G              + G      +  ILAV+EISLSF+NA++NA  
Sbjct: 4   LRIFGWSLAITVIGVAAA---------GVIGGPRNAALVAILAVLEISLSFDNAVINATI 54

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L +MS  WQ+ FLT GILIAVFGMR+IFPI IV + + + P+E  +LA+     Y + + 
Sbjct: 55  LGRMSQFWQRIFLTLGILIAVFGMRLIFPIAIVALTAHLGPLEVFDLALNDGARYAEKLG 114

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FL M+ L F F+ + ++ WI  LE  +    ++  + I + L  +  +
Sbjct: 115 DAHPAIAAFGGIFLFMLFLDFLFDPEREIQWIKKLEEPLRRAGQLDVVPIVLGLIALLVV 174

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-------------------- 230
                 +     + S  A +  + G+  L     +                         
Sbjct: 175 GQAFAGDHQQQVLLSGVAGLATYLGVRGLGEFFEARGVGAEDDDDDSVAESAGLAPVRSN 234

Query: 231 ---------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
                    +  GK    LFLYLE+IDAS S DGV+ +FAI++N F+I  GL IGA+Y+R
Sbjct: 235 GTGGPPKLVLATGKAAAFLFLYLEVIDASFSFDGVVGAFAISQNIFVIAAGLGIGAMYIR 294

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYS 341
           S+T+ ++++G L +Y YLEHG++Y+I  L++I+ +    ++PEI TG      I LS+ S
Sbjct: 295 SLTVYLVRRGTLGEYIYLEHGAHYAIGALAIILAISIETEVPEIVTGLIGVAFIGLSLLS 354

Query: 342 SIKNK 346
           SI+++
Sbjct: 355 SIRHR 359


>gi|296141865|ref|YP_003649108.1| hypothetical protein Tpau_4201 [Tsukamurella paurometabola DSM
           20162]
 gi|296029999|gb|ADG80769.1| protein of unknown function DUF475 [Tsukamurella paurometabola DSM
           20162]
          Length = 364

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 121/360 (33%), Positives = 198/360 (55%), Gaps = 34/360 (9%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F  +I+VT+A  +            L G    + +  IL V+EISLSF+NA++NA  
Sbjct: 3   LRTFGLSIVVTIAALIVAF---------LYGGPQALLLTAILGVLEISLSFDNAVINATV 53

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP----QDYL 126
           L++MS  WQK FLT GILIAV GMR++FP+ IV I + ++P+ AM LA+  P      Y 
Sbjct: 54  LRRMSDFWQKMFLTVGILIAVVGMRLLFPLAIVWITAGLDPVHAMRLALNPPTDGSPTYE 113

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
            +++ AH  I+ FGG FL+M+ L F   ++  + W+ ++E  +  + ++  + + I    
Sbjct: 114 SLVTAAHPQIAAFGGIFLLMLFLDFVL-AEKDVTWLSWIEKPLEKIGRLDQLSVVIASGA 172

Query: 187 IFGISNILP-TNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV-------------- 231
           +   +  +    E  + + +    ++ +  +N L  +   D    +              
Sbjct: 173 LLYTAMYIAHPGEETTVLVAGLLGMMTYLVVNGLGELFHIDEEAEIADLDAESKPNSGPS 232

Query: 232 ----THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLL 286
                 GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL  IGA++VRS+T+ 
Sbjct: 233 ELAKAAGKAGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGLGLIGAMFVRSITVY 292

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +++QG L++Y YLEHG++++I  L+VI+       +PE+ TG    +LI  ++ SS+   
Sbjct: 293 LVRQGTLSQYVYLEHGAHWAIGALAVILLYSIGTPVPEVVTGLIGLVLIIAALISSVVRN 352


>gi|15837794|ref|NP_298482.1| hypothetical protein XF1192 [Xylella fastidiosa 9a5c]
 gi|9106162|gb|AAF84002.1|AE003953_6 integral membrane protein [Xylella fastidiosa 9a5c]
          Length = 341

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 122/340 (35%), Positives = 213/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T          G+    T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFTAFCLSLAAWWGYS---TALGVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GI IAVFGMR++FPI+IV + + +  I  M LA+  P+ Y +++
Sbjct: 58  ILKHMSEFWRKLFLTIGIFIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   I + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAIAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM + T+  +PE+ TG     LI  S++SS + +
Sbjct: 298 IGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYR 337


>gi|71276516|ref|ZP_00652791.1| Protein of unknown function DUF475 [Xylella fastidiosa Dixon]
 gi|170729737|ref|YP_001775170.1| hypothetical protein Xfasm12_0534 [Xylella fastidiosa M12]
 gi|71162693|gb|EAO12420.1| Protein of unknown function DUF475 [Xylella fastidiosa Dixon]
 gi|167964530|gb|ACA11540.1| integral membrane protein [Xylella fastidiosa M12]
          Length = 345

 Score =  336 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 122/340 (35%), Positives = 213/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T          G+    T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFTAFCLSLAAWWGYS---TALGVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GILIAVFGMR++FPI+IV + + +  I  M LA+  P+ Y  ++
Sbjct: 58  ILKHMSEFWRKLFLTIGILIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSLVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   + + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAMAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM + T+  +PE+ TG     LI  S++SS + +
Sbjct: 298 IGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYR 337


>gi|311895883|dbj|BAJ28291.1| hypothetical protein KSE_24770 [Kitasatospora setae KM-6054]
          Length = 360

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 113/356 (31%), Positives = 194/356 (54%), Gaps = 30/356 (8%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F W+  +T+AG +    I                + +IL+++EISLSF+NA++NA  
Sbjct: 3   LRTFGWSFAITIAGLIAAGLIW---------GAEGFGVVLILSILEISLSFDNAVVNATV 53

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQDY 125
           L++M++ WQK FLT G+LIAVFGMR++FP+++V + + ++P   + LA+     +    Y
Sbjct: 54  LKRMNAFWQKLFLTVGVLIAVFGMRLVFPLLVVGLTAHLSPGTVIELALDSSKTHDGHTY 113

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
            + +  A+  I+ FGG FL+M+ L F F  +   +W+ +LE  +  + K+  +   + L 
Sbjct: 114 AEYLDLANPAIAAFGGIFLLMIFLDFIF-EEKDFNWLRWLEKPLEKIGKLDALSSVVALV 172

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD---------------SSNN 230
           ++   S     +   + + +    +  +  +N L  V  S                 S  
Sbjct: 173 VLALSSRFFAGDRAETVLLAGICGLATYLAVNGLSEVFESGLEQQQEAEDAAERSGKSIV 232

Query: 231 VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQ 290
              GK    LF+YLE++DAS S DGV+ +FAI+++ F I +GL IGA+Y+RS+T+ ++++
Sbjct: 233 QVGGKAAFFLFIYLEVLDASFSFDGVVGAFAISQDIFQITLGLGIGAMYIRSLTVFLVRK 292

Query: 291 GILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           G L+ Y YLEHG++Y+I  L++I+       IPEI TG      I  ++ +SI   
Sbjct: 293 GTLDDYVYLEHGAHYAIGALALILLASIKYHIPEIVTGLIGVAFIGAALATSIVRN 348


>gi|28198391|ref|NP_778705.1| integral membrane protein [Xylella fastidiosa Temecula1]
 gi|182681033|ref|YP_001829193.1| hypothetical protein XfasM23_0472 [Xylella fastidiosa M23]
 gi|28056461|gb|AAO28354.1| integral membrane protein [Xylella fastidiosa Temecula1]
 gi|182631143|gb|ACB91919.1| protein of unknown function DUF475 [Xylella fastidiosa M23]
 gi|307579501|gb|ADN63470.1| hypothetical protein XFLM_07800 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 345

 Score =  335 bits (860), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 121/340 (35%), Positives = 212/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T          G+    T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFTAFCLSLAAWWGYS---TALGVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GI IAVFGMR++FPI+IV + + +  I  M LA+  P+ Y  ++
Sbjct: 58  ILKHMSEFWRKLFLTIGIFIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSLVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   + + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAMAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM + T+  +PE+ TG     LI  S++SS + +
Sbjct: 298 IGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYR 337


>gi|166710315|ref|ZP_02241522.1| integral membrane protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 341

 Score =  335 bits (859), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 119/328 (36%), Positives = 209/328 (63%), Gaps = 3/328 (0%)

Query: 22  VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR 81
           +   +C     W    T  G    +++C++L+V+E+SLSF+NA++NA  L+ M++ WQK 
Sbjct: 4   LVAAVCLGVAAWWGHTTAMGLWQALWLCLVLSVLEVSLSFDNAVVNAGVLKHMNAFWQKL 63

Query: 82  FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGG 141
           FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P+ Y ++++  +  I+ FGG
Sbjct: 64  FLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPERYSQVLTDNYPSIAAFGG 123

Query: 142 TFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYS 201
            FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++      LP     S
Sbjct: 124 MFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLCTKLFLPEGIFQS 183

Query: 202 FVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEIIDASLSLDGVIS 258
            + +    I+++  +  ++++  ++ S +   G   + G+  FLYLE++DAS S DGVI 
Sbjct: 184 VLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEVLDASFSFDGVIG 243

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
           +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I VL++IM + T
Sbjct: 244 AFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAIGVLAIIMLVGT 303

Query: 319 IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +  +PE+ TG      I  S++SSI+ +
Sbjct: 304 VYHVPEVLTGLIGVAFIAASVWSSIRYR 331


>gi|188578924|ref|YP_001915853.1| hypothetical protein PXO_02894 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188523376|gb|ACD61321.1| integral membrane protein [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 341

 Score =  335 bits (859), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 119/328 (36%), Positives = 209/328 (63%), Gaps = 3/328 (0%)

Query: 22  VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR 81
           +   +C     W    T  G    +++C++L+V+E+SLSF+NA++NA  L+ M++ WQK 
Sbjct: 4   LVAAVCLGVAAWWGHTTALGLWQALWLCLVLSVLEVSLSFDNAVVNAGVLKHMNAFWQKL 63

Query: 82  FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGG 141
           FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P+ Y ++++  +  I+ FGG
Sbjct: 64  FLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPERYSQVLTDNYPSIAAFGG 123

Query: 142 TFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYS 201
            FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++      LP     S
Sbjct: 124 MFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLCTKLFLPEGIFQS 183

Query: 202 FVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEIIDASLSLDGVIS 258
            + +    I+++  +  ++++  ++ S +   G   + G+  FLYLE++DAS S DGVI 
Sbjct: 184 VLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEVLDASFSFDGVIG 243

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
           +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I VL++IM + T
Sbjct: 244 AFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAIGVLAIIMLVGT 303

Query: 319 IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +  +PE+ TG      I  S++SSI+ +
Sbjct: 304 VYHVPEVLTGLIGVAFIAASVWSSIRYR 331


>gi|237653141|ref|YP_002889455.1| hypothetical protein Tmz1t_2476 [Thauera sp. MZ1T]
 gi|237624388|gb|ACR01078.1| protein of unknown function DUF475 [Thauera sp. MZ1T]
          Length = 339

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 127/338 (37%), Positives = 209/338 (61%), Gaps = 11/338 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F W+I  TV G + G  +G              +I  +LAV+E SLSF+NA++NA  
Sbjct: 4   LKYFTWSIGFTVFGLVGGYLLG---------GWPAAFIVAVLAVLETSLSFDNAVVNATV 54

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M   W++RFL WGILIAVFGMRI+FP+ IV +V+++ P+E ++LA+++P +Y ++++
Sbjct: 55  LRHMDEKWRQRFLLWGILIAVFGMRIVFPLAIVGVVASLGPVEVVDLALFNPDEYARLLT 114

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FLMMV L FF +     HW+  +E  ++ L +++  +I + L  I   
Sbjct: 115 SAHHEIAAFGGAFLMMVFLKFFIDENKDTHWLAPIESPLTKLGRLEAAQILLTLLAILAT 174

Query: 191 SNILP-TNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVT-HGKHGLNLFLYLEIID 248
           S  +   ++   F+ +    +I++   + L +++  +         K G   F+YLE++D
Sbjct: 175 SAWIDGADKRMEFIVAGVWGLIVYIAADGLGAIMGGEEGEGGKMVAKTGFAGFMYLELLD 234

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T +  II IGL +GA++VRS TL+++ +G L  Y+YLEHG++++I 
Sbjct: 235 ASFSFDGVIGAFALTTSLPIIAIGLGVGAMFVRSFTLMLVYRGTLEAYRYLEHGAFWAIG 294

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L+ IMF+   + IPE FTG    +LI  + +SS+++ 
Sbjct: 295 ALAAIMFVGVHMHIPETFTGLIGAVLIGAAFWSSLRHN 332


>gi|258653185|ref|YP_003202341.1| hypothetical protein Namu_3015 [Nakamurella multipartita DSM 44233]
 gi|258556410|gb|ACV79352.1| protein of unknown function DUF475 [Nakamurella multipartita DSM
           44233]
          Length = 379

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 119/373 (31%), Positives = 198/373 (53%), Gaps = 48/373 (12%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F W+ +VT    +            + G+ S V +C IL V+E+SLSF+NA++NA  
Sbjct: 3   VKIFMWSYIVTAVSLVVAF---------VYGSWSAVVLCAILGVLEVSLSFDNAVINATI 53

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP-------- 122
           L++MS  WQK FLT GI+IAVFGMR++ P++IV   + + P+EA  LA+  P        
Sbjct: 54  LERMSEFWQKMFLTVGIVIAVFGMRLLLPLLIVYFAAGLPPVEAFQLAMNPPADGAAYFP 113

Query: 123 ---QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                Y  +++ AH  I+ FGG FL+M+ L + F  + +  W+ +LE  ++   ++  + 
Sbjct: 114 DGSPSYETLLTDAHPIIAAFGGMFLLMLFLNWLF-EEKEHTWLTWLERPLAKAGRLDSMA 172

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS------------ 227
           I +   ++  +S  L  +   + + +    ++++  +N L +   +              
Sbjct: 173 ILVACLLLLVVSETLAED-AETVLFAGLLGLVVYLAVNGLGTFFENAEHIGEDDGEARET 231

Query: 228 -------------SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT 274
                              GK G  LFLYLE++DAS S DGVI +FAIT +  +I +GL 
Sbjct: 232 NVDHEPSVAGRNTKLVKAAGKAGFFLFLYLEVLDASFSFDGVIGAFAITSDPILIALGLG 291

Query: 275 -IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTI 333
            IGA++VRS+T+ ++++G L++Y YLEHG++++I  L+VI+ +   V I E  TG     
Sbjct: 292 LIGAMFVRSLTVYLVRKGTLSEYVYLEHGAHWAIGALAVILMISIGVHISEFITGLLGVA 351

Query: 334 LIFLSIYSSIKNK 346
            I  +  SSI+  
Sbjct: 352 FIGAAFISSIQRN 364


>gi|289664732|ref|ZP_06486313.1| hypothetical protein XcampvN_17108 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289670855|ref|ZP_06491930.1| hypothetical protein XcampmN_20803 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 341

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 121/334 (36%), Positives = 210/334 (62%), Gaps = 6/334 (1%)

Query: 16  WAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMS 75
            ++LV           G     T  G    +++C++L+V+E+SLSF+NA++NA  L+ M+
Sbjct: 1   MSLLVAAVCLSVAAWWG---HTTSMGLWQALWLCLVLSVLEVSLSFDNAVVNAGVLKHMN 57

Query: 76  SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVP 135
           + WQK FLT GILIAVFGMR++FPI+IV + + +     M +A+  P+ Y ++++  +  
Sbjct: 58  AFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLAPVMQMALKEPERYSQVLTDNYPS 117

Query: 136 ISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILP 195
           I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G    LP
Sbjct: 118 IAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLGTKLFLP 177

Query: 196 TNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEIIDASLS 252
                S + +    I+++  +  ++++  ++ S +   G   + G+  FLYLE++DAS S
Sbjct: 178 DGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEVLDASFS 237

Query: 253 LDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSV 312
            DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I VL++
Sbjct: 238 FDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAIGVLAI 297

Query: 313 IMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 331


>gi|307822897|ref|ZP_07653127.1| protein of unknown function DUF475 [Methylobacter tundripaludum
           SV96]
 gi|307735672|gb|EFO06519.1| protein of unknown function DUF475 [Methylobacter tundripaludum
           SV96]
          Length = 334

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 133/339 (39%), Positives = 205/339 (60%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HFR +  VT                   G I   +I IIL V+E+SLSF+NA++NA  
Sbjct: 1   MQHFRLSFFVTAVCLAAAFY---------WGGIMGAFIAIILGVLEVSLSFDNAVVNASI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++M   WQK FLTWGILIAVFGMR++FPI+IV   + I+ +    +A+     Y K + 
Sbjct: 52  LKRMDDRWQKYFLTWGILIAVFGMRLLFPIVIVSAATGIDFMGVTEMALKDTATYAKHLD 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            +HV I+ FGG FL+MV  +F F+   +LHW+ ++E  MS   K++ I+I + L  +  I
Sbjct: 112 ASHVQIAAFGGMFLLMVFYSFIFDETKELHWLGYIEEKMSSFGKLEAIEIIMALGPLLII 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH---GKHGLNLFLYLEII 247
            N LP       + +    +I+F  ++ L ++   +           K G+  F+YLE++
Sbjct: 172 QNYLPQEIRLDALVAGVTGVILFVIVDSLAALFEHEEEGEEVVAVLKKSGMMSFIYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT++  II++GL IGA++VRS+T+ ++++G L++Y +LEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAITQDVVIIMLGLAIGAMFVRSLTVYLVRKGTLDEYVFLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL+ IM +     IPE+ TG +  +LI LS+ SSI+ K
Sbjct: 292 GVLAGIMLVSMTHHIPEVITGLTGAVLIALSVISSIRYK 330


>gi|71901122|ref|ZP_00683229.1| Protein of unknown function DUF475 [Xylella fastidiosa Ann-1]
 gi|71729127|gb|EAO31251.1| Protein of unknown function DUF475 [Xylella fastidiosa Ann-1]
          Length = 345

 Score =  334 bits (856), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 122/340 (35%), Positives = 212/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T          G+    T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFTAFCLSLAAWWGYS---TALGVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GILIAVFGMR++FPI+IV + + +  I  M LA+  P+ Y  ++
Sbjct: 58  ILKHMSEFWRKLFLTIGILIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSLVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   + + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAMAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQGDGLMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II+ GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMFGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM + T+  +PE+ TG     LI  S++SS + +
Sbjct: 298 IGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYR 337


>gi|326563549|gb|EGE13808.1| hypothetical protein E9O_08327 [Moraxella catarrhalis 12P80B1]
          Length = 344

 Score =  334 bits (856), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 123/340 (36%), Positives = 195/340 (57%), Gaps = 20/340 (5%)

Query: 25  FLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLT 84
            +     G+     +S     + I  ILA++EISLSF+NA++NA  L+  +  W+K FLT
Sbjct: 1   MVIAAWWGYS-HGGISEMFLALGITAILAIMEISLSFDNAVVNASILKGWNDFWKKIFLT 59

Query: 85  WGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFL 144
            GILIAVFGMR+IFPI IV + + +   E ++LA+ +P  Y + ++  H  IS FGG FL
Sbjct: 60  VGILIAVFGMRLIFPIAIVAVTANLGMGEVIHLALNNPVQYAEHLNAHHAEISAFGGMFL 119

Query: 145 MMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVS 204
           ++V L F F     +HW  +LE  +   SK+  + +F+ L ++    + +   +    + 
Sbjct: 120 LLVFLNFMF-GDKDVHWFKWLESRLVKFSKVDAMSVFVALVVLMISMSWVEEAKQGVVMV 178

Query: 205 SSTAAIIIFYGINFLESVLSSDSSNNVTHG------------------KHGLNLFLYLEI 246
           +    I+++ G++ L ++L  D  +                       K G+  FLYLE+
Sbjct: 179 AGIWGILVYLGVSVLSALLEGDGDDKAAVYDAKGREITNTAGVSSTILKGGIAGFLYLEV 238

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT +  +I+IGL IGA++VRSMT+ ++ +G L+ + YLEHG++Y+
Sbjct: 239 LDASFSFDGVIGAFAITNDVIVIMIGLAIGAMFVRSMTIYLVNKGTLSDFIYLEHGAHYA 298

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I  L++IM L T   +PEI TG      I LS+++SI+  
Sbjct: 299 IGALAIIMLLSTRFHVPEIITGLIGVAFIVLSVFNSIQYN 338


>gi|326387901|ref|ZP_08209507.1| hypothetical protein Y88_0816 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207947|gb|EGD58758.1| hypothetical protein Y88_0816 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 345

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 141/340 (41%), Positives = 222/340 (65%), Gaps = 3/340 (0%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F  ++L T+A     L  GW  T ++  T   +++ I+LAV+EISLSF+NA++NA 
Sbjct: 1   MLRQFTGSLLFTIAALFATLAYGWFLTGSVGATAGLIWVVIVLAVLEISLSFDNAVVNAA 60

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +M  IWQ+RFLTWG+L AVFGMRI+FP++IV + + + PI+A+ L++  P  Y +I+
Sbjct: 61  VLSEMDDIWQRRFLTWGMLFAVFGMRILFPLVIVALAAGLGPIDALKLSLTEPARYEQIV 120

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           S AH+ ISGFGG FL +V +T+F N +  +HWI +LE  +  ++ I+  +I ++L  +  
Sbjct: 121 SSAHIAISGFGGAFLALVGMTYFVNPEKTVHWIGWLERHLVAIATIRAAEIALLLVAMSV 180

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
           I+  LP +E   F+ +    I+ F  +  + +VL +        G   K GL  F+YL +
Sbjct: 181 IARFLPAHEALEFIEAGIGGIVAFVLVEGIGTVLEAREEARRAAGLAMKSGLGGFIYLNV 240

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FA++ N  II IGL++GA++VRS+TLL+++QG LN+Y+YLEHG++++
Sbjct: 241 LDASFSFDGVIGAFALSNNMVIIAIGLSVGAMFVRSITLLLVRQGTLNEYRYLEHGAFWA 300

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I  L  IM L   V++PE  TG     LI +S++SS++  
Sbjct: 301 IVALGTIMLLSPRVEVPETVTGLIGAALIGVSLWSSLRAN 340


>gi|158312910|ref|YP_001505418.1| hypothetical protein Franean1_1056 [Frankia sp. EAN1pec]
 gi|158108315|gb|ABW10512.1| protein of unknown function DUF475 [Frankia sp. EAN1pec]
          Length = 422

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 113/364 (31%), Positives = 194/364 (53%), Gaps = 37/364 (10%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F W++ +TV G      IG      +   ++ +         EISLSF+NA++NA  
Sbjct: 32  LRIFGWSLAITVIGVAGAGVIGGGDAAAIVAILAVL---------EISLSFDNAVINATI 82

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++MS  WQ+ FL+ G++IAVFGMR++FPI+IV + + ++P++  +LA+   ++Y   + 
Sbjct: 83  LRRMSEFWQRIFLSVGVIIAVFGMRLLFPIVIVALTAHLSPVDVFDLALNHEEEYGARLH 142

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FL M+ L F F+ + ++ WI  +E       ++  + + + L  +  +
Sbjct: 143 DAHPSIAAFGGIFLFMIFLDFMFDPEREIQWIKRIEEPFRRAGQLDVVSVVLGLVALLVV 202

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-------------------- 230
                 +     +++  A +  + G+  L     +                         
Sbjct: 203 GEAFSGDHTQQVLTAGVAGLATYLGVRGLGEFFEARGIGADDDEDDEDEKAGANGSAPGR 262

Query: 231 --------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRS 282
                   +  G+    LFLYLE+IDAS S DGV+ +FAI++N FII  GL IGA+Y+RS
Sbjct: 263 TTGTSDVVLATGRAAFFLFLYLEVIDASFSFDGVVGAFAISQNIFIIAAGLGIGAMYIRS 322

Query: 283 MTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
            T+ ++++G L +Y YLEHG++Y+I  L+VI+ +    ++ EI TG      I L++ SS
Sbjct: 323 TTVYLVRRGTLGEYIYLEHGAHYAIGALAVILAVSIETEVHEIVTGLIGVAFIGLALLSS 382

Query: 343 IKNK 346
           I+++
Sbjct: 383 IRHR 386


>gi|167589002|ref|ZP_02381390.1| hypothetical protein BuboB_26950 [Burkholderia ubonensis Bu]
          Length = 338

 Score =  332 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 120/334 (35%), Positives = 201/334 (60%), Gaps = 10/334 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F+  + +TV   +    +         G    + I  +L V+EISLS +NA++NA 
Sbjct: 1   MLKDFKIPLSLTVLALVVAYWL---------GGFKDMLIVAVLCVLEISLSLDNAVVNAS 51

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+  S  W+ RF+ +G+ +AVFGMR++FP++IV ++  I   EA+ LAI +P  Y  I+
Sbjct: 52  VLKNWSEKWRNRFMVFGLPVAVFGMRLVFPLLIVAVIGHIGMWEALTLAIDAPDKYAAIL 111

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  +S FGG FL+MV   F  ++    HWI   E  M HL +I  +++ + L+I+  
Sbjct: 112 TSAHHQVSAFGGAFLLMVFFKFMLDTGKDEHWIGIFEGPMRHLGRITALEVALTLAIVII 171

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  +P+ E  SF+ +    +I F   + +  ++  + + +    + G+  F+YLE++D+
Sbjct: 172 ASLYVPSAEQVSFLLAGAFGVISFVIAHGIGDLIGGEDTGSRVV-REGVAGFMYLEVLDS 230

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA++ N F+I +GL +GA Y+R MTL++LK+G L +Y+YLEHG++++I  
Sbjct: 231 SFSFDGVIGAFALSNNIFLIALGLGVGAAYIREMTLVLLKKGTLAQYRYLEHGAFWAIGA 290

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L+ IMFL   ++IPE+ TG      I  +++SSI
Sbjct: 291 LAAIMFLGVKLEIPEVVTGLIGAATIGAAVWSSI 324


>gi|325518381|gb|EGC98102.1| hypothetical protein B1M_43243 [Burkholderia sp. TJI49]
          Length = 338

 Score =  332 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 125/334 (37%), Positives = 204/334 (61%), Gaps = 10/334 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F+  + +TV   +            L G +  + I  +L+V+EISLS +NA++NA 
Sbjct: 1   MLKDFKIPLSLTVLALVAAY---------LLGGVKDMLIVAVLSVLEISLSLDNAVVNAS 51

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+  S  W+ RF+ +G+ +AVFGMR++FP++IV ++  I   +A+ LAI SP+ Y  ++
Sbjct: 52  VLKNWSEKWRNRFMVFGLPVAVFGMRLVFPLLIVAVIGHIGLWDALRLAIESPEQYAAML 111

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  +S FGG FL+MV   F  +++   HWI FLE  M HL +I  +++ + L II  
Sbjct: 112 TSAHHEVSAFGGAFLLMVFFKFMLDTEKDEHWIGFLEGPMRHLGRITALEVALTLGIIIV 171

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  +P  E  SF+ +    +I F   + +  ++  + +      + GL  FLYLE++D+
Sbjct: 172 ASFYVPGAEQVSFLLAGAFGVIGFVIAHGVGDLVGGEDTGTRVV-REGLAGFLYLEVLDS 230

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA++ N F+I +GL +GA Y+R MTL++LK+G L +Y+YLEHG++++I  
Sbjct: 231 SFSFDGVIGAFALSNNIFLIALGLGVGAAYIREMTLVLLKKGTLAQYRYLEHGAFWAIGA 290

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L+ IMFL    D+PE+ TG     +I  +++SSI
Sbjct: 291 LAAIMFLGVKFDVPEVVTGLVGAAMIGAAVWSSI 324


>gi|309811360|ref|ZP_07705147.1| putative membrane protein [Dermacoccus sp. Ellin185]
 gi|308434667|gb|EFP58512.1| putative membrane protein [Dermacoccus sp. Ellin185]
          Length = 379

 Score =  332 bits (851), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 125/374 (33%), Positives = 204/374 (54%), Gaps = 48/374 (12%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +T+AG + G  I         G  S + I  IL V+E+SLSF+NA++NA 
Sbjct: 2   LLKTFGWSAAITIAGLVGGFLI---------GGPSGLAIVAILIVLEVSLSFDNAVVNAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQD 124
            L++M++ WQK FLT GILIAVFGMR++FP++IVC+   + P+EA++LAI      +P  
Sbjct: 53  ILKRMNAFWQKIFLTVGILIAVFGMRLVFPLLIVCLTGHVGPMEAIDLAIKGGDQETPGT 112

Query: 125 YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL 184
           Y  ++  AH  I+ FGG FL+M+ L F F  +  L W+  +E  ++ + K+  + + + L
Sbjct: 113 YAHMLHDAHPSIAAFGGMFLLMLFLDFVF-EKRDLQWLRPIERPLAKIGKLDQLSVVVAL 171

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD------------------ 226
            ++  +S  L   E  + + S    ++ +  +  L  +  S                   
Sbjct: 172 LVLAVVSQTLA-KEPGTVLFSGILGLMTYLLVGGLGDLFESQGEDDDDAAAGDDDAERSV 230

Query: 227 --------------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG 272
                              T GK    LF+YLE++DAS S DGVI +FAI+++ FII +G
Sbjct: 231 ATKAGDTAAQAPASKGVGTTAGKAAFFLFMYLEVLDASFSFDGVIGAFAISQDIFIIALG 290

Query: 273 LTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSST 332
           L +GA+++RS+T+ +++QG L+ Y YLEHG+ ++I  L+ I+ +    ++PE+ TG    
Sbjct: 291 LGVGAMWIRSLTVYLVRQGTLDDYAYLEHGAMWAIGALAAILLISIKHEVPEVVTGLIGV 350

Query: 333 ILIFLSIYSSIKNK 346
             I  +  SS+   
Sbjct: 351 GFIGAAYLSSLVRN 364


>gi|184159802|ref|YP_001848141.1| hypothetical protein ACICU_03485 [Acinetobacter baumannii ACICU]
 gi|183211396|gb|ACC58794.1| uncharacterized protein conserved in bacteria [Acinetobacter
           baumannii ACICU]
          Length = 349

 Score =  331 bits (849), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 124/340 (36%), Positives = 197/340 (57%), Gaps = 19/340 (5%)

Query: 25  FLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAILNAKNLQKMSSIWQK 80
               L   W FTH     +ST+     I  ILAV+E+SLSF+NA++NA  L+     W+ 
Sbjct: 2   VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKM 61

Query: 81  RFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFG 140
            FLT GILIAVFGMR+IFP++IV + + +  +E   +A+  P+ Y + +   H  IS FG
Sbjct: 62  IFLTVGILIAVFGMRLIFPVVIVAVTADMGVVEVAKMALNDPKTYSERLMAHHAEISAFG 121

Query: 141 GTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY 200
           GTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  +  ++  +  ++  
Sbjct: 122 GTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIALIVMAGYVDDHQRL 181

Query: 201 SFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHGKHGLNLFLYLEI 246
           +   +    I+++ G+  L  +L  +              S       K GL  FLYLE+
Sbjct: 182 AVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASGVVKAGLGGFLYLEV 241

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+
Sbjct: 242 LDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYA 301

Query: 307 IFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 302 IGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 341


>gi|307324700|ref|ZP_07603906.1| protein of unknown function DUF475 [Streptomyces violaceusniger Tu
           4113]
 gi|306889582|gb|EFN20562.1| protein of unknown function DUF475 [Streptomyces violaceusniger Tu
           4113]
          Length = 397

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 123/386 (31%), Positives = 206/386 (53%), Gaps = 59/386 (15%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +TV G      +              + I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAITVIGLALAGVLW---------GWKGLAIVGILSILEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + ++P++A++LAI +   Y  ++
Sbjct: 53  ILRKMNAFWQKIFLTVGVLIAVFGMRLVFPVIIVAITAKLSPLQAVDLAINNKDKYEHLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F  +  + W+ +LE  ++ L ++    + + L ++  
Sbjct: 113 TAAHPAIAAFGGMFLLMIFLDFIF-EERDIRWLGWLEKPLAKLGRLDTFSVVVALVVLLI 171

Query: 190 ISNILPTNEMY-------SFVSSSTAAIIIFYGINFLESVL------------------S 224
            +  + T+  +       + + +  A ++ +  +  + S                     
Sbjct: 172 SATTVATDVAHGGGDKSSTVLLAGVAGLVTYLIVGGISSYFEDKLEEEEEDDEDEEAAKG 231

Query: 225 SDSSNNVT------------------------HGKHGLNLFLYLEIIDASLSLDGVISSF 260
           +D S   T                         GK    LFLYLE+IDAS S DGVI +F
Sbjct: 232 ADESGEETKSAANAQLNGSGGRGSSGATVVGLAGKAAFFLFLYLEVIDASFSFDGVIGAF 291

Query: 261 AITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIV 320
           AIT + F + +GL IGA+Y+RS+T+ ++++G L+ Y YLEHG++Y+I  L+ I+ +    
Sbjct: 292 AITNDIFEMALGLGIGAMYIRSLTVFLVRRGTLDDYVYLEHGAHYAIGALAGILLVTIKY 351

Query: 321 DIPEIFTGTSSTILIFLSIYSSIKNK 346
           +I E+ TG    +LI  S +SS+   
Sbjct: 352 EINEVITGLVGVVLIGASYWSSVVRN 377


>gi|288922172|ref|ZP_06416373.1| protein of unknown function DUF475 [Frankia sp. EUN1f]
 gi|288346493|gb|EFC80821.1| protein of unknown function DUF475 [Frankia sp. EUN1f]
          Length = 413

 Score =  329 bits (844), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 110/371 (29%), Positives = 195/371 (52%), Gaps = 43/371 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  +T  G      IG      +   ++ +         EISLSF+NA++NA 
Sbjct: 3   VLRIFGWSFAITAIGIAAAGVIGGGDAAAIVAILAVL---------EISLSFDNAVINAT 53

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L++MS +WQ+ FL+ G++IAVFGMR++FPI+IV + + ++P++  +LA+    +Y   +
Sbjct: 54  ILRRMSEVWQRLFLSLGVIIAVFGMRLLFPIVIVALTAHLSPLDVFDLALNDEAEYAARL 113

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
            +AH  I+ FGG FL M+ L F F+ +  + W+ +LE       +++ + +   L  +  
Sbjct: 114 HEAHPSIAAFGGIFLFMIFLDFMFDPERDIQWLRWLEEPFRKAGQLEVLSVVTGLVALLV 173

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN------------------- 230
           ++     +     +++  A +  + G+  L     +                        
Sbjct: 174 VAEAFSGDHTQQVLTAGVAGLATYLGVRGLGEFFEARGIGADDDEDEDDDAAQSTSAQAT 233

Query: 231 ---------------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
                          +  G+    LFLYLE+IDAS S DGV+ +FAI++N FII  GL I
Sbjct: 234 GSAPAERRTGTPDLVLATGRAAFFLFLYLEVIDASFSFDGVVGAFAISQNIFIIATGLGI 293

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA+Y+RS T+ ++++G L++Y +LEHG++Y+I  L+VI+ +    ++ E+ TG      I
Sbjct: 294 GAMYIRSTTVYLVRRGTLSEYVFLEHGAHYAIGALAVILAVSIETEVHEVVTGLIGVAFI 353

Query: 336 FLSIYSSIKNK 346
            L++ SSI+ +
Sbjct: 354 GLALLSSIRFR 364


>gi|293610616|ref|ZP_06692916.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826960|gb|EFF85325.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 349

 Score =  329 bits (844), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 127/340 (37%), Positives = 195/340 (57%), Gaps = 19/340 (5%)

Query: 25  FLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAILNAKNLQKMSSIWQK 80
               L   W FTH     +ST+     I  ILAV+E+SLSF+NA++NA  L+     W+ 
Sbjct: 2   VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKM 61

Query: 81  RFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFG 140
            FLT GILIAVFGMR+IFP+ IV + + +  IE   LA+  P+ Y + +   H  IS FG
Sbjct: 62  LFLTVGILIAVFGMRLIFPVAIVAVTADMGMIEVAKLALNDPKTYSERLMAHHAEISAFG 121

Query: 141 GTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY 200
           GTFL++V L FFF+ + + HW  +LE  +S L+ +  + +FI L  +  ++  +  ++  
Sbjct: 122 GTFLLLVFLNFFFDEEKETHWFRWLEAKLSSLASVPAMSVFIALIAMLIMAANVDESQRL 181

Query: 201 SFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHGKHGLNLFLYLEI 246
               +    I+++ G+  L  +L  +              S       K G+  FLYLE+
Sbjct: 182 VVTMAGIWGIVVYIGVEVLSHMLGGEPEIDEDGNAIMKDGSGAASGVVKAGIGGFLYLEV 241

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+
Sbjct: 242 LDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYA 301

Query: 307 IFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 302 IGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 341


>gi|148651893|ref|YP_001278986.1| hypothetical protein PsycPRwf_0076 [Psychrobacter sp. PRwf-1]
 gi|148570977|gb|ABQ93036.1| protein of unknown function DUF475 [Psychrobacter sp. PRwf-1]
          Length = 362

 Score =  329 bits (843), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 124/356 (34%), Positives = 203/356 (57%), Gaps = 22/356 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF +  + T    +     G+     + G IS + I  ILAV+EISLSF+NA++NA  
Sbjct: 1   MRHFYFDFIFTTLALIVAAWWGYS-HGGMGGLISALSITAILAVMEISLSFDNAVVNASV 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+     W+  FLT GILIAVFGMR++FPI+IV + + +  ++ +NLA+Y+P +Y   + 
Sbjct: 60  LKHWDKFWKMIFLTVGILIAVFGMRLVFPIVIVAVTADMGMMDVINLALYNPTEYSAKLM 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F F+    +HW  +LE  ++   ++  + +F+ L+I+   
Sbjct: 120 AHHAEISAFGGMFLLLVFLNFLFDD-KDVHWFDWLERRLAKFGEVDAMSVFVALAILMIS 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS--------------------SDSSNN 230
            + +   +  + + +    I+++ G+  +  +L                        +  
Sbjct: 179 LSWVHEEQTLAVLIAGVWGILVYLGVQVVSGMLEGDLEEAEEALEDGTVANSSNGSGNVG 238

Query: 231 VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQ 290
               K G+  FLYLE++DAS S DGVI +FAIT +  II++GL IGA++VRSMT+ ++++
Sbjct: 239 SAVMKGGIAGFLYLEVLDASFSFDGVIGAFAITNDVIIIMLGLAIGAMFVRSMTIFLVEK 298

Query: 291 GILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           G L+++ YLEHG++Y+I  L+VIM L     +PEI TG      I  ++ +SI+ K
Sbjct: 299 GTLDEFVYLEHGAHYAIGALAVIMLLSMKFHVPEIVTGLIGIAFIAWAVVASIRFK 354


>gi|323519729|gb|ADX94110.1| hypothetical protein ABTW07_3693 [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 349

 Score =  329 bits (843), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 126/340 (37%), Positives = 196/340 (57%), Gaps = 19/340 (5%)

Query: 25  FLCGLGIGWQFTHTLSGTISTVY----ICIILAVVEISLSFENAILNAKNLQKMSSIWQK 80
               L   W FTH     +ST+     I  ILAV+E+SLSF+NA++NA  L+     W+ 
Sbjct: 2   VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKM 61

Query: 81  RFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFG 140
            FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y + +   H  IS FG
Sbjct: 62  IFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKMALNDPKTYSERLMAHHAEISAFG 121

Query: 141 GTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY 200
           GTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  +  ++  +      
Sbjct: 122 GTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIALIVMAAYVDEVHRL 181

Query: 201 SFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHGKHGLNLFLYLEI 246
           + V +    I+++ G+  L  +L  +              S       K GL  FLYLE+
Sbjct: 182 AVVMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASGVVKAGLGGFLYLEV 241

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+
Sbjct: 242 LDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYA 301

Query: 307 IFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 302 IGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 341


>gi|312194852|ref|YP_004014913.1| hypothetical protein FraEuI1c_0970 [Frankia sp. EuI1c]
 gi|311226188|gb|ADP79043.1| protein of unknown function DUF475 [Frankia sp. EuI1c]
          Length = 373

 Score =  328 bits (841), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 119/357 (33%), Positives = 192/357 (53%), Gaps = 29/357 (8%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT         IG      L   ++ +         EISLSF+NA++NA 
Sbjct: 3   ILRIFGWSFAVTAVVVAGAGVIGGGQAAALVAILAVL---------EISLSFDNAVINAT 53

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS+ WQ+ FLT G+LIAVFGMR+IFPI++V + + ++P +  +LA+     Y   +
Sbjct: 54  ILGRMSAAWQRIFLTVGVLIAVFGMRLIFPIVVVALTAHLSPYDVFDLAVNHSDQYADKL 113

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
             AH  I+ FGG FL M+ L F F+++  + W+ +LE  +     +  I + + L  +  
Sbjct: 114 HAAHPAIAAFGGIFLFMIFLDFMFDNERDVQWLRWLEEPLRKAGALDVIPVVLGLVALLV 173

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------------SSN 229
           +              +  A +  +  ++ L     S                     SS 
Sbjct: 174 VGEWFSGGHTEQVFVAGVAGLATYLAVSGLGEFFESRGLGAEEDDGDEPATAGTGGASST 233

Query: 230 NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLK 289
            +  GK    LFLYLE++DAS S DGV+ +FAI++N FII  GL IGA+Y+RS+T+ +++
Sbjct: 234 ALATGKAAFFLFLYLEVLDASFSFDGVVGAFAISQNIFIIAAGLGIGAMYIRSLTVFLVR 293

Query: 290 QGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           QG L++Y +LEHG++Y+I  L+VI+ +    D+PEI TG      I L++ +SI+++
Sbjct: 294 QGTLSEYVFLEHGAHYAIGALAVILAVSIENDVPEIVTGLIGVAFIGLALLTSIRHR 350


>gi|269796668|ref|YP_003316123.1| hypothetical protein Sked_33950 [Sanguibacter keddieii DSM 10542]
 gi|269098853|gb|ACZ23289.1| uncharacterized conserved protein [Sanguibacter keddieii DSM 10542]
          Length = 419

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 117/389 (30%), Positives = 205/389 (52%), Gaps = 63/389 (16%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+ ++T    +  L         L G    + +C+ILAV+E+SLSF+NA++NAK
Sbjct: 2   ILRTFGWSFVITALALVTAL---------LYGGPEALVLCLILAVLEVSLSFDNAVVNAK 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQD 124
            L++MS  WQK FLT G+LIAVFGMR++FP+++V + + + P+EA+ LA+     + P  
Sbjct: 53  VLERMSEAWQKIFLTVGVLIAVFGMRLVFPLLVVSVTAGLGPVEAVRLAMAKGDVHEPGS 112

Query: 125 YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL 184
           Y  I+++AH  I+ FG    +++    F  S+ ++ W+ ++E  ++   K+  + + +  
Sbjct: 113 YGYILAEAHPQIAAFG-GLFLLMLFLDFVFSEREITWLSWIERPLARAGKLANLSVVVAA 171

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSS------------------- 225
             +   S +L  +  ++ + +    +I +  +N L S+                      
Sbjct: 172 IALVLASELLAED-SHTVLLAGVLGMITYLAVNGLGSLFEDSHVLDDDATADGVQEQEPV 230

Query: 226 ---------------------------DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVIS 258
                                       +      GK G  LFLYLE++DAS S DGVI 
Sbjct: 231 ARAAAAGGADVSTDPRAPITSAARPTGPTGLAKATGKAGFFLFLYLEVLDASFSFDGVIG 290

Query: 259 SFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ 317
           +FAIT +  II +GL  IGA++VRS+T+ ++++G L +Y YLEHG++++I  L+ I+ L 
Sbjct: 291 AFAITADPIIIALGLGFIGAMFVRSITIFLVRKGTLAEYVYLEHGAHWAIGALATILLLS 350

Query: 318 TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
               I E+ TG    + I  + +SS++++
Sbjct: 351 IHWHINEVVTGLIGVVFIGAAFWSSVRHR 379


>gi|269127400|ref|YP_003300770.1| hypothetical protein Tcur_3191 [Thermomonospora curvata DSM 43183]
 gi|268312358|gb|ACY98732.1| protein of unknown function DUF475 [Thermomonospora curvata DSM
           43183]
          Length = 383

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 121/359 (33%), Positives = 201/359 (55%), Gaps = 33/359 (9%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  +T  G              L G  + + +  +LAV+EISLSF+NA++NAK
Sbjct: 2   ILRTFGWSFAITGLG---------LLAALLYGGPAGLALVAVLAVLEISLSFDNAVVNAK 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L++MS+ WQK FLT GI IAVFGMR++FP++IV I + + PIEA +LA   P++Y   +
Sbjct: 53  VLERMSTFWQKIFLTIGIAIAVFGMRLLFPLLIVGITAQMTPIEAFDLAFNDPKEYAHRM 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
            +A+  I+ FGG FLMM+ L F F  +    W+ +LE  ++ + K+  + + +    +  
Sbjct: 113 HEAYPTIAAFGGMFLMMLFLDFVFEERAD-KWLPWLERPLARIGKLDQLSVVVAAGALAL 171

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS----------------------SDS 227
           ++ +   +     + +    ++ +  +N L  + S                        +
Sbjct: 172 VAGLFAED-TGQVMIAGVLGMVTYILVNGLGELFSQGGEDDGDGEEEVKVPAVKGTTGPN 230

Query: 228 SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLM 287
              +  GK G  LFLYLE++DAS S DGVI +FAI+ +  +I++GL IGA+Y+RS+T+ +
Sbjct: 231 GLVLATGKAGFFLFLYLEVLDASFSFDGVIGAFAISTDPVVIMLGLGIGAMYIRSLTVFL 290

Query: 288 LKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +++G L++Y YLEHG++++I  L+V M +   V +PE  TG     LI  +  SS+   
Sbjct: 291 VRKGTLHEYVYLEHGAHWAIGALAVCMLISIAVHVPEAITGGLGAGLIIAAFLSSVLRN 349


>gi|206560630|ref|YP_002231395.1| hypothetical protein BCAL2269 [Burkholderia cenocepacia J2315]
 gi|198036672|emb|CAR52570.1| putative membrane protein [Burkholderia cenocepacia J2315]
          Length = 330

 Score =  326 bits (837), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 116/303 (38%), Positives = 193/303 (63%), Gaps = 1/303 (0%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G +  + I  +L V+EISLS +NA++NA  L+  S  W+ RF+ +G+ +AVFGMR++FP+
Sbjct: 15  GGVKDMLIVAVLCVLEISLSLDNAVVNASVLKNWSEKWRNRFMVFGLPVAVFGMRLVFPL 74

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV ++  I   +A+ LAI SP  Y  +++ AH  +S FGG FL+MV   F  +++   H
Sbjct: 75  LIVAVIGHIGLWDALTLAIESPDKYAAVLTSAHHEVSAFGGAFLLMVFFKFMLDTEKDEH 134

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLE 220
           WI FLE  M HL +I  +++ + L+I+   S  +P  E  SF+ +    +I F   + + 
Sbjct: 135 WIGFLEGPMRHLGRITALEVALTLAIVIVASFYVPATEQVSFLLAGAFGVIGFVIAHGVG 194

Query: 221 SVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
            ++  + +      + G+  F+YLE++D+S S DGVI +FA++ N F+I +GL +GA Y+
Sbjct: 195 DLVGGEDTGTRVV-REGVAGFMYLEVLDSSFSFDGVIGAFALSNNIFLIALGLGVGAAYI 253

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
           R MTL++LK+G L +Y++LEHG++++I  L+ IMFL    ++PE+ TG     +I  +++
Sbjct: 254 REMTLVLLKKGTLAQYRFLEHGAFWAIGALATIMFLGVKFEVPEVVTGLIGAAMIAAAVW 313

Query: 341 SSI 343
           SSI
Sbjct: 314 SSI 316


>gi|134296360|ref|YP_001120095.1| hypothetical protein Bcep1808_2261 [Burkholderia vietnamiensis G4]
 gi|134139517|gb|ABO55260.1| protein of unknown function DUF475 [Burkholderia vietnamiensis G4]
          Length = 338

 Score =  325 bits (834), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 121/334 (36%), Positives = 204/334 (61%), Gaps = 10/334 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F+  + +TV   +            L G +  + I  +L+V+EISLS +NA++NA 
Sbjct: 1   MLKDFKIPLALTVLALVAAY---------LLGGVKDMLIVAVLSVLEISLSLDNAVVNAS 51

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+  S  W+ RF+ +G+ +AVFGMR++FP++IV ++  I  ++A+ LAI +P+ Y  ++
Sbjct: 52  VLKNWSEKWRNRFMVFGLPVAVFGMRLVFPLLIVAVIGHIGLLDALTLAIEAPEKYAAVL 111

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  +S FGG FL+MV   F  + +   HWI FLE  M HL +I  +++ + L+I+  
Sbjct: 112 TSAHHEVSAFGGAFLLMVFFKFMLDKEKDEHWIGFLEGPMRHLGRITALEVALTLAIVIV 171

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  +P  E  SF+ +    +I F   + +  ++  + +      + G+  F+YLE++D+
Sbjct: 172 ASFYVPAAEQVSFLLAGAFGVIGFVIAHGVGDLVGGEDTGTRVV-REGVAGFMYLEVLDS 230

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA++ N F+I +GL +GA Y+R MTL++LK+G L +Y+YLEHG++++I  
Sbjct: 231 SFSFDGVIGAFALSNNIFLIALGLGVGAAYIREMTLVLLKKGTLAQYRYLEHGAFWAIGA 290

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L+ IMF+   +D+PEI TG      I  ++ SSI
Sbjct: 291 LATIMFVGVKLDVPEIVTGLIGAATIAAAVGSSI 324


>gi|183985097|ref|YP_001853388.1| hypothetical protein MMAR_5129 [Mycobacterium marinum M]
 gi|183178423|gb|ACC43533.1| conserved hypothetical membrane protein [Mycobacterium marinum M]
          Length = 358

 Score =  325 bits (834), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 117/362 (32%), Positives = 202/362 (55%), Gaps = 34/362 (9%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           + I  F  ++LVT A  + G            G ++ +++ ++LA++EISLSF+NAI+NA
Sbjct: 2   TTIRVFGLSLLVTAAALVAGYW---------HGGVTALFLLVVLAILEISLSFDNAIINA 52

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------ 122
             L++MS  WQ+ FLT GI+IAVFGMR++FP+ IV + + ++P+ AM LA+  P      
Sbjct: 53  TILKQMSQFWQQMFLTIGIVIAVFGMRLVFPLTIVWVTAGLDPVRAMRLALNPPPGGALD 112

Query: 123 -----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                  Y K+IS AH  I+ FGG FL+ + L F FN   ++ W+ ++E   + + ++  
Sbjct: 113 FPDGSPSYEKLISAAHPQIAAFGGMFLLTLFLDFVFND-REIKWLKWIEAPFARIGRLGQ 171

Query: 178 IKIFIVLSIIFGISNIL--PTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS-------- 227
           + + +    +      L   ++++ + + +    ++ +  +N L   L            
Sbjct: 172 VHVMVACVTLIFAGPGLTDSSDDLGTVMVAGLLGLVTYLVVNGLSRALQPPRVGAGPGEL 231

Query: 228 SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLL 286
           +     GK G  LF+YLE++DAS S DGV  +FAIT +  +I +GL  +GA++VRS+T+ 
Sbjct: 232 AAQGAVGKAGFMLFMYLEVLDASFSFDGVTGAFAITSDPIVIALGLGLVGAMFVRSITIY 291

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD--IPEIFTGTSSTILIFLSIYSSIK 344
           +++Q  L++Y YLEHG++++I  L+VIM +       IPE  T +   + I  +  +S+ 
Sbjct: 292 LVRQDALDRYVYLEHGAHWAIGALAVIMLMSIDHHLQIPEWITASIGVVFIGAAFTNSVV 351

Query: 345 NK 346
             
Sbjct: 352 RN 353


>gi|134288489|ref|YP_001110652.1| hypothetical protein Bcep1808_6963 [Burkholderia vietnamiensis G4]
 gi|134133139|gb|ABO59849.1| protein of unknown function DUF475 [Burkholderia vietnamiensis G4]
          Length = 340

 Score =  325 bits (833), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 125/334 (37%), Positives = 203/334 (60%), Gaps = 10/334 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F+  + +T+   +            L G +  + I  +L+V+EISLS +NA++NA 
Sbjct: 1   MLKDFKIPLALTLVALVAAY---------LMGGVKDMIIVGVLSVLEISLSLDNAVVNAS 51

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+  S  WQ RF+ +G+ IAVFGMR++FP++IV I+  I   EA +LA+  P  Y  I+
Sbjct: 52  VLKHWSKKWQDRFMVFGLPIAVFGMRLVFPLLIVAIIGHIGFWEAASLALKDPAQYASIL 111

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  +S FGG FL+MV   F F+S  + HWI F+E AM+ L +I  +++ + L I+  
Sbjct: 112 TSAHHEVSAFGGAFLLMVFFKFMFDSGKEEHWIGFVEQAMARLGRITAVEVALTLGIVVL 171

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  +P  E  +F+ +    +I F   + +  ++  + +      + G+  FLYLE++D+
Sbjct: 172 ASFHVPAQEQIAFLLAGVFGVISFVVAHGIGDLMGGEDTGTRVV-REGVAGFLYLEVLDS 230

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA++ N F+I IGL +GA Y+R MTL++LK+G L  YKYLE G++++I  
Sbjct: 231 SFSFDGVIGAFALSDNVFLIAIGLGVGAAYIREMTLVLLKKGTLASYKYLECGAFWAIGA 290

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L+ IMFL    ++PE+ TG    + I L++++SI
Sbjct: 291 LATIMFLNVKFEVPEVVTGLIGAVTIGLAVWTSI 324


>gi|111225246|ref|YP_716040.1| hypothetical protein FRAAL5896 [Frankia alni ACN14a]
 gi|111152778|emb|CAJ64521.1| putative integral membrane protein [Frankia alni ACN14a]
          Length = 371

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 117/340 (34%), Positives = 188/340 (55%), Gaps = 32/340 (9%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           + GT     I  ILAV+EISLSF+NA++NA  L++MS  WQK FLT G++IAVFGMR++F
Sbjct: 1   MIGTPRDAAIVAILAVLEISLSFDNAVINATILRRMSPFWQKLFLTLGVVIAVFGMRLLF 60

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNK 158
           PI+IV + + + P++  +LA+     Y + +  AH  I+ FGG FL M+ L F F+ +  
Sbjct: 61  PIIIVALTAHLGPVKVFDLALNDSAQYAEKLGDAHPAIAAFGGIFLFMLFLDFLFDPERD 120

Query: 159 LHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINF 218
           + WI  LE  +    ++  I   + L  +  +      +     +++  A +  + G+  
Sbjct: 121 VQWIKKLEEPLRRAGQLDVIPTVVGLVALLVVGEAFSGDHTQQVLTAGVAGLATYLGVRG 180

Query: 219 LESVLSSDSSNN--------------------------------VTHGKHGLNLFLYLEI 246
           L     S                                     +  G+    LFLYLE+
Sbjct: 181 LGEFFESRGVGAEDDDAADSDGVAVDGAGKTTAAPRSSGQPKLVLATGRAAAFLFLYLEV 240

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           IDAS S DGV+ +FAI++N F+I  GL IGA+Y+RS+T+ ++++G L++Y YLEHG++Y+
Sbjct: 241 IDASFSFDGVVGAFAISQNIFVIATGLGIGAMYIRSLTVYLVRRGTLSEYIYLEHGAHYA 300

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I  L++I+ +    ++PEI TG      I L++ SSI+++
Sbjct: 301 IGALAIILAISIETEVPEIVTGLVGVAFIGLALVSSIRHR 340


>gi|226304083|ref|YP_002764041.1| hypothetical protein RER_05940 [Rhodococcus erythropolis PR4]
 gi|226183198|dbj|BAH31302.1| conserved hypothetical membrane protein [Rhodococcus erythropolis
           PR4]
          Length = 373

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 120/352 (34%), Positives = 197/352 (55%), Gaps = 28/352 (7%)

Query: 22  VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR 81
           + G    + I       + G    +++ IIL+++EISLSF+NA++NA  L++MS  WQK 
Sbjct: 5   IFGLSIAISIIAMIVAFIYGGPEALFLVIILSILEISLSFDNAVINATVLRRMSDFWQKI 64

Query: 82  FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP-----------QDYLKIIS 130
           FLT GI+IAVFGMR++FP++IV   S + P+ A++LA+  P             Y  I++
Sbjct: 65  FLTIGIVIAVFGMRLVFPLVIVWAASGLGPVAALDLALNPPADDAAYFANGEPSYETILT 124

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FL+M+ L F F  + ++ W+ +LE  ++ + K+  + + +   ++   
Sbjct: 125 DAHPQIAAFGGMFLLMLFLGFIF-EEREITWLSWLEKPLARIGKLDQLSVVVAGIVLVLS 183

Query: 191 SNILPTNEMY-SFVSSSTAAIIIFYGINFLESVL--------------SSDSSNNVTHGK 235
            + L  ++   + + S    +I +  +N L  +                  +      GK
Sbjct: 184 GSFLAADDKVSTVMISGVLGMITYIAVNGLGELFNLPEEGEEEETTKSGGPTEFAKATGK 243

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILN 294
            G  LFLYLE++DAS S DGVI +FAIT +  II +GL  +GA++VRS+T+ ++++G L+
Sbjct: 244 AGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGLGFVGAMFVRSITVFLVRKGTLS 303

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            Y YLEHG++++I  L+VI+ +   V I EI TG     LI  +  SS+   
Sbjct: 304 DYVYLEHGAHWAIGALAVILMVSIGVHINEIITGLVGVFLIGAAFISSLIRN 355


>gi|229489797|ref|ZP_04383654.1| integral membrane protein [Rhodococcus erythropolis SK121]
 gi|229323307|gb|EEN89071.1| integral membrane protein [Rhodococcus erythropolis SK121]
          Length = 373

 Score =  324 bits (830), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 120/364 (32%), Positives = 202/364 (55%), Gaps = 37/364 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F  +I +++   +            + G    +++ IIL+++EISLSF+NA++NA 
Sbjct: 2   VLRIFGLSIAISILAMIVAF---------IYGGPEALFLVIILSILEISLSFDNAVINAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------- 122
            LQ+MS  WQK FLT G++IAVFGMR++FP++IV   S + P+ A++LA+  P       
Sbjct: 53  VLQRMSEFWQKIFLTIGVIIAVFGMRLVFPLVIVWAASGLGPVAALDLALNPPADDAAYF 112

Query: 123 ----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                 Y  I++ AH  I+ FGG FL+M+ L F F  + ++ W+ +LE  ++ + K+  +
Sbjct: 113 ANGEPSYETILTDAHPQIAAFGGMFLLMLFLGFIF-EEREITWLSWLEKPLARIGKLDQL 171

Query: 179 KIFIVLSIIFGISNILPTNEMY-SFVSSSTAAIIIFYGINFLESVL-------------- 223
            + +   ++    + L  ++   + + S    +I +  +N L  +               
Sbjct: 172 SVVVAGIVLVLSGSFLAADDKVSTVMISGVLGMITYIAVNGLGELFNLPEEGEEEETAKS 231

Query: 224 SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRS 282
              +      GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL  +GA++VRS
Sbjct: 232 GGPTQLAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGLGFVGAMFVRS 291

Query: 283 MTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           +T+ ++++G L+ Y YLEHG++++I  L+VI+ +   V I EI TG     LI  +  SS
Sbjct: 292 ITVFLVRKGTLSDYVYLEHGAHWAIGALAVILMVSIGVHINEIITGLVGVFLIGAAFISS 351

Query: 343 IKNK 346
           +   
Sbjct: 352 LIRN 355


>gi|118619378|ref|YP_907710.1| hypothetical protein MUL_4205 [Mycobacterium ulcerans Agy99]
 gi|118571488|gb|ABL06239.1| conserved hypothetical membrane protein [Mycobacterium ulcerans
           Agy99]
          Length = 358

 Score =  323 bits (828), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 117/362 (32%), Positives = 201/362 (55%), Gaps = 34/362 (9%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           + I  F  ++LVT A  + G            G ++ +++ ++LA++EISLSF+NAI+NA
Sbjct: 2   TTIRVFGLSLLVTAAALIAGYW---------HGGVTALFLLVVLAILEISLSFDNAIINA 52

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------ 122
             L++MS  WQ+ FLT GI+IAVFGMR++FP+ IV + + ++P+ AM LA+  P      
Sbjct: 53  TILKQMSQFWQQMFLTIGIVIAVFGMRLVFPLTIVWVTAGLDPVRAMRLALNPPPGGALD 112

Query: 123 -----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                  Y K+IS AH  I+ FGG FL+ + L F FN   ++ W+ ++E   + + ++  
Sbjct: 113 FPDGSPSYEKLISAAHPQIAAFGGMFLLTLFLDFVFND-REIKWLKWIEAPFARIGRLGQ 171

Query: 178 IKIFIVLSIIFGISNIL--PTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS-------- 227
           + + +    +      L   ++++   + +    ++ +  +N L   L            
Sbjct: 172 VHVMVACVTLIFAGPGLTDSSDDLGIVMVAGLLGLVTYLVVNGLSRALQPPRVGAGPGEL 231

Query: 228 SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLL 286
           +     GK G  LF+YLE++DAS S DGV  +FAIT +  +I +GL  +GA++VRS+T+ 
Sbjct: 232 AAQGAVGKAGFMLFMYLEVLDASFSFDGVTGAFAITSDPIVIALGLGLVGAMFVRSITIY 291

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD--IPEIFTGTSSTILIFLSIYSSIK 344
           +++Q  L++Y YLEHG++++I  L+VIM +       IPE  T +   + I  +  +S+ 
Sbjct: 292 LVRQDALDRYVYLEHGAHWAIGALAVIMLMSIDHHLQIPEWITASIGVVFIGAAFTNSVV 351

Query: 345 NK 346
             
Sbjct: 352 RN 353


>gi|330984164|gb|EGH82267.1| hypothetical protein PLA107_03950 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 342

 Score =  322 bits (825), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 126/339 (37%), Positives = 212/339 (62%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + LVT+   +            + G  S  +  +IL V+E+S+S +NA+ NAK 
Sbjct: 1   MRNFWGSALVTLICMIGAF---------IYGGPSAAFAVLILGVLEVSVSLDNAVANAKV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ MS  WQ  FLT GI IAVF +R+I P+ IV + + ++ ++  ++ +  P  Y   + 
Sbjct: 52  LKDMSRFWQMAFLTVGIFIAVFVVRLILPVEIVALAANLSFMDTAHMLVNDPVQYSHHLH 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +AH+ IS FGG FL+MV L F FN + +  W+  +E  ++    + GIK F+ L+++ GI
Sbjct: 112 EAHLSISAFGGMFLLMVFLDFVFNDEKEHFWLGAVEEKLASFGGVDGIKAFVALAVLMGI 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV---THGKHGLNLFLYLEII 247
           +++L   +  +F+ + +  ++IF+ ++ L+++     + +    T  K GL  FLYLE++
Sbjct: 172 ASVLEGAKSATFLYAGSLGLVIFFAMSLLKNLFEEKETGDAVVNTVKKGGLVSFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS SLDGVI +FAI+K+  +I +GLTIGA++VRS+T+ ++K+G L++  YLE G+  +I
Sbjct: 232 DASFSLDGVIGAFAISKDPVVIGMGLTIGAMFVRSLTVYLVKKGTLDELVYLEAGAMCAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL++IM     VDIPE+FT     +LI LS++SS+++K
Sbjct: 292 GVLALIMISSGFVDIPELFTALVGAVLIGLSVWSSLRHK 330


>gi|213159028|ref|YP_002321026.1| major facilitator family transporter [Acinetobacter baumannii
           AB0057]
 gi|213058188|gb|ACJ43090.1| major facilitator family transporter [Acinetobacter baumannii
           AB0057]
          Length = 327

 Score =  322 bits (825), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 117/319 (36%), Positives = 190/319 (59%), Gaps = 15/319 (4%)

Query: 42  TISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIM 101
            +  + I  ILAV+E+SLSF+NA++NA  L+     W+  FLT GILIAVFGMR+IFP++
Sbjct: 1   MLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVV 60

Query: 102 IVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHW 161
           IV + + +  +E   +A+  P+ Y + +   H  IS FGGTFL++V L FFF+ + + HW
Sbjct: 61  IVAVTADMGVVEVAKMALNDPKTYSERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHW 120

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
             +LE  ++ L+ +  + +F+ L  +  ++  +  ++  +   +    I+++ G+  L  
Sbjct: 121 FRWLESKLASLASVPAMSVFLALIALIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSH 180

Query: 222 VLSSD--------------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFF 267
           +L  +              S       K GL  FLYLE++DAS S DGVI +FAIT +  
Sbjct: 181 LLGGEPEIDENGNAVLQDGSGAASGVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVV 240

Query: 268 IIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIF 326
           +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+I  L+ IM    T V +PE+ 
Sbjct: 241 VIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVV 300

Query: 327 TGTSSTILIFLSIYSSIKN 345
           TG      I  ++ +SI+ 
Sbjct: 301 TGLIGVAFIVWAVIASIQY 319


>gi|126643296|ref|YP_001086280.1| hypothetical protein A1S_3289 [Acinetobacter baumannii ATCC 17978]
          Length = 327

 Score =  321 bits (824), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 117/319 (36%), Positives = 190/319 (59%), Gaps = 15/319 (4%)

Query: 42  TISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIM 101
            +  + I  ILAV+E+SLSF+NA++NA  L+     W+  FLT GILIAVFGMR+IFP++
Sbjct: 1   MLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVV 60

Query: 102 IVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHW 161
           IV + + +  IE   +A+  P+ Y + +   H  IS FGGTFL++V L FFF+ + + HW
Sbjct: 61  IVAVTADMGVIEVAKMALNDPKTYSERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHW 120

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
             +LE  ++ L+ +  + +F+ L  +  ++  +  ++  +   +    I+++ G+  L  
Sbjct: 121 FRWLESKLASLASVPAMSVFLALIALIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSH 180

Query: 222 VLSSD--------------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFF 267
           +L  +              +       K GL  FLYLE++DAS S DGVI +FAIT +  
Sbjct: 181 LLGGEPEIDENGNAVLQDGTGAASGVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVV 240

Query: 268 IIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIF 326
           +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+I  L+ IM    T V +PE+ 
Sbjct: 241 VIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVV 300

Query: 327 TGTSSTILIFLSIYSSIKN 345
           TG      I  ++ +SI+ 
Sbjct: 301 TGLIGVAFIVWAVIASIQY 319


>gi|325123816|gb|ADY83339.1| putative integral membrane protein [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 327

 Score =  319 bits (819), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 120/319 (37%), Positives = 188/319 (58%), Gaps = 15/319 (4%)

Query: 42  TISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIM 101
            +  + I  ILAV+E+SLSF+NA++NA  L+     W+  FLT GILIAVFGMR+IFP+ 
Sbjct: 1   MLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKMLFLTVGILIAVFGMRLIFPVA 60

Query: 102 IVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHW 161
           IV + + +  IE   LA+  P+ Y + +   H  IS FGGTFL++V L FFF+ + + HW
Sbjct: 61  IVAVTADMGMIEVAKLALNDPKTYSERLMAHHAEISAFGGTFLLLVFLNFFFDEEKETHW 120

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
             +LE  +S L+ +  + +FI L  +  ++  +  ++      +    I+++ G+  L  
Sbjct: 121 FRWLEAKLSSLASVPAMSVFIALIAMLIMAANVDESQRLVVTMAGIWGIVVYIGVEVLSH 180

Query: 222 VLSSD--------------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFF 267
           +L  +              S       K G+  FLYLE++DAS S DGVI +FAIT +  
Sbjct: 181 MLGGEPEIDEDGNAIMKDGSGAASGVVKAGIGGFLYLEVLDASFSFDGVIGAFAITSDVV 240

Query: 268 IIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIF 326
           +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+I  L+ IM    T V +PE+ 
Sbjct: 241 VIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVV 300

Query: 327 TGTSSTILIFLSIYSSIKN 345
           TG      I  ++ +SI+ 
Sbjct: 301 TGLIGVAFIVWAVIASIQY 319


>gi|15843241|ref|NP_338278.1| hypothetical protein MT3731 [Mycobacterium tuberculosis CDC1551]
 gi|13883597|gb|AAK48092.1| conserved hypothetical transmembrane protein [Mycobacterium
           tuberculosis CDC1551]
          Length = 374

 Score =  319 bits (819), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 113/362 (31%), Positives = 198/362 (54%), Gaps = 34/362 (9%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S    F +++L+TV   +         T  L G  + +++  +LA++E+SLSF+NAI+NA
Sbjct: 11  STFRIFGFSLLMTVVALV---------TGYLHGGPTALFLLAVLALLEVSLSFDNAIINA 61

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------ 122
             LQ+MS  WQ+ FLT GILIAVFGMR++FP+ I+   + ++P+ AM LA+  P      
Sbjct: 62  AILQRMSPFWQRMFLTIGILIAVFGMRLVFPLAIIWTTAGLDPVRAMELALRPPAHGALE 121

Query: 123 -----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                  Y K+I+ AH  I+ FGG FL+M+ L F       + W+ ++E+  + + ++  
Sbjct: 122 FADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVV-HDRDIKWLKWIEVPFARIGRLGQ 180

Query: 178 IKIFI--VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS-------- 227
           + + +  V  ++ G      +++  + + +    ++ +  +N +                
Sbjct: 181 VPVIVASVGLVLAGALLTHSSDQRGTVLIAGLLGMVTYLVVNGISRAFRPAGLGEATPGV 240

Query: 228 SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLL 286
                 GK G  LFLYLE++DA+ S DGV  +FAIT +  II +GL  +GA++VRS+T+ 
Sbjct: 241 QARQAAGKAGCALFLYLEVLDAAFSFDGVTGAFAITTDPIIIALGLGVVGAMFVRSITIY 300

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSIK 344
           +++Q  L++Y YLEHG++++I  L++I+ L       +PE  T +   + I  +   S++
Sbjct: 301 LVRQDTLDRYVYLEHGAHWAIGALAIILLLSIDHRFAVPEWVTASVGVVFIGAAFTESVR 360

Query: 345 NK 346
             
Sbjct: 361 RN 362


>gi|15610765|ref|NP_218146.1| hypothetical protein Rv3629c [Mycobacterium tuberculosis H37Rv]
 gi|31794799|ref|NP_857292.1| hypothetical protein Mb3653c [Mycobacterium bovis AF2122/97]
 gi|121639542|ref|YP_979766.1| hypothetical protein BCG_3687c [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|148663492|ref|YP_001285015.1| hypothetical protein MRA_3665 [Mycobacterium tuberculosis H37Ra]
 gi|148824833|ref|YP_001289587.1| integral membrane protein [Mycobacterium tuberculosis F11]
 gi|167968548|ref|ZP_02550825.1| hypothetical protein MtubH3_11131 [Mycobacterium tuberculosis
           H37Ra]
 gi|215413549|ref|ZP_03422221.1| integral membrane protein [Mycobacterium tuberculosis 94_M4241A]
 gi|215424871|ref|ZP_03422790.1| integral membrane protein [Mycobacterium tuberculosis T92]
 gi|215432600|ref|ZP_03430519.1| integral membrane protein [Mycobacterium tuberculosis EAS054]
 gi|215447966|ref|ZP_03434718.1| integral membrane protein [Mycobacterium tuberculosis T85]
 gi|218755407|ref|ZP_03534203.1| integral membrane protein [Mycobacterium tuberculosis GM 1503]
 gi|219559700|ref|ZP_03538776.1| integral membrane protein [Mycobacterium tuberculosis T17]
 gi|224992039|ref|YP_002646728.1| putative integral membrane protein [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|253800667|ref|YP_003033668.1| hypothetical protein TBMG_03666 [Mycobacterium tuberculosis KZN
           1435]
 gi|254233127|ref|ZP_04926453.1| hypothetical protein TBCG_03552 [Mycobacterium tuberculosis C]
 gi|254366181|ref|ZP_04982225.1| conserved integral membrane protein [Mycobacterium tuberculosis
           str. Haarlem]
 gi|254552741|ref|ZP_05143188.1| hypothetical protein Mtube_20215 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260184546|ref|ZP_05762020.1| hypothetical protein MtubCP_00610 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260198668|ref|ZP_05766159.1| hypothetical protein MtubT4_00630 [Mycobacterium tuberculosis T46]
 gi|260202812|ref|ZP_05770303.1| hypothetical protein MtubK8_00645 [Mycobacterium tuberculosis K85]
 gi|289441058|ref|ZP_06430802.1| conserved membrane protein [Mycobacterium tuberculosis T46]
 gi|289445222|ref|ZP_06434966.1| conserved membrane protein [Mycobacterium tuberculosis CPHL_A]
 gi|289555888|ref|ZP_06445098.1| conserved membrane protein [Mycobacterium tuberculosis KZN 605]
 gi|289571865|ref|ZP_06452092.1| conserved membrane protein [Mycobacterium tuberculosis T17]
 gi|289572276|ref|ZP_06452503.1| integral membrane protein [Mycobacterium tuberculosis K85]
 gi|289748143|ref|ZP_06507521.1| conserved membrane protein [Mycobacterium tuberculosis T92]
 gi|289755756|ref|ZP_06515134.1| integral membrane protein [Mycobacterium tuberculosis EAS054]
 gi|289759787|ref|ZP_06519165.1| integral membrane protein [Mycobacterium tuberculosis T85]
 gi|289763805|ref|ZP_06523183.1| conserved integral membrane protein [Mycobacterium tuberculosis GM
           1503]
 gi|294995461|ref|ZP_06801152.1| hypothetical protein Mtub2_13345 [Mycobacterium tuberculosis 210]
 gi|297636301|ref|ZP_06954081.1| hypothetical protein MtubK4_19345 [Mycobacterium tuberculosis KZN
           4207]
 gi|297733295|ref|ZP_06962413.1| hypothetical protein MtubKR_19485 [Mycobacterium tuberculosis KZN
           R506]
 gi|298527105|ref|ZP_07014514.1| conserved integral membrane protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306777982|ref|ZP_07416319.1| conserved membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|306778513|ref|ZP_07416850.1| conserved membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|306786535|ref|ZP_07424857.1| conserved membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|306790902|ref|ZP_07429224.1| conserved membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|306791222|ref|ZP_07429524.1| conserved membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|306796008|ref|ZP_07434310.1| conserved membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|306801255|ref|ZP_07437923.1| conserved membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|306805469|ref|ZP_07442137.1| conserved membrane protein [Mycobacterium tuberculosis SUMu007]
 gi|306969761|ref|ZP_07482422.1| conserved membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|306974100|ref|ZP_07486761.1| conserved membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|307081808|ref|ZP_07490978.1| conserved membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|307086423|ref|ZP_07495536.1| conserved membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|313660626|ref|ZP_07817506.1| hypothetical protein MtubKV_19480 [Mycobacterium tuberculosis KZN
           V2475]
 gi|2105065|emb|CAB08828.1| PROBABLE CONSERVED INTEGRAL MEMBRANE PROTEIN [Mycobacterium
           tuberculosis H37Rv]
 gi|31620396|emb|CAD95839.1| PROBABLE CONSERVED INTEGRAL MEMBRANE PROTEIN [Mycobacterium bovis
           AF2122/97]
 gi|121495190|emb|CAL73676.1| Probable conserved integral membrane protein [Mycobacterium bovis
           BCG str. Pasteur 1173P2]
 gi|124602920|gb|EAY61195.1| hypothetical protein TBCG_03552 [Mycobacterium tuberculosis C]
 gi|134151693|gb|EBA43738.1| conserved integral membrane protein [Mycobacterium tuberculosis
           str. Haarlem]
 gi|148507644|gb|ABQ75453.1| putative conserved integral membrane protein [Mycobacterium
           tuberculosis H37Ra]
 gi|148723360|gb|ABR07985.1| conserved integral membrane protein [Mycobacterium tuberculosis
           F11]
 gi|224775154|dbj|BAH27960.1| putative integral membrane protein [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|253322170|gb|ACT26773.1| conserved membrane protein [Mycobacterium tuberculosis KZN 1435]
 gi|289413977|gb|EFD11217.1| conserved membrane protein [Mycobacterium tuberculosis T46]
 gi|289418180|gb|EFD15381.1| conserved membrane protein [Mycobacterium tuberculosis CPHL_A]
 gi|289440520|gb|EFD23013.1| conserved membrane protein [Mycobacterium tuberculosis KZN 605]
 gi|289536707|gb|EFD41285.1| integral membrane protein [Mycobacterium tuberculosis K85]
 gi|289545619|gb|EFD49267.1| conserved membrane protein [Mycobacterium tuberculosis T17]
 gi|289688730|gb|EFD56159.1| conserved membrane protein [Mycobacterium tuberculosis T92]
 gi|289696343|gb|EFD63772.1| integral membrane protein [Mycobacterium tuberculosis EAS054]
 gi|289711311|gb|EFD75327.1| conserved integral membrane protein [Mycobacterium tuberculosis GM
           1503]
 gi|289715351|gb|EFD79363.1| integral membrane protein [Mycobacterium tuberculosis T85]
 gi|298496899|gb|EFI32193.1| conserved integral membrane protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308213696|gb|EFO73095.1| conserved membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|308328450|gb|EFP17301.1| conserved membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|308328859|gb|EFP17710.1| conserved membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|308332700|gb|EFP21551.1| conserved membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|308340193|gb|EFP29044.1| conserved membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|308343480|gb|EFP32331.1| conserved membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|308347978|gb|EFP36829.1| conserved membrane protein [Mycobacterium tuberculosis SUMu007]
 gi|308351920|gb|EFP40771.1| conserved membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|308352679|gb|EFP41530.1| conserved membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|308356554|gb|EFP45405.1| conserved membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|308360512|gb|EFP49363.1| conserved membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|308364127|gb|EFP52978.1| conserved membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|323717679|gb|EGB26880.1| membrane protein [Mycobacterium tuberculosis CDC1551A]
 gi|326905464|gb|EGE52397.1| conserved membrane protein [Mycobacterium tuberculosis W-148]
 gi|328460397|gb|AEB05820.1| conserved membrane protein [Mycobacterium tuberculosis KZN 4207]
          Length = 365

 Score =  319 bits (819), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 113/362 (31%), Positives = 198/362 (54%), Gaps = 34/362 (9%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S    F +++L+TV   +         T  L G  + +++  +LA++E+SLSF+NAI+NA
Sbjct: 2   STFRIFGFSLLMTVVALV---------TGYLHGGPTALFLLAVLALLEVSLSFDNAIINA 52

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------ 122
             LQ+MS  WQ+ FLT GILIAVFGMR++FP+ I+   + ++P+ AM LA+  P      
Sbjct: 53  AILQRMSPFWQRMFLTIGILIAVFGMRLVFPLAIIWTTAGLDPVRAMELALRPPAHGALE 112

Query: 123 -----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                  Y K+I+ AH  I+ FGG FL+M+ L F       + W+ ++E+  + + ++  
Sbjct: 113 FADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVV-HDRDIKWLKWIEVPFARIGRLGQ 171

Query: 178 IKIFI--VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS-------- 227
           + + +  V  ++ G      +++  + + +    ++ +  +N +                
Sbjct: 172 VPVIVASVGLVLAGALLTHSSDQRGTVLIAGLLGMVTYLVVNGISRAFRPAGLGEATPGV 231

Query: 228 SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLL 286
                 GK G  LFLYLE++DA+ S DGV  +FAIT +  II +GL  +GA++VRS+T+ 
Sbjct: 232 QARQAAGKAGCALFLYLEVLDAAFSFDGVTGAFAITTDPIIIALGLGVVGAMFVRSITIY 291

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSIK 344
           +++Q  L++Y YLEHG++++I  L++I+ L       +PE  T +   + I  +   S++
Sbjct: 292 LVRQDTLDRYVYLEHGAHWAIGALAIILLLSIDHRFAVPEWVTASVGVVFIGAAFTESVR 351

Query: 345 NK 346
             
Sbjct: 352 RN 353


>gi|215405677|ref|ZP_03417858.1| integral membrane protein [Mycobacterium tuberculosis 02_1987]
 gi|289747465|ref|ZP_06506843.1| integral membrane protein [Mycobacterium tuberculosis 02_1987]
 gi|289687993|gb|EFD55481.1| integral membrane protein [Mycobacterium tuberculosis 02_1987]
          Length = 365

 Score =  318 bits (816), Expect = 7e-85,   Method: Composition-based stats.
 Identities = 113/362 (31%), Positives = 198/362 (54%), Gaps = 34/362 (9%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S    F +++L+TV   +         T  L G  + +++  +LA++E+SLSF+NAI+NA
Sbjct: 2   STFRIFGFSLLMTVVALV---------TGYLHGGPTALFLLAVLALLEVSLSFDNAIINA 52

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------ 122
             LQ+MS  WQ+ FLT GILIAVFGMR++FP+ I+   + ++P+ AM LA+  P      
Sbjct: 53  AILQRMSPFWQRMFLTIGILIAVFGMRLVFPLAIIWTTAGLDPVRAMELALRPPAHGALE 112

Query: 123 -----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                  Y K+I+ AH  I+ FGG FL+M+ L F       + W+ ++E+  + + ++  
Sbjct: 113 FADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVV-HDRDIKWLKWIEVPFARIGRLGQ 171

Query: 178 IKIFI--VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS-------- 227
           + + +  V  ++ G      +++  + + +    ++ +  +N +                
Sbjct: 172 VPVIVASVGLVLAGALLTHSSDQRGTVLIAGLLGMVTYLVVNGISRAFRPAGLGEATPGV 231

Query: 228 SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLL 286
                 GK G  LFLYLE++DA+ S DGV  +FAIT +  II +GL  +GA++VRS+T+ 
Sbjct: 232 QARQAAGKAGCALFLYLEVLDAAFSFDGVTGAFAITTDPIIIALGLGVVGAMFVRSITIC 291

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSIK 344
           +++Q  L++Y YLEHG++++I  L++I+ L       +PE  T +   + I  +   S++
Sbjct: 292 LVRQDTLDRYVYLEHGAHWAIGALAIILLLSIDHRFAVPEWVTASVGVVFIGAAFTESVR 351

Query: 345 NK 346
             
Sbjct: 352 RN 353


>gi|91774403|ref|YP_544159.1| hypothetical protein Mfla_0047 [Methylobacillus flagellatus KT]
 gi|91708390|gb|ABE48318.1| protein of unknown function DUF475 [Methylobacillus flagellatus KT]
          Length = 348

 Score =  315 bits (807), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 126/341 (36%), Positives = 206/341 (60%), Gaps = 5/341 (1%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR++  VT          G+Q    L G    + + +IL ++E+SLSF+NA++NA  
Sbjct: 1   MRDFRYSFFVTFLCLGLAALWGYQSKGGLVGIWPALSVALILGIMEVSLSFDNAVVNASI 60

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++M   W+  FLT GILIAVFG+R++FP+++V   +    ++  ++AI +P  Y   + 
Sbjct: 61  LKEMDEKWRHIFLTVGILIAVFGVRLLFPLLLVAAATDQGLLDVADMAINNPVLYADYLD 120

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  I+ FGG+FL +V L+F  + + +LHW+  LE A   L  ++ IKI ++L I+  +
Sbjct: 121 DGHTAIAAFGGSFLFLVFLSFLLDPEKELHWLGRLEAAFGKLGSLESIKIILILLILLSL 180

Query: 191 SNILP--TNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV---THGKHGLNLFLYLE 245
            N LP    E  + + +  + ++++  I+ L    SS +  +    T  ++G   FLYLE
Sbjct: 181 QNFLPISQAERLTILLAGLSGVVLYVFIDSLSGFFSSQAEGDAFAKTAKRNGAMGFLYLE 240

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           I+DAS S DGVI +FAIT++  II++GLTIGA++VRSMT+ ++ +G L+ Y YLEHG++Y
Sbjct: 241 ILDASFSFDGVIGAFAITRDVVIIMLGLTIGAMFVRSMTVRLVYKGTLDNYVYLEHGAHY 300

Query: 306 SIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +I VL ++MF      +PE+ +G    + I  ++ SSI  K
Sbjct: 301 AIGVLGLVMFYTIYRPVPEVVSGLIGVVFIIAALLSSIFYK 341


>gi|237749072|ref|ZP_04579552.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229380434|gb|EEO30525.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 336

 Score =  314 bits (804), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 127/337 (37%), Positives = 209/337 (62%), Gaps = 10/337 (2%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            S + +F  + +V VA F+ G  I         G  + +     L V+E++LSF+NA++N
Sbjct: 2   KSYLSYFTSSFIVCVAAFVVGYAI---------GGPAAIATIFFLTVLEVALSFDNAVVN 52

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+  S IW++ FL WGI +AVFGMR++FP++IVC+   + P EA+N+AIY P +Y +
Sbjct: 53  AGILKHWSHIWRQHFLLWGIFVAVFGMRLVFPLLIVCVAGHMGPAEALNIAIYLPHEYSR 112

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           I++ AH  ++ FGG FL+MV L+FF       HW+ F+E  ++ L +++ I+  + L  +
Sbjct: 113 IMASAHHEVAAFGGVFLLMVFLSFFVARHKTEHWLAFIEKPLTRLGQMEAIQAALTLITL 172

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH-GLNLFLYLEI 246
             I+  +  +E + F+ +    ++++     + S+LS        H  H G+  FLYLE+
Sbjct: 173 TAITYFVSPDERFEFLLAGMWGLVVYVLTKGVASLLSPHDQQIEQHIVHQGVGGFLYLEL 232

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           IDAS S DGV+ +FA+T N FII +GL  GA++VRS T+L++++G L+ Y+YLEHG++++
Sbjct: 233 IDASFSFDGVLGAFAMTNNLFIIALGLGAGAMFVRSFTILLVEKGTLSHYRYLEHGAFWA 292

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           I  L+++M L  +  +PE  TG    +LI  ++ SSI
Sbjct: 293 IGSLALLMLLGVLFPVPEAITGLLGALLIIAALGSSI 329


>gi|237746918|ref|ZP_04577398.1| predicted protein [Oxalobacter formigenes HOxBLS]
 gi|229378269|gb|EEO28360.1| predicted protein [Oxalobacter formigenes HOxBLS]
          Length = 336

 Score =  312 bits (801), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 131/337 (38%), Positives = 209/337 (62%), Gaps = 10/337 (2%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            S + +F  + +V +   + G          + G  + V     L V+E++LSF+NA++N
Sbjct: 2   KSHLSYFTTSFIVCLLALIAGF---------IIGGTAAVATIFFLTVLEVALSFDNAVVN 52

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+  + +W++ FL WGI IAVFGMR++FP+ IV +V+ INPIEA+N+A+Y P+ Y +
Sbjct: 53  AGVLKNWNHLWRQHFLIWGIFIAVFGMRLVFPLAIVSVVAHINPIEAVNVALYRPEIYSR 112

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +++ AH  ++ FGG FLMMV L+FF       HW+ F+E  ++ L +++ I+  + L  +
Sbjct: 113 LMAAAHHQVAAFGGVFLMMVFLSFFVARHKTEHWLAFIEKPLTRLGQMEAIQAALTLITL 172

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH-GLNLFLYLEI 246
              S  +  +E + F+ +    +I++     + S+LS   ++   H  H G+  FLYLE+
Sbjct: 173 TMFSYFVSQSERFEFLLAGMWGLIVYVLTKGIASLLSPHDAHIEQHVVHQGVGGFLYLEL 232

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           IDAS S DGV+ +FA+T N FII +GL  GA++VRS T+L++++G LN Y+YLEHG++++
Sbjct: 233 IDASFSFDGVLGAFAMTNNLFIIALGLGAGAMFVRSFTVLLVEKGTLNHYRYLEHGAFWA 292

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           I  L+ +M L  I  IPE  TG    ILI  S+ SSI
Sbjct: 293 IGSLAFLMLLGVIFAIPEAITGLLGAILILASLGSSI 329


>gi|90409338|ref|ZP_01217428.1| hypothetical protein PCNPT3_06878 [Psychromonas sp. CNPT3]
 gi|90309556|gb|EAS37751.1| hypothetical protein PCNPT3_06878 [Psychromonas sp. CNPT3]
          Length = 344

 Score =  312 bits (799), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 140/340 (41%), Positives = 212/340 (62%), Gaps = 16/340 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR + LVT  G L G  I         G    +++  +L+V+EISLSF+NA++NA  
Sbjct: 4   LRFFRGSFLVTFIGALLGYLI---------GGFEALFLIFVLSVLEISLSFDNAVVNATV 54

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+KM ++W+KRFLTWGILI+VFGMR+IFP+ +V +V+ ++P  A+ +AI SP  Y  ++ 
Sbjct: 55  LKKMDALWRKRFLTWGILISVFGMRVIFPVAVVSVVAGVSPWSAILIAINSPSQYQVLMQ 114

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK-GIKIFIVLSIIFG 189
            AH+ + GFGG+FL++V L FF N     HWI  +E  + H+ K+K    IF VL I+  
Sbjct: 115 SAHISLMGFGGSFLLLVGLDFFLNEDKTEHWIGIIERPLLHIGKLKFSAPIFTVLGILLI 174

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN------NVTHGKHGLNLFLY 243
               LP  + YSF++S  + I+ F  I+ + + +             V   K  L +FLY
Sbjct: 175 AGLYLPDADQYSFIASGASGIVAFTLIHKISAQMEKREDRRASCNGTVVVAKSSLGMFLY 234

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           LE++DAS S DGVI +FAIT N  II  GL IGA++VRS+T++ ++  +L +Y+YL+HG+
Sbjct: 235 LELLDASFSFDGVIGAFAITTNLLIIATGLGIGAMFVRSLTIMFVENNVLEEYQYLQHGA 294

Query: 304 YYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +Y++  L++IMFL+T + +PEI TG      I L+   S+
Sbjct: 295 FYAVIALAIIMFLKTFIHVPEILTGLIGAGFIALAFIHSL 334


>gi|56552674|ref|YP_163513.1| hypothetical protein ZMO1778 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|4378178|gb|AAD19423.1| unknown [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56544248|gb|AAV90402.1| protein of unknown function DUF475 [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 339

 Score =  310 bits (794), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 124/339 (36%), Positives = 206/339 (60%), Gaps = 7/339 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGW-QFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           ++ HFR + LVT+ G +     G+    H L   ++  ++  +LA++E + SF+NA++NA
Sbjct: 1   MLKHFRASFLVTILGLITAFIFGYYAQGHHLISGLNAAFLAFLLAILETAFSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ ++  WQK FLTWG+++AVFGMRI+FP++IV   + ++P EA  +A+++   Y ++
Sbjct: 61  SVLKNLTPKWQKCFLTWGMIVAVFGMRILFPLLIVSFSAWVDPWEATKIALFNHARYEEV 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+GFG  FLM+V L+FF   ++   WI ++E  +  L  I  I   +   I+ 
Sbjct: 121 VTAAHASIAGFGSAFLMLVGLSFFVKEEHSPIWISWIEKPLMALRVIPFISYILTFLIMA 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
           G +      + YSF  ++   +  ++ +   E  +        T GK GL  F+YLE +D
Sbjct: 181 GFAFWFDQKDSYSFSVAALFGMAAYFLLEQFERFMGKP-----TPGKAGLATFIYLEFLD 235

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T +  +I IGL IGA++VRSMT+ +++ G L++Y YLE G++Y+I 
Sbjct: 236 ASFSFDGVIGAFAVTNDIVLIAIGLGIGAMFVRSMTVALVQGGHLSQYPYLEAGAFYAIV 295

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSI-YSSIKNK 346
            L+ I  L   +++PEI +G S  + I  S+ YS I+N+
Sbjct: 296 TLAFITALNVRIEVPEIISGLSGLVWIGGSLVYSMIENR 334


>gi|260753678|ref|YP_003226571.1| hypothetical protein Za10_1449 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258553041|gb|ACV75987.1| protein of unknown function DUF475 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 339

 Score =  309 bits (792), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 124/339 (36%), Positives = 205/339 (60%), Gaps = 7/339 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGW-QFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           ++ HFR + LVT+ G +     G+    H L   +   ++  +LA++E + SF+NA++NA
Sbjct: 1   MLKHFRASFLVTILGLITAFIFGYYAQGHHLISGLDAAFLAFLLAILETAFSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ ++  WQK FLTWG+++AVFGMRI+FP++IV   + ++P EA  +A+++   Y ++
Sbjct: 61  SVLKNLTPKWQKCFLTWGMIVAVFGMRILFPLLIVSFSAWVDPWEATKIALFNHARYEEV 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+GFG  FLM+V L+FF   ++   WI ++E  +  L  I  I   +   I+ 
Sbjct: 121 VTAAHASIAGFGSAFLMLVGLSFFVKEEHSPIWISWIEKPLMALRVIPFISYILTFLIMA 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
           G +      + YSF  ++   +  ++ +   E  +        T GK GL  F+YLE +D
Sbjct: 181 GFAFWFDQKDGYSFSVAALFGMAAYFLLEQFERFMGKP-----TPGKAGLATFIYLEFLD 235

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T +  +I IGL IGA++VRSMT+ +++ G L++Y YLE G++Y+I 
Sbjct: 236 ASFSFDGVIGAFAVTNDIVLIAIGLGIGAMFVRSMTVALVQGGHLSQYPYLEAGAFYAIV 295

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSI-YSSIKNK 346
            L+ I  L   +++PEI +G S  + I  S+ YS I+N+
Sbjct: 296 TLAFITALNVRIEVPEIISGLSGLVWIGGSLVYSMIENR 334


>gi|262202415|ref|YP_003273623.1| hypothetical protein Gbro_2489 [Gordonia bronchialis DSM 43247]
 gi|262085762|gb|ACY21730.1| protein of unknown function DUF475 [Gordonia bronchialis DSM 43247]
          Length = 374

 Score =  308 bits (790), Expect = 8e-82,   Method: Composition-based stats.
 Identities = 114/368 (30%), Positives = 190/368 (51%), Gaps = 41/368 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
            I  F  + +VT+                     + + +C IL V+E+SLSF+NA++NA 
Sbjct: 2   TIRIFGLSAVVTLLALAVAFAYR---------GWTGLALCAILGVLEVSLSFDNAVINAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------- 122
            L++MS  WQ+ FLT G++IAVFGMR+ FP+ IV + + ++P +A  LA+  P       
Sbjct: 53  ILERMSEFWQRMFLTVGVIIAVFGMRLFFPLAIVWVTAGLDPADAFRLAMNPPADGSEYF 112

Query: 123 ----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG- 177
                 Y  I+  A+  I+ FGG   +++    F  S  +  W+ + E  ++ L K+   
Sbjct: 113 ADGSPSYETILHDANPQIAAFGGM-FLLLLFLNFVLSDRENTWLTWFERPLAALGKLDQL 171

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN-------- 229
             +    +++     +   ++  + + +    II +  ++ L S+ +    +        
Sbjct: 172 AVVIAAAALLAVAQFLAAEDKRATVLVAGLLGIITYILVDGLSSLFAGQGHDRAAGSGDG 231

Query: 230 ----------NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAI 278
                         GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL  IGA+
Sbjct: 232 SGGATGPTAVTRATGKAGFFLFLYLEVLDASFSFDGVIGAFAITPDPIIIALGLGFIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           +VRS+T+ ++++G L +Y+YLEHG++++I  L+VI+     V IPEI TG      I  +
Sbjct: 292 FVRSITIFLVRKGTLAEYRYLEHGAHWAIGALAVILLTSVKVHIPEIITGLIGVAFIGAA 351

Query: 339 IYSSIKNK 346
           + SSI+  
Sbjct: 352 LLSSIRAN 359


>gi|257461093|ref|ZP_05626191.1| integral membrane protein [Campylobacter gracilis RM3268]
 gi|257441467|gb|EEV16612.1| integral membrane protein [Campylobacter gracilis RM3268]
          Length = 336

 Score =  307 bits (787), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 126/336 (37%), Positives = 196/336 (58%), Gaps = 16/336 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  +  V+    +    I         G     YIC++L V+EISLSF+NA++NAK 
Sbjct: 1   MKYFYSSFAVSFIAVIIAFYI---------GGAGAAYICVLLCVLEISLSFDNAVVNAKV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M+ +WQ RF+ WGI IAVFGMR +FP++IV   + +   E + LA+  PQ Y +I+S
Sbjct: 52  LKDMAPVWQSRFILWGIPIAVFGMRFLFPVLIVAASAHLGLWETLVLALKQPQRYHEILS 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +    I  FGG FL+MV   FFF++Q +LHW+  +E     +  +K I     L  +   
Sbjct: 112 ENEAQIYVFGGAFLLMVFCDFFFDAQRELHWLGIIE-NNGLVRFLKRIPNAPTLIALAAG 170

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
             +L      +  ++   AI+++  I+  + +  +D        K+GL  FLYLE +DAS
Sbjct: 171 LVLLAKTGSATLGAAYFGAILLYLLISCFDRLFGTDGV------KNGLAGFLYLETLDAS 224

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA++ N FII++GL  GA++VRS+TL ++ +G L+ + YLEHG++Y+I  L
Sbjct: 225 FSFDGVIGAFALSDNIFIIMLGLGAGAMFVRSITLYLIARGTLSHFAYLEHGAHYAIACL 284

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           + IMF +   ++ EI TGT   + I LS+ SS+   
Sbjct: 285 AFIMFAKLKFEVSEIITGTVGILFIALSLLSSVLYN 320


>gi|296166693|ref|ZP_06849118.1| integral membrane protein [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295897958|gb|EFG77539.1| integral membrane protein [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 358

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 111/345 (32%), Positives = 199/345 (57%), Gaps = 21/345 (6%)

Query: 22  VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR 81
           + G    L +         G ++ + + + LA++EISLSF+NAI+NA  L++MS  W++ 
Sbjct: 6   IFGISLLLTVAALVLGYAHGGLNALLLLLALALLEISLSFDNAIINAAILKQMSPFWRQM 65

Query: 82  FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP-----------QDYLKIIS 130
           FLT G+L+AVFGMR++FP++IV + + ++P+ AM LA++ P             Y K+I 
Sbjct: 66  FLTIGVLVAVFGMRLLFPLLIVWVTAGLDPVRAMELALHPPPNGALEFPDGSPSYEKLIG 125

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG--IKIFIVLSIIF 188
            AH  I+ FGGTFL+M+ L F F     + W+ ++E+  + + ++    + + +V  ++ 
Sbjct: 126 AAHPQIAAFGGTFLLMLFLDFVF-HDRDIKWLKWIEVPFARIGRLGQVSVAVTVVALVVV 184

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD----SSNNVTHGKHGLNLFLYL 244
           G+       E  + +++    ++ +  +N L           + +    GK GL LFLYL
Sbjct: 185 GMRLTHSGEERATVLTAGLLGLVTYLVVNGLSRAFRPPHIEAAGDGEAVGKAGLTLFLYL 244

Query: 245 EIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           E++DA+ S DGV  +FAIT +  +I +GL  +G+++VRS+T+ ++KQ  L++Y YLEHG+
Sbjct: 245 EVLDAAFSFDGVTGAFAITSDPIVIALGLGLVGSMFVRSITIFLVKQDALDRYVYLEHGA 304

Query: 304 YYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +++I VL+VIM +      ++P+  T +   + I  ++  S+   
Sbjct: 305 HWAIGVLAVIMLVSIEPRFEVPDPVTASVGVVFIGAALGWSVLRN 349


>gi|241762087|ref|ZP_04760170.1| protein of unknown function DUF475 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373337|gb|EER62937.1| protein of unknown function DUF475 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 339

 Score =  306 bits (785), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 122/339 (35%), Positives = 203/339 (59%), Gaps = 7/339 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGW-QFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           ++ HF  + LVT+ G +     G+    H L   +   ++  +LA++E + SF+NA++NA
Sbjct: 1   MLKHFWASFLVTILGLITAFIFGYYAQGHHLMSGLDAAFLAFLLAILETAFSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ ++  WQK FLTWG+++AVFGMRI+FP++IV   + ++P EA  +A+++   Y ++
Sbjct: 61  SILKNLTPKWQKCFLTWGMIVAVFGMRILFPLLIVSFSAWVDPWEATKIALFNHARYEEV 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+GFG  FLM+V L+FF   ++   WI ++E  +  L  I  I   +   I+ 
Sbjct: 121 VTAAHASIAGFGSAFLMLVGLSFFVKEEHSPIWISWIEKPLMALRVIPFISYILTFLIMA 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
           G +      + YSF  ++   +  ++ +   E  +        T GK GL  F+YLE +D
Sbjct: 181 GFAFWFDQKDGYSFSVAALFGMAAYFLLEQFERFMGKP-----TPGKAGLATFIYLEFLD 235

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T +  +I IGL IGA++VRSMT+ +++ G L++Y YLE G++Y+I 
Sbjct: 236 ASFSFDGVIGAFAVTNDIVLIAIGLGIGAMFVRSMTVALVQGGHLSQYPYLEAGAFYAIV 295

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSI-YSSIKNK 346
            L+ I  L   +++PEI +  S  + I  S+ YS I+N+
Sbjct: 296 TLAFITALNVRIEVPEIISCLSGLVWIGGSLVYSMIENR 334


>gi|240172428|ref|ZP_04751087.1| hypothetical protein MkanA1_24140 [Mycobacterium kansasii ATCC
           12478]
          Length = 355

 Score =  302 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 118/359 (32%), Positives = 197/359 (54%), Gaps = 31/359 (8%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           + I  F  ++L T      G            G  + +++ ++LAV+E+SLSF+NAI+NA
Sbjct: 2   TTIRIFGLSLLFTTGALAIGYW---------HGGPTALFLLVVLAVLEVSLSFDNAIINA 52

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------ 122
             L++MS  WQ+ FLT GILIAVFGMR++FP+ IV + + ++P+ AM+LA+  P      
Sbjct: 53  AILKQMSRFWQQMFLTVGILIAVFGMRLVFPLAIVWVTAGLDPVHAMDLALNPPPNGALE 112

Query: 123 -----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                  Y K+I  AH  I+ FGG FL+M+ L F F     + W+ ++E   + + ++  
Sbjct: 113 FPDGSPSYEKLIKAAHPQIAAFGGMFLLMLFLDFVF-HDRDIKWLKWIEAPFARVGRLGQ 171

Query: 178 --IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS-----SNN 230
             + +  V  ++ G       +E  + + +    ++I+  +N L                
Sbjct: 172 VPVVVACVALVLVGTELTHSGDERANVLIAGLLGLVIYLVVNGLSRAFRPPEAAADVGGA 231

Query: 231 VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLK 289
              GK G  LFLYLE++DAS S DGV  +FAIT +  II +GL  +GA++VRS+T+ +++
Sbjct: 232 GAVGKAGFTLFLYLEVLDASFSFDGVTGAFAITSDPIIIALGLGLVGAMFVRSITIYLVR 291

Query: 290 QGILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           Q  L++Y YLEHG++++I  L+VIM +     + +PE  T +   + I  ++ +S+   
Sbjct: 292 QETLDRYVYLEHGAHWAIGALAVIMLISVNHRLQLPEWITASIGVVFIAAAVTNSVLRN 350


>gi|34498819|ref|NP_903034.1| hypothetical protein CV_3364 [Chromobacterium violaceum ATCC 12472]
 gi|34104671|gb|AAQ61028.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 370

 Score =  302 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 111/340 (32%), Positives = 202/340 (59%), Gaps = 3/340 (0%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            S   +FR +++ +VA        G           + +    +LAV+E S+SF+NA++N
Sbjct: 30  PSTFSYFRGSLIFSVAVLAAVAWYGHMRGGAELAG-AFLLTTAVLAVLETSVSFDNAVVN 88

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+ MS  W++ F+T GI +AVFGMR++FP++IV     ++  EA  +A   P+ Y +
Sbjct: 89  ATVLKAMSHRWRQVFMTVGIAVAVFGMRVLFPLLIVSTAGGVSLAEAFAVATRQPERYQQ 148

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           I+  +H+ I GFG TFL+MV + +F   +   HW+  +E  ++ L  ++  +  + + ++
Sbjct: 149 IMHDSHLMIMGFGATFLLMVVIEYFVQHEKDEHWLPGIEPLLAKLGSVENAQSLVTILVV 208

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
             I+ +LP  +  +F+SS     ++F  ++  + +            K+GL  F+YLE++
Sbjct: 209 AAIAALLPAGQKMAFISSCFWGYVVFMVLHMFKQLFGGVDIQT-AAAKNGLIGFVYLEVL 267

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S+DGVI++FAIT +F++I  GL IGA++VRS+TL ++++ +++++KYLE  ++++I
Sbjct: 268 DASFSMDGVIAAFAITNDFWLIAAGLGIGAMFVRSLTLYLVERDVMSQFKYLEVSAFWAI 327

Query: 308 FVLSVIMF-LQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L  IMF     V++ E+ TG  S  +I L + +S+ ++
Sbjct: 328 AALVAIMFAAALHVELGEVATGLISVAIIGLGVLTSLPSR 367


>gi|71901998|ref|ZP_00684045.1| Protein of unknown function DUF475 [Xylella fastidiosa Ann-1]
 gi|71728243|gb|EAO30427.1| Protein of unknown function DUF475 [Xylella fastidiosa Ann-1]
          Length = 311

 Score =  302 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 112/314 (35%), Positives = 197/314 (62%), Gaps = 6/314 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T          G+    T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFTAFCLSLAAWWGYS---TALGVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GILIAVFGMR++FPI+IV + + +  I  M LA+  P+ Y  ++
Sbjct: 58  ILKHMSEFWRKLFLTIGILIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSLVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   + + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAMAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIV 320
           I VL+VIM +   +
Sbjct: 298 IGVLAVIMLVVPYI 311


>gi|237749821|ref|ZP_04580301.1| integral membrane protein [Helicobacter bilis ATCC 43879]
 gi|229374571|gb|EEO24962.1| integral membrane protein [Helicobacter bilis ATCC 43879]
          Length = 324

 Score =  301 bits (772), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 130/332 (39%), Positives = 203/332 (61%), Gaps = 16/332 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF  + +VT+ G +    +         G    +YICI+L+++E+SLSF+NA++NAK 
Sbjct: 1   MKHFYSSFVVTLIGLVLAFYV---------GAWQAIYICILLSILEVSLSFDNAVVNAKV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L  M   WQKRF+ WGI IAVFGMR IFPI+IV + + +  +E +NLA+YSPQ+Y K + 
Sbjct: 52  LDTMDIKWQKRFIYWGIPIAVFGMRFIFPIVIVAVAARLGMLETLNLALYSPQEYHKTLE 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +    I  FG  FL+MV L FFF+   ++HW+ F+E  +     +K     ++L+I  GI
Sbjct: 112 ETRFEIYAFGAGFLLMVCLQFFFSEDKEVHWLSFIEDNVIMRFFMKFPNFALLLAITLGI 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
             +  T+ +     +   AI+++  I+  +  L +         ++GL  FLYLE++DAS
Sbjct: 172 ILLALTDNIL-VGMAYFCAIVLYLIIHSADKFLGA------GGVRNGLMGFLYLEVLDAS 224

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+++N FII+IGL IGA++VRS+TL +++   L K  YLEHG++Y+I  L
Sbjct: 225 FSFDGVIGAFALSENIFIIMIGLGIGAMFVRSLTLYLVEHKTLQKLIYLEHGAHYAIGAL 284

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           ++IM L+  +++ EI TG      I ++   S
Sbjct: 285 AIIMLLKIFMEVSEIITGLIGVGFIGIAFICS 316


>gi|224372322|ref|YP_002606694.1| hypothetical protein NAMH_0271 [Nautilia profundicola AmH]
 gi|223588816|gb|ACM92552.1| integral membrane protein [Nautilia profundicola AmH]
          Length = 318

 Score =  301 bits (772), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 126/332 (37%), Positives = 200/332 (60%), Gaps = 19/332 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + ++   G +    I            S VY+  ILA++E+SLSF+NA++NAK 
Sbjct: 1   MRYFYVSFIIAAIGLILSFFID---------GWSAVYLTSILAILEVSLSFDNAVVNAKI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M  IW+KRFLTWG++IAVFGMR IFPI+IV + + +  +E +N+AI  P+ Y +++ 
Sbjct: 52  LKDMDKIWEKRFLTWGMVIAVFGMRFIFPILIVAVAANLGVVETLNIAINHPEQYHEVLL 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           ++   I  FGG FL +V   F F    ++ WI  +E     L ++  I + +   I   +
Sbjct: 112 KSENLIYAFGGAFLWLVFTDFLF-EHKEIRWIKPVERYAEKLGRVNNISLIVATVIGIIV 170

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
              +  ++ Y    +    ++ +  +N +    + +        K+GL  FLYLEI+DAS
Sbjct: 171 ---IYDSKSYEIGIAYLLGMLTYSLLNGINEAFAVE------GAKNGLMGFLYLEILDAS 221

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FAIT N FII+IGL IGA++VRS+T+ M+++G+L++YKYLEHG++Y+I VL
Sbjct: 222 FSFDGVIGAFAITGNIFIIMIGLGIGAMFVRSLTIWMVEKGVLSEYKYLEHGAHYAIGVL 281

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           +VIM L+  + I E+ TGT    L+ ++   S
Sbjct: 282 AVIMLLKIFMHIGEVLTGTIGLGLLAIAFLHS 313


>gi|125624168|ref|YP_001032651.1| hypothetical protein llmg_1349 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|124492976|emb|CAL97939.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300070945|gb|ADJ60345.1| hypothetical protein LLNZ_06975 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 356

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 117/331 (35%), Positives = 190/331 (57%), Gaps = 25/331 (7%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           + G +  + +  IL ++E+SLSF+NAI+NA+ L++MS  W+  FLT G+LIAV GMR IF
Sbjct: 20  VYGGVDALILATILGIMEVSLSFDNAIVNARILERMSHRWRNIFLTVGMLIAVLGMRFIF 79

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQD-----YLKIISQAHVPISGFGGTFLMMVSLTFFF 153
           P+ +V + + ++P++A++LA+          Y  I+  AH  I+ FGG FL+M++L FFF
Sbjct: 80  PLAVVSVSAQMSPMKALHLAMEKGNPETVGTYGYILQHAHPVIAAFGGAFLLMLALNFFF 139

Query: 154 NSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIF 213
           +     HW    E  +  + K       IVL ++  IS  +   + Y    S  A ++++
Sbjct: 140 DEN-DYHWFVLPEKLLFKIGKFPMATPMIVLVVMMVISKWVSG-QSYLVFFSGAAGMVLY 197

Query: 214 YGINFLESVLSSDS-----------------SNNVTHGKHGLNLFLYLEIIDASLSLDGV 256
             +  L +++                      + +  GK    LFLYLE+IDAS S DG 
Sbjct: 198 MAVEGLGNLMEHHGTLAEVAEEIENDEPLIAQSILATGKQAFVLFLYLEMIDASFSFDGA 257

Query: 257 ISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF 315
           I +FAIT +  +I++GL  IGA++VRS+T+ ++++G LN + YL+HG++++I  LS+++ 
Sbjct: 258 IGAFAITSDPIVIMLGLGLIGAMFVRSLTVYLVEKGTLNDFVYLDHGAHWAILTLSILLL 317

Query: 316 LQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +   ++IPEI TG    ILI  S  SSI   
Sbjct: 318 VSINIEIPEIVTGLIGAILIGASFLSSIFYN 348


>gi|15827010|ref|NP_301273.1| hypothetical protein ML0205 [Mycobacterium leprae TN]
 gi|221229488|ref|YP_002502904.1| hypothetical protein MLBr_00205 [Mycobacterium leprae Br4923]
 gi|3097236|emb|CAA18813.1| putative membrane protein [Mycobacterium leprae]
 gi|13092557|emb|CAC29713.1| putative membrane protein [Mycobacterium leprae]
 gi|219932595|emb|CAR70298.1| putative membrane protein [Mycobacterium leprae Br4923]
          Length = 356

 Score =  300 bits (768), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 112/357 (31%), Positives = 191/357 (53%), Gaps = 29/357 (8%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +    F  ++L T    L            + G ++++   I+LA+ E+SLSF+NAI+NA
Sbjct: 2   AAFRGFGISLLTTAIALLVAY---------IYGGLASLLPLIVLAIFEVSLSFDNAIINA 52

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------ 122
             L++MS  W+K FLT GILIA FGMR+IFP +IV   + ++P+  M+LA++ P      
Sbjct: 53  AILKQMSRFWRKMFLTIGILIAAFGMRLIFPAVIVWATAKLDPVRTMDLALHPPPNHALE 112

Query: 123 -----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                  Y K+I  AH  I+ FGGTFL+M+ L F F     + W+ ++E   + + ++  
Sbjct: 113 FPDGSPSYQKLIMSAHPQIAAFGGTFLLMLFLDFVF-QDRDIKWLKWIEAPFTRIGRLGP 171

Query: 178 IKIF-IVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS----SNNVT 232
           + +  I + ++   +     +E    + +   +++ +  ++ L            S    
Sbjct: 172 LSVVAIFVLVLIATALTHSGDERAKVLIAGLLSLVTYLLVSVLNRAFRPPDIDTASGRRM 231

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQG 291
            G+ GL  FLYLEI+DA+ S DGV  +FAIT +  II +GL  I ++++RS+T+ ++ Q 
Sbjct: 232 AGRAGLVRFLYLEILDATFSFDGVTGAFAITSDPVIIALGLGLISSVFIRSITIYLVHQD 291

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L++Y YLE+G++++I  LSV+M L      +I E  T     + I  ++  S+   
Sbjct: 292 ALDRYVYLEYGAHWAIGALSVMMLLSVEPRFEILEAVTALVGVLFIGAALTWSVFRN 348


>gi|149194204|ref|ZP_01871302.1| integral membrane protein [Caminibacter mediatlanticus TB-2]
 gi|149136157|gb|EDM24635.1| integral membrane protein [Caminibacter mediatlanticus TB-2]
          Length = 321

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 131/332 (39%), Positives = 204/332 (61%), Gaps = 19/332 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F ++  + + G L    I         G +S +YI  ILA++EISLSF+NA++NAK 
Sbjct: 1   MRYFYFSFFIGIVGILLAFFI---------GGLSAIYITSILALLEISLSFDNAVVNAKI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M  +WQ+RFLTWGILIAVFGMR +FPI+IV + + I  I+ +NLA++ PQ Y +++ 
Sbjct: 52  LKNMDKVWQRRFLTWGILIAVFGMRFVFPILIVSVAANIGIIKTINLALFDPQKYHEVLV 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
                I  FGG FL MV   F F  + ++ WI  +E       ++  I + + + I   +
Sbjct: 112 NVEKLIYAFGGAFLWMVFSDFLF-EEKEVRWIKPIEKTAEKFGRVNNISLIVAMIIGLIV 170

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
              +  ++ Y    +    I+I+  ++ + S LS++        K GL  FLYLE++DAS
Sbjct: 171 ---IYDSKDYKIAIAYFLGILIYSILHGINSALSTE------GAKSGLMGFLYLEVLDAS 221

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FAIT N  II++GL IGA++VRS+T+ M+++G+L++YKYLEHG++Y+I +L
Sbjct: 222 FSFDGVIGAFAITSNILIIMLGLGIGAMFVRSLTIWMVERGVLDEYKYLEHGAHYAIGIL 281

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           +VIM L+    I E  TGT   +L+ ++   S
Sbjct: 282 AVIMLLKIFFHISEEITGTLGLLLLIIAFLHS 313


>gi|41406532|ref|NP_959368.1| hypothetical protein MAP0434 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41394881|gb|AAS02751.1| hypothetical protein MAP_0434 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 359

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 106/357 (29%), Positives = 195/357 (54%), Gaps = 31/357 (8%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F  ++LVT A  + G            G   ++Y+ ++LA +E+SLSF+NA++NA  
Sbjct: 1   MRTFGVSLLVTAAALVLGYAY---------GGPKSLYLLLVLAALEVSLSFDNAVINAAV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP-------- 122
           L++MS  WQ+ FLT GIL+AVFGMR++FP++IV   + ++P+ A+ LA+  P        
Sbjct: 52  LKQMSRFWQRMFLTIGILVAVFGMRLLFPLLIVWATAGLDPVRALELALRPPPHGALEFP 111

Query: 123 ---QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                Y K+++ AH  I+ FGG   +++    F      + W+ ++E+  + + ++  + 
Sbjct: 112 DGSPSYQKLLTAAHPQIAAFGGI-FLLMLFLDFLLIDRDIKWLKWIEVPFARIGRLGQVS 170

Query: 180 IFI--VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVL-----SSDSSNNVT 232
           + +  +  ++ G      + E  + +++    ++ +  +N L                  
Sbjct: 171 VVLSGLTLVLVGTGLTHSSQEAVTVLTAGLLGMVAYLVVNGLSRAFRPSGVGQPQPAGPA 230

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQG 291
            G  GL+LFLYLE++DA+ S DGV  +FAIT +  +IV+GL  +G+++VRS+T+ ++ Q 
Sbjct: 231 TGWAGLSLFLYLEVLDAAFSFDGVTGAFAITSDPVVIVLGLGAVGSMFVRSITIYLVHQE 290

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L++Y YLEHG++++I  L+VIM       + +PE  T +     I  ++  S+  +
Sbjct: 291 TLDRYVYLEHGAHWAIGALAVIMLASIEPRLTVPEPVTASVGVFFIGTAVGFSVLRR 347


>gi|125624286|ref|YP_001032769.1| hypothetical protein llmg_1480 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|124493094|emb|CAL98058.1| putative membrane protein [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300071068|gb|ADJ60468.1| hypothetical protein LLNZ_07620 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 339

 Score =  298 bits (763), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 128/347 (36%), Positives = 201/347 (57%), Gaps = 22/347 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR +I+V++   +            + G  + ++I +ILAV+EISLS +NAI+NA+ 
Sbjct: 1   MKIFRGSIIVSLIALIIAF---------IYGGWNGLFITLILAVLEISLSMDNAIVNARI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD-----Y 125
           L++MS  WQK FLT G+LIAV GMR++FP++IV + + I+PI A+ LA+          Y
Sbjct: 52  LERMSPAWQKTFLTLGVLIAVVGMRLVFPLLIVGVSAQIDPISALRLALEKGNPSTAGTY 111

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
             I+  AH  I+ FGG FL+M++L FFF+ +    W+   E  +  +         I + 
Sbjct: 112 GYILHHAHPQIAAFGGMFLLMLALGFFFD-ERAHTWLKLPEKFLQKIGHFPAANAIISII 170

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-----VTHGKHGLNL 240
           I+   S  +   E ++ + +    I+ F  ++     +S   +       V  GK GL L
Sbjct: 171 ILLITSEFIA-KESHAVLFAGILGILTFMLVDGFGETMSHSKAATSTDFVVATGKAGLAL 229

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYL 299
           FLYLE+IDAS S DGVI +FAIT +  II++GL  IGA++VRS+TL ++++G LN   YL
Sbjct: 230 FLYLEVIDASFSFDGVIGAFAITADPIIILLGLGVIGAMFVRSLTLYLVQKGTLNDLVYL 289

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           EHG++++I  L+ ++ +    +I E+ TG +  ILI LS  SS+   
Sbjct: 290 EHGAHWAILTLAFLILVSIKWEIGEVVTGLTGAILIILSFVSSVIYN 336


>gi|326383858|ref|ZP_08205542.1| hypothetical protein SCNU_13023 [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326197317|gb|EGD54507.1| hypothetical protein SCNU_13023 [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 351

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 114/350 (32%), Positives = 203/350 (58%), Gaps = 23/350 (6%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
            +  F  + +V++A  +            L G  + + + +IL V+E+SLSF+NA++NA 
Sbjct: 2   TLRVFGMSFVVSIAALIAAF---------LYGGTTAMVLTLILGVLEVSLSFDNAVINAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP----QDY 125
            L +MS  WQK FLT G++IAVFGMR++FP+MIV + + +NP++A++LA+  P      Y
Sbjct: 53  VLARMSEFWQKMFLTVGVIIAVFGMRLLFPLMIVWVTAGLNPVDALDLALNPPTDGSPTY 112

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
             I++ AH  I+ FG    +++    F     +L W+ ++E  +    K++GI + + LS
Sbjct: 113 ESIVTAAHPQIASFG-GMFLLMLFLGFLFEDRELTWLSWIERPLQRAGKLRGISVVVALS 171

Query: 186 IIFGISNIL-PTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV-------THGKHG 237
           ++   +  + P +E  + + S    +I +  +N    +   +  ++          G+ G
Sbjct: 172 LLVLTATYIAPDDETSTVMISGALGLITYIVVNGFGELFHVEEESSGGPSGLVKATGRAG 231

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKY 296
             LFLYLE++DAS S DGVI +FAIT +  II +GL  IGA++VRS+T+ ++ +G L++Y
Sbjct: 232 FFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGLGLIGAMFVRSITIYLVHRGTLSEY 291

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            +LEHG++++I  L++I+      D+PE+ TG +    I  ++ +S+  +
Sbjct: 292 VFLEHGAHWAIGALALILLYSLGTDVPELVTGLTGLCFILAALATSLWYR 341


>gi|116511931|ref|YP_809147.1| hypothetical protein LACR_1193 [Lactococcus lactis subsp. cremoris
           SK11]
 gi|116107585|gb|ABJ72725.1| hypothetical protein LACR_1193 [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 339

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 128/347 (36%), Positives = 201/347 (57%), Gaps = 22/347 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR +I+V++   +            + G  + ++I +ILAV+EISLS +NAI+NA+ 
Sbjct: 1   MKIFRGSIIVSLIALIIAF---------IYGGWNGLFITLILAVLEISLSMDNAIVNARI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD-----Y 125
           L++MS  WQK FLT G+LIAV GMR++FP++IV + + I+PI A+ LA+          Y
Sbjct: 52  LERMSPAWQKTFLTLGVLIAVVGMRLVFPLLIVGVSAQIDPISALRLALEKGNPSTAGTY 111

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
             I+  AH  I+ FGG FL+M++L FFF+      W+   E  +  +         I + 
Sbjct: 112 GYILHHAHPQIAAFGGMFLLMLALGFFFDD-RAHTWLKLPEKFLQKIGHFPAANAIISII 170

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH-----GKHGLNL 240
           I+   S  +  +  ++ + +    I+ F  ++     +S   +   TH     GK GL L
Sbjct: 171 ILLITSEFIAKD-SHAVLFAGILGILTFMLVDGFGETMSHSKAATSTHFVVATGKAGLAL 229

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYL 299
           FLYLE+IDAS S DGVI +FAIT +  II++GL  IGA++VRS+TL ++++G LN   YL
Sbjct: 230 FLYLEVIDASFSFDGVIGAFAITADPIIILLGLGVIGAMFVRSLTLYLVQKGTLNDLVYL 289

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           EHG++++I  L+ ++ +    +I E+ TG +  ILI LS  SS+   
Sbjct: 290 EHGAHWAILTLAFLILVSIKWEIGEVVTGLTGAILIILSFVSSVIYN 336


>gi|300744120|ref|ZP_07073139.1| integral membrane protein [Rothia dentocariosa M567]
 gi|300379845|gb|EFJ76409.1| integral membrane protein [Rothia dentocariosa M567]
          Length = 365

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 123/353 (34%), Positives = 201/353 (56%), Gaps = 24/353 (6%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+  F++ +L+T+A       IG  F   + G +S      IL V+EI  SF+NA +NA
Sbjct: 2   ALLKFFKYDLLITLAAL-----IGAAFYGGIVGMVSA----AILIVLEIVFSFDNAGVNA 52

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQ 123
           K L KMS  W+  FLT G+L+AVFGMR+IFP +IVC+   + P+EA NLA+     ++P 
Sbjct: 53  KYLDKMSHAWRNIFLTVGVLVAVFGMRLIFPFLIVCLAGNVGPVEAWNLAMERGDPHTPG 112

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV 183
            Y  I+  AH  I+ FGG FL+M+ L+F F +   +HW+  +E  ++       + + + 
Sbjct: 113 TYGYILESAHHTIASFGGMFLLMLFLSFLFEAGKDVHWLSVIEKPLAKAGHFDSMPVLVS 172

Query: 184 LSIIFGISNILPTNE--MYSFVSSSTAAIIIFYGINFLESVLSSDSSNN--------VTH 233
             I+   S +        Y+ + S    ++ F   N L + +   + +         V  
Sbjct: 173 GVILVTASQLFGAEHHEQYTILLSGLLGMLTFLATNGLATFMEDRNESQEESLANVAVLT 232

Query: 234 GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
           GK   ++F++LE++DAS S DGV+ +FA+T +  II IGL +GA++VRSMT+ ++++G L
Sbjct: 233 GKAAFSMFIFLEVLDASFSFDGVLGAFAVTSDPIIIAIGLGVGALFVRSMTIYLVEKGTL 292

Query: 294 NKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            + +YL+HG++++I VL++++      DIP+   G S  + I  SI SS K  
Sbjct: 293 QELRYLDHGAHWAIGVLALMLLATLKWDIPDYVIGLSGIVFIAGSIISSRKAN 345


>gi|254819880|ref|ZP_05224881.1| hypothetical protein MintA_08144 [Mycobacterium intracellulare ATCC
           13950]
          Length = 356

 Score =  296 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 111/340 (32%), Positives = 194/340 (57%), Gaps = 21/340 (6%)

Query: 22  VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR 81
           V G    L +         G +  +++ ++LAV+E+SLSF+NAI+NA  L++MS  W++ 
Sbjct: 6   VFGVSLLLTVVALVLGYAHGGLEDLFLLLVLAVLEVSLSFDNAIINAAILKRMSPFWRQM 65

Query: 82  FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP-----------QDYLKIIS 130
           FLT GI+IAVFGMR++FP++IV   + I P+ AM LA++ P             Y K+I 
Sbjct: 66  FLTVGIVIAVFGMRLLFPLVIVWATAGIGPVRAMELALHPPPNGALEFADGSPSYEKMIL 125

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS--IIF 188
            AH  I+ FGG FL+M+ L F F     + W+ ++E+  + + ++  + + +  +  ++ 
Sbjct: 126 SAHPQIAAFGGMFLLMLFLDFVF-HDRDIKWLKWIEVPFARIGRLGQVSVVVAGATLVLV 184

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVT----HGKHGLNLFLYL 244
           G       +E  + +++    ++ +  +N L       +   +T     G+ G  LFLYL
Sbjct: 185 GSRLTHSADERATVLTAGVLGLVTYLVVNGLSRAFRPANVEGMTVGEAVGRAGFTLFLYL 244

Query: 245 EIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           E++DA+ S DGV  +FAIT +  +I +GL  IG+++VRS+T+ ++KQ  L++Y YLEHG+
Sbjct: 245 EVLDAAFSFDGVTGAFAITSDPIVIALGLGLIGSMFVRSITIYLVKQETLDRYVYLEHGA 304

Query: 304 YYSIFVLSVIMF--LQTIVDIPEIFTGTSSTILIFLSIYS 341
           +++I  L+VIM   +   + +PE  T +   + I  ++  
Sbjct: 305 HWAIGALAVIMLGSIDPGLQVPEAVTASVGVVFIGAALGW 344


>gi|281491592|ref|YP_003353572.1| hypothetical protein LLKF_1120 [Lactococcus lactis subsp. lactis
           KF147]
 gi|281375310|gb|ADA64823.1| Hypothetical protein LLKF_1120 [Lactococcus lactis subsp. lactis
           KF147]
          Length = 339

 Score =  296 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 125/347 (36%), Positives = 198/347 (57%), Gaps = 22/347 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR + +V++   +            +    + ++I +ILAV+EISLS +NAI+NA+ 
Sbjct: 1   MKIFRGSFIVSLIALIIAF---------VYAGWNGLFITLILAVLEISLSMDNAIVNARI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD-----Y 125
           L++MSS WQK FLT G+LIAV GMR+IFP++IV + + I+PI A+ LA+          Y
Sbjct: 52  LERMSSAWQKAFLTLGVLIAVLGMRLIFPLLIVGVSAQIDPISALKLALEKGNPNTVGTY 111

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
             I+  AH  I+ FGG FL+M++L FFF+ +    W+   E  +  +         I + 
Sbjct: 112 GYILHHAHPQIAAFGGMFLLMLALGFFFD-ERAHTWLKIPEKILQKIGNFPAANAIISII 170

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-----VTHGKHGLNL 240
           ++   S  +  +  ++ + +    I+ F  ++     +S   + N     V  GK GL L
Sbjct: 171 LLLITSEFIAKD-AHAVLFAGILGILTFMLVDGFGETMSHSKAANTTSSVVATGKAGLAL 229

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYL 299
           FLYLE+IDAS S DGVI +FAIT +  II++GL  IGA++VRS+TL ++++G LN   YL
Sbjct: 230 FLYLEVIDASFSFDGVIGAFAITADPIIILLGLGVIGAMFVRSLTLYLVQKGTLNDLVYL 289

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           EHG++++I  L+ ++      +I E+ TG    + I LS  SS+   
Sbjct: 290 EHGAHWAILTLAFLILASIKWEIGEVVTGLLGAVFIILSFISSVIYN 336


>gi|116512028|ref|YP_809244.1| hypothetical protein LACR_1294 [Lactococcus lactis subsp. cremoris
           SK11]
 gi|116107682|gb|ABJ72822.1| hypothetical protein LACR_1294 [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 355

 Score =  296 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 123/331 (37%), Positives = 193/331 (58%), Gaps = 25/331 (7%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           + G +  + +  IL ++E+SLSF+NAI+NA+ L++MS  W+  FLT G+LIAV GMR IF
Sbjct: 20  VYGGVDALVLATILGIMEVSLSFDNAIVNARILERMSHRWRNIFLTVGMLIAVLGMRFIF 79

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQD-----YLKIISQAHVPISGFGGTFLMMVSLTFFF 153
           P+ +V I + ++P+EA++LA+          Y  I+  AH  I+ FGG FL+M++L FFF
Sbjct: 80  PLAVVSISAQLSPLEALHLAMEKGDPETIGTYGYILQHAHPMIAAFGGAFLLMLALNFFF 139

Query: 154 NSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIF 213
           +     HWI   E  +  + K       IVL ++ GIS  + + + Y    +  A ++++
Sbjct: 140 DEN-DYHWIVIPEKLLFRIGKFPMATPMIVLIVMMGISKWVSS-QSYLIFFAGAAGMVLY 197

Query: 214 YGINFLESVLSSDS-----------------SNNVTHGKHGLNLFLYLEIIDASLSLDGV 256
             +  L S++                        +  GK    LFLYLE+IDAS S DG 
Sbjct: 198 MAVEGLGSLMEHHGTLAEVTEEIENDEPLIAQTVLATGKQAFVLFLYLEMIDASFSFDGA 257

Query: 257 ISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF 315
           I +FAIT +  +I++GL  IGA++VRS+T+ ++++G LN + YL+HG++++I VLSV++ 
Sbjct: 258 IGAFAITSDPIVIMLGLGLIGAMFVRSLTVYLVEKGTLNDFVYLDHGAHWAILVLSVLLL 317

Query: 316 LQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +   V+IPEI TG    ILI  S  SS+   
Sbjct: 318 ISINVEIPEIITGLIGAILIGASFLSSVLYN 348


>gi|311112703|ref|YP_003983925.1| integral membrane protein [Rothia dentocariosa ATCC 17931]
 gi|310944197|gb|ADP40491.1| integral membrane protein [Rothia dentocariosa ATCC 17931]
          Length = 365

 Score =  295 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 123/353 (34%), Positives = 201/353 (56%), Gaps = 24/353 (6%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+  F++ +L+T+A       IG  F   + G +S      IL V+EI  SF+NA +NA
Sbjct: 2   ALLKFFKYDLLITLAAL-----IGAAFYGGIVGMVSA----AILIVLEIVFSFDNAGVNA 52

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQ 123
           K L KMS  W+  FLT G+L+AVFGMR+IFP +IVC+   + P+EA NLA+     ++P 
Sbjct: 53  KYLDKMSHAWRNIFLTVGVLVAVFGMRLIFPFLIVCLAGNVGPVEAWNLAMERGDPHTPG 112

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV 183
            Y  I+  AH  I+ FGG FL+M+ L+F F +   +HW+  +E  ++       + + + 
Sbjct: 113 TYGYILESAHHTIASFGGMFLLMLFLSFLFEAGKDVHWLSVIEKPLAKAGHFDSMPVLVS 172

Query: 184 LSIIFGISNILPTNE--MYSFVSSSTAAIIIFYGINFLESVLSSDSSNN--------VTH 233
             I+   S +        Y+ + S    ++ F   N L + +   + +         V  
Sbjct: 173 GVILVTASQLFGAEHHEQYAILLSGLLGMLTFLATNGLATFMEDRNESQEESLANVAVLT 232

Query: 234 GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
           GK   ++F++LE++DAS S DGV+ +FA+T +  II IGL +GA++VRSMT+ ++++G L
Sbjct: 233 GKAAFSMFIFLEVLDASFSFDGVLGAFAVTSDPIIIAIGLGVGALFVRSMTIYLVEKGTL 292

Query: 294 NKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            + +YL+HG++++I VL++++      DIP+   G S  + I  SI SS K  
Sbjct: 293 QELRYLDHGAHWAIGVLALMLLATLKWDIPDYVIGLSGIVFIAGSIISSRKAN 345


>gi|15673075|ref|NP_267249.1| hypothetical protein L99421 [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12724049|gb|AAK05191.1|AE006341_10 conserved hypothetical protein [Lactococcus lactis subsp. lactis
           Il1403]
 gi|326406643|gb|ADZ63714.1| conserved hypothetical protein [Lactococcus lactis subsp. lactis
           CV56]
          Length = 339

 Score =  294 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 124/347 (35%), Positives = 197/347 (56%), Gaps = 22/347 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR + +V++   +            +    + ++I +ILAV+EISLS +NAI+NA+ 
Sbjct: 1   MKIFRGSFIVSLIALIIAF---------VYAGWNGLFITLILAVLEISLSMDNAIVNARI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD-----Y 125
           L++MS  WQK FLT G+LIAV GMR+IFP++IV + + I+PI A+ LA+          Y
Sbjct: 52  LERMSFAWQKAFLTLGVLIAVLGMRLIFPLLIVGVSAQIDPISALKLALEKGNPNTVGTY 111

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
             I+  AH  I+ FGG FL+M++L FFF+ +    W+   E  +  +         I + 
Sbjct: 112 GYILHHAHPQIAAFGGMFLLMLALGFFFD-ERAHTWLKIPEKILQKIGNFPAANAIISII 170

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-----VTHGKHGLNL 240
           ++   S  +  +  ++ + +    I+ F  ++     +S   + N     V  GK GL L
Sbjct: 171 LLLITSEFIAKD-AHAVLFAGILGILTFMLVDGFGETMSHSKAANTTSSVVATGKAGLAL 229

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYL 299
           FLYLE+IDAS S DGVI +FAIT +  II++GL  IGA++VRS+TL ++++G LN   YL
Sbjct: 230 FLYLEVIDASFSFDGVIGAFAITADPIIILLGLGVIGAMFVRSLTLYLVQKGTLNDLVYL 289

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           EHG++++I  L+ ++      +I E+ TG    + I LS  SS+   
Sbjct: 290 EHGAHWAILTLAFLILASIKWEIGEVVTGLLGAVFIILSFISSVIYN 336


>gi|154148595|ref|YP_001405960.1| integral membrane protein [Campylobacter hominis ATCC BAA-381]
 gi|153804604|gb|ABS51611.1| integral membrane protein [Campylobacter hominis ATCC BAA-381]
          Length = 324

 Score =  294 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 140/336 (41%), Positives = 204/336 (60%), Gaps = 16/336 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + ++T  G L    I         G+ + VYIC +L V+E+SLSF+NA++NAK 
Sbjct: 1   MKYFYLSFVITFLGLLIAFFI---------GSFAAVYICFLLTVLEVSLSFDNAVVNAKI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L  MS IWQ+RF+TWGI IAVFGMR+IFPI+IV I +     E   LA+  P  Y +I+S
Sbjct: 52  LNNMSKIWQRRFITWGIFIAVFGMRLIFPILIVSIATKHGLTETFMLALKDPDLYHEILS 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           ++   I  FGG FLMM+ L FFF+ +  + WI   E  +      K   I + L++I G+
Sbjct: 112 ESKNEIYIFGGGFLMMIFLNFFFDKERDVFWIKPFEKNIITEFFKKFNNISLTLALILGV 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
             I  + +  S + +  +AII++  I   + V S +        ++G+  FLYLE++DAS
Sbjct: 172 FIIYQSGD-ISLILAYFSAIILYNLIQNFDDVFSKNGI------RNGIVGFLYLEMLDAS 224

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+++N FII+IGL  GA++VRSMTL +++   L  + +LEHG++Y+IF L
Sbjct: 225 FSFDGVIGAFALSENIFIIMIGLGSGAMFVRSMTLYLVEHKTLEHFIFLEHGAHYAIFAL 284

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +VIM L+T + I EI TGT     I LS   SI  K
Sbjct: 285 AVIMLLKTQMQISEILTGTLGFGFILLSFLCSIFYK 320


>gi|148927769|ref|ZP_01811201.1| protein of unknown function DUF475 [candidate division TM7
           genomosp. GTL1]
 gi|147886881|gb|EDK72419.1| protein of unknown function DUF475 [candidate division TM7
           genomosp. GTL1]
          Length = 344

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 120/351 (34%), Positives = 202/351 (57%), Gaps = 14/351 (3%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           MK+ S  A+L+  +  A  VT+  +L            L G  + ++  I+L  +E + S
Sbjct: 1   MKNTSSRAALLKIYWLAASVTLLIWLGAA---------LWGGFTALFTVIVLTFLETTFS 51

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
            +NA++N+K L  MS  WQK F+T GI IAVF +R + PI+IV + + +   E + LAI 
Sbjct: 52  ADNAVVNSKVLASMSPRWQKLFMTLGIFIAVFLVRFLVPILIVVLTAGLGSTEVIQLAIN 111

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P  Y + +++A   IS FGGTFL+M++L++F + + + HW+ FLE  +  L +   + I
Sbjct: 112 EPHRYEQELAKAEPIISAFGGTFLLMIALSYFVDYEKQSHWLKFLERRLGKLGRFDDLTI 171

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN----NVTHGKH 236
           F++L    G+   +      + + +S AA+++  G+N LE++   +           G  
Sbjct: 172 FVMLLAALGLFFTVERAYHTAVLIASIAAMVLHIGLNLLEALFEKNKKGLFSIKPKVGGA 231

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
            L  FLYLEI+DAS S DGVI +FAIT +  +I+ GL  GA++VR+MT+ +++   L KY
Sbjct: 232 ALAAFLYLEILDASFSFDGVIGAFAITGSVVLIMAGLGAGAVWVRAMTIHLVRAKALTKY 291

Query: 297 KYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIKNK 346
            +LEHG+++++  L ++M L+   ++ PE F G +  ++I  SI  S + +
Sbjct: 292 VFLEHGAHWALVFLGLVMLLKLYHIEFPEWFVGLAGIVVIAFSIVWSRRWQ 342


>gi|254773497|ref|ZP_05215013.1| hypothetical protein MaviaA2_02300 [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 359

 Score =  287 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 104/357 (29%), Positives = 192/357 (53%), Gaps = 31/357 (8%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F  ++LVT A  + G            G   ++Y+ ++LA +E+SLSF+NA++NA  
Sbjct: 1   MRTFGVSLLVTAAALVLGYAY---------GGPKSLYLLLVLAALEVSLSFDNAVINAAV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP-------- 122
           L++MS  WQ+ FLT GIL+AVFGMR++FP++IV   + ++P+ A+ LA+  P        
Sbjct: 52  LKQMSRFWQRMFLTIGILVAVFGMRLLFPLLIVWATAGLDPVRALELALRPPPHGALEFP 111

Query: 123 ---QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                Y K+++ AH  I+ FGG   +++    F      + W+ ++E+  + + ++  + 
Sbjct: 112 DGSPSYQKLLTAAHPQIAAFGGI-FLLMLFLDFLLIDRDIKWLKWIEVPFARIGRLGQVS 170

Query: 180 IFI--VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVL-----SSDSSNNVT 232
           + +  +  ++ G      + E  + +++    ++ +  +N L                  
Sbjct: 171 VVLSGLTLVLVGTGLTHSSQEAVTVLTAGLLGMVAYLVVNGLSRAFRPSGVGQPQPAGPA 230

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNF-FIIVIGLTIGAIYVRSMTLLMLKQG 291
            G  GL+LFLYLE++DA+ S DGV  +FAIT +   I++    +GA++VRS+T+ ++ Q 
Sbjct: 231 TGWAGLSLFLYLEVLDAAFSFDGVTGAFAITSDPVVIVLGLGVVGAMFVRSITIYLVHQE 290

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L++Y YLEHG++++I  L+VIM       + +PE  T +     I  ++  S+  +
Sbjct: 291 TLDRYVYLEHGAHWAIGALAVIMLASIEPRLTVPEPVTASVGVFFIGTAVGFSVLRR 347


>gi|118463569|ref|YP_879807.1| hypothetical protein MAV_0528 [Mycobacterium avium 104]
 gi|118164856|gb|ABK65753.1| integral membrane protein [Mycobacterium avium 104]
          Length = 362

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 104/357 (29%), Positives = 192/357 (53%), Gaps = 31/357 (8%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F  ++LVT A  + G            G   ++Y+ ++LA +E+SLSF+NA++NA  
Sbjct: 4   LRTFGVSLLVTAAALVLGYAY---------GGPKSLYLLLVLAALEVSLSFDNAVINAAV 54

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP-------- 122
           L++MS  WQ+ FLT GIL+AVFGMR++FP++IV   + ++P+ A+ LA+  P        
Sbjct: 55  LKQMSRFWQRMFLTIGILVAVFGMRLLFPLLIVWATAGLDPVRALELALRPPPHGALEFP 114

Query: 123 ---QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                Y K+++ AH  I+ FGG   +++    F      + W+ ++E+  + + ++  + 
Sbjct: 115 DGSPSYQKLLTAAHPQIAAFGGI-FLLMLFLDFLLIDRDIKWLKWIEVPFARIGRLGQVS 173

Query: 180 IFI--VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVL-----SSDSSNNVT 232
           + +  +  ++ G      + E  + +++    ++ +  +N L                  
Sbjct: 174 VVLSGLTLVLVGTGLTHSSQEAVTVLTAGLLGMVAYLVVNGLSRAFRPSGVGQPQPAGPA 233

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNF-FIIVIGLTIGAIYVRSMTLLMLKQG 291
            G  GL+LFLYLE++DA+ S DGV  +FAIT +   I++    +GA++VRS+T+ ++ Q 
Sbjct: 234 TGWAGLSLFLYLEVLDAAFSFDGVTGAFAITSDPVVIVLGLGVVGAMFVRSITIYLVHQE 293

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L++Y YLEHG++++I  L+VIM       + +PE  T +     I  ++  S+  +
Sbjct: 294 TLDRYVYLEHGAHWAIGALAVIMLASIEPRLTVPEPVTASVGVFFIGTAVGFSVLRR 350


>gi|56707698|ref|YP_169594.1| hypothetical protein FTT_0569c [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670169|ref|YP_666726.1| hypothetical protein FTF0569c [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134302332|ref|YP_001122301.1| hypothetical protein FTW_1443 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|187931925|ref|YP_001891910.1| hypothetical protein FTM_1275 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|224456769|ref|ZP_03665242.1| hypothetical protein FtultM_03072 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254370204|ref|ZP_04986210.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874511|ref|ZP_05247221.1| integral membrane protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|56604190|emb|CAG45202.1| conserved hypothetical membrane protein [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320502|emb|CAL08585.1| conserved hypothetical membrane protein [Francisella tularensis
           subsp. tularensis FSC198]
 gi|134050109|gb|ABO47180.1| integral membrane protein [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|151568448|gb|EDN34102.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|187712834|gb|ACD31131.1| integral membrane protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254840510|gb|EET18946.1| integral membrane protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158865|gb|ADA78256.1| integral membrane protein [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 340

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 197/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSFFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  I    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYSDPNYQGSLAIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ ++ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAVLLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|254374161|ref|ZP_04989643.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151571881|gb|EDN37535.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 340

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 196/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSFFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +M   WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMPPKWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  I    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYSDPNYQGSLAIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ I+ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAILLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|261886382|ref|ZP_06010421.1| hypothetical protein CfetvA_15863 [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 325

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 125/333 (37%), Positives = 195/333 (58%), Gaps = 17/333 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + ++T+ G L    I         G    VYIC +L ++E+SLSF+NA++NAK 
Sbjct: 1   MKYFYSSFIITILGLLLAYFI---------GGFLAVYICFLLGILEVSLSFDNAVVNAKI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L  M+  WQ RF+ +GI IAVFGMR +FPI+IV + + +   E  +LA+  P  Y   +S
Sbjct: 52  LSGMNKKWQDRFIIFGIPIAVFGMRFLFPILIVSVAANLGMWETFSLALNDPDAYHNALS 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
                I  FGG FL+MV L+FFF  +  + WI F+E         K   I + ++I+ G+
Sbjct: 112 ANKNQIYIFGGAFLLMVFLSFFF-EEKDVKWIRFIEDNYLVHILSKTNSIALFIAILTGM 170

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
             +  T +  S+  S   A+++   ++  + + S++        K G   FLYLE++DAS
Sbjct: 171 IIVFLT-QNTSYALSYFGAVLLHMALSLFDDIFSANGV------KSGFMGFLYLEVLDAS 223

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+++N FII+IGL IGA++VRS+T+ M+ +  L  + YLEHG++Y+I  L
Sbjct: 224 FSFDGVIGAFAMSENIFIIMIGLGIGAMFVRSLTIYMVHKKTLESFIYLEHGAHYAILAL 283

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           ++IMF+    ++ E  TGT    LI ++  SSI
Sbjct: 284 AIIMFINVFHEVGEAITGTIGFGLIVIAFLSSI 316


>gi|208779126|ref|ZP_03246472.1| integral membrane protein [Francisella novicida FTG]
 gi|208744926|gb|EDZ91224.1| integral membrane protein [Francisella novicida FTG]
          Length = 340

 Score =  286 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 129/336 (38%), Positives = 197/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSFFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V I S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSITSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  I    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYANPNYQGSLAIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ I+ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAILLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|115315063|ref|YP_763786.1| hypothetical protein FTH_1307 [Francisella tularensis subsp.
           holarctica OSU18]
 gi|115129962|gb|ABI83149.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
          Length = 340

 Score =  286 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 128/336 (38%), Positives = 198/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  ++ VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSLFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  I    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYSDPNYQGSLDIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ I+ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAILLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|89256645|ref|YP_514007.1| hypothetical protein FTL_1342 [Francisella tularensis subsp.
           holarctica LVS]
 gi|169656661|ref|YP_001428851.2| hypothetical protein FTA_1421 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|254367959|ref|ZP_04983979.1| hypothetical protein FTHG_01262 [Francisella tularensis subsp.
           holarctica 257]
 gi|290953536|ref|ZP_06558157.1| hypothetical protein FtulhU_04179 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313140|ref|ZP_06803822.1| hypothetical protein FtulhU_04164 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89144476|emb|CAJ79781.1| conserved hypothetical membrane protein [Francisella tularensis
           subsp. holarctica LVS]
 gi|134253769|gb|EBA52863.1| hypothetical protein FTHG_01262 [Francisella tularensis subsp.
           holarctica 257]
 gi|164551729|gb|ABU61896.2| putative membrane protein [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 340

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 198/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  ++ VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSLFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  I    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYSDPNYQGSLDIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ ++ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAVLLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|118497338|ref|YP_898388.1| hypothetical protein FTN_0743 [Francisella tularensis subsp.
           novicida U112]
 gi|195536025|ref|ZP_03079032.1| membrane protein, putative [Francisella tularensis subsp. novicida
           FTE]
 gi|118423244|gb|ABK89634.1| conserved hypothetical membrane protein [Francisella novicida U112]
 gi|194372502|gb|EDX27213.1| membrane protein, putative [Francisella tularensis subsp. novicida
           FTE]
          Length = 340

 Score =  285 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 129/336 (38%), Positives = 197/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSFFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQTIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  I    +    G  I   + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILFAIIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
               +    N   S   +    II+   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIHYANPNYQGSLAIAFLLGIIVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ I+ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAILLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|315637371|ref|ZP_07892586.1| integral membrane protein [Arcobacter butzleri JV22]
 gi|315478345|gb|EFU69063.1| integral membrane protein [Arcobacter butzleri JV22]
          Length = 359

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 130/351 (37%), Positives = 201/351 (57%), Gaps = 23/351 (6%)

Query: 7   YASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAIL 66
              +I +F     V     +            L G    VY   IL+V+E+SLSF+NA++
Sbjct: 3   QKPIISYFYGFFAVWFIATILLF---------LYGGFFAVYQGTILSVLELSLSFDNAVV 53

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L  M+ +W+KRFL WG++IAVFG+R +FPI+IV   + +  I++ NLA+ +P +Y 
Sbjct: 54  NATILATMALVWRKRFLIWGMIIAVFGVRFVFPILIVYFSTPMGFIDSFNLAVTNPDEYE 113

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           +II  +H  I  FGG FL+M+ L F F+    LHWI  +E   + +SKI  +KI  +L +
Sbjct: 114 RIIESSHHVIMSFGGMFLLMLFLKFIFDENKDLHWIKSIENFATKISKIGDVKILFILFL 173

Query: 187 IFGISNILPTN----------EMYSFVSSSTAAIIIFYGINFLESVL----SSDSSNNVT 232
           + GI+ I P                 ++     +I FY I FL+  +      +S + +T
Sbjct: 174 MLGITYIAPNQVVMGDNMVNVNKIEILAPMIIGVIAFYMIEFLKGFIEHRNEEESDSKIT 233

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
               G   F+YLE+ID S SLDGV+ +FAIT+N  II++GL IGA+ VRS+T+ M+++ +
Sbjct: 234 QVSGGFISFMYLELIDMSFSLDGVLGAFAITQNIVIIMLGLGIGAMAVRSLTIYMVERDV 293

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           ++KY YLEHG+ +SI +LS+ M +Q    +P +   T + + I L+   SI
Sbjct: 294 VSKYIYLEHGAMWSIGLLSLSMLVQIFHHLPPMLVTTFAIVPITLAFIHSI 344


>gi|118475138|ref|YP_891227.1| hypothetical protein CFF8240_0017 [Campylobacter fetus subsp. fetus
           82-40]
 gi|118414364|gb|ABK82784.1| integral membrane protein [Campylobacter fetus subsp. fetus 82-40]
          Length = 325

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 124/333 (37%), Positives = 195/333 (58%), Gaps = 17/333 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + ++T+ G L    I         G    VYIC +L ++E+SLSF+NA++NAK 
Sbjct: 1   MKYFYSSFIITILGLLLAYFI---------GGFLAVYICFLLGILEVSLSFDNAVVNAKI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L  M+  WQ RF+ +GI IAVFGMR +FPI+IV + + +   E  +LA+  P  Y   +S
Sbjct: 52  LSGMNKKWQDRFIIFGIPIAVFGMRFLFPILIVSVAANLGMWETFSLALNDPDAYHNALS 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
                I  FGG FL+MV L+FFF  +  + WI F+E         K   I + ++I+ G+
Sbjct: 112 ANKNQIYIFGGAFLLMVFLSFFF-EEKDVKWIRFIEDNYLVHILSKTNSIALFIAILTGM 170

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
             +  T +  S+  S   A+++   ++  + + S++        K G   FL+LE++DAS
Sbjct: 171 IIVFLT-QNTSYALSYFGAVLLHMALSLFDDIFSANGV------KSGFMGFLHLEVLDAS 223

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+++N FII+IGL IGA++VRS+T+ M+ +  L  + YLEHG++Y+I  L
Sbjct: 224 FSFDGVIGAFAMSENIFIIMIGLGIGAMFVRSLTIYMVHKKTLESFIYLEHGAHYAILAL 283

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           ++IMF+    ++ E  TGT    LI ++  SSI
Sbjct: 284 AIIMFINVFHEVGEAITGTIGFGLIVIAFLSSI 316


>gi|157737609|ref|YP_001490292.1| hypothetical protein Abu_1367 [Arcobacter butzleri RM4018]
 gi|157699463|gb|ABV67623.1| conserved hypothetical protein (DUF475 domain protein) [Arcobacter
           butzleri RM4018]
          Length = 359

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 130/351 (37%), Positives = 201/351 (57%), Gaps = 23/351 (6%)

Query: 7   YASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAIL 66
              +I +F     V     +            L G    VY   IL+V+E+SLSF+NA++
Sbjct: 3   QKPIISYFYGFFAVWFIATILLF---------LYGGFFAVYQGTILSVLELSLSFDNAVV 53

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L  M+ +W+KRFL WG++IAVFG+R +FPI+IV   + +  I++ NLA+ +P +Y 
Sbjct: 54  NATILATMALVWRKRFLIWGMIIAVFGVRFVFPILIVYFSTPMGFIDSFNLAVTNPDEYE 113

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           +II  +H  I  FGG FL+M+ L F F+    LHWI  +E   + +SKI  +KI  +L +
Sbjct: 114 RIIESSHHVIMSFGGMFLLMLFLKFIFDENKDLHWIKSIENFATKISKIGDVKILFILFL 173

Query: 187 IFGISNILPTN----------EMYSFVSSSTAAIIIFYGINFLESVL----SSDSSNNVT 232
           + GI+ I P                 ++     +I FY I FL+  +      +S + +T
Sbjct: 174 MLGITYIAPNQVVMGDNMVNVNKIEILAPMIIGVIAFYMIEFLKGFIEHKNEEESDSKIT 233

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
               G   F+YLE+ID S SLDGV+ +FAIT+N  II++GL IGA+ VRS+T+ M+++ +
Sbjct: 234 QVSGGFISFMYLELIDMSFSLDGVLGAFAITQNIVIIMLGLGIGAMAVRSLTIYMVERDV 293

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           ++KY YLEHG+ +SI +LS+ M +Q    +P +   T + + I L+   SI
Sbjct: 294 VSKYIYLEHGAMWSIGLLSLSMLVQIFHHLPPMLVTTFAIVPITLAFIHSI 344


>gi|254369516|ref|ZP_04985527.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122470|gb|EDO66605.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 340

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 128/336 (38%), Positives = 198/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSFFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MSS WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSSRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  I    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYSDPNYQGSLAIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ ++ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAVLLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|167011127|ref|ZP_02276058.1| hypothetical protein Ftulh_10562 [Francisella tularensis subsp.
           holarctica FSC200]
          Length = 338

 Score =  284 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 198/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  ++ VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSLFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  I    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYSDPNYQGSLDIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ ++ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAVLLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|313683193|ref|YP_004060931.1| hypothetical protein Sulku_2071 [Sulfuricurvum kujiense DSM 16994]
 gi|313156053|gb|ADR34731.1| protein of unknown function DUF475 [Sulfuricurvum kujiense DSM
           16994]
          Length = 326

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 122/335 (36%), Positives = 199/335 (59%), Gaps = 21/335 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  +  +   G +    +         G ++ +YI  +L V+EISLSF+NA++NAK 
Sbjct: 1   MRYFISSFAIMAMGLIAAFYL---------GGLTAIYITFLLIVLEISLSFDNAVVNAKV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M  +WQKRF+ +GI IAVFGMR++FP+ IV IV+ +  +E + +A+  P +Y K++ 
Sbjct: 52  LETMDPVWQKRFIVFGIPIAVFGMRLVFPLAIVSIVTGMGLMETLQVAMNQPSEYEKVLK 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSIIF 188
                I  FGG FL+MV L FFF  +  + W+ F+E    M   S +  I++   + I  
Sbjct: 112 ATESTIFAFGGAFLLMVFLDFFF-EERDIKWVTFVEGSKMMETFSGVANIELITAIMIGI 170

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
            + +I    + +  V +    +++   +  L+  LSSD        K G+  F+YLE++D
Sbjct: 171 ALGHI---TQDFGVVLAFMYGVLLHSLLGMLDHFLSSD------TVKSGIAGFIYLEVLD 221

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T N FII+IGL +GA++VRS+TL  ++   L++++YLEHG++Y+I 
Sbjct: 222 ASFSFDGVIGAFALTSNIFIIMIGLGVGAMFVRSITLYFVEHKTLSEFRYLEHGAHYAIG 281

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +L++IM ++    I E+ TGT    LI ++   SI
Sbjct: 282 ILAIIMLMKITTHISEMVTGTIGIGLITIAFLHSI 316


>gi|332184185|gb|AEE26439.1| hypothetical protein FN3523_1136 [Francisella cf. novicida 3523]
          Length = 340

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 194/336 (57%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F  +  +T+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKFFYGSFFITIIGVVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +M   WQK F+  G+ IAVFGMR+IFPI++V + S IN I  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMPPKWQKIFIYIGLPIAVFGMRLIFPILLVSVTSGINFINVITLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  +    +    G  I   + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNVVTKKIRNYDGGYILFAIIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
               +    N   +   +    II+   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIHYADPNYQGNLAIAFLLGIIVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ I+ L+    IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAILLLKIFTHIPEWFSGSIGILVLSLAFIHSV 332


>gi|241668789|ref|ZP_04756367.1| hypothetical protein FphipA2_08475 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254877320|ref|ZP_05250030.1| integral membrane protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254843341|gb|EET21755.1| integral membrane protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 341

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 196/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G    + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSFFVTLIGVGIAIFIY------PTAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN    + LA+  PQ Y  I+
Sbjct: 57  ILGQMSQKWQKIFIYLGLPIAVFGMRLLFPILLVSVTSGINFTNVVTLALNDPQQYQNIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E       +    G  I   + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENEGHHWIPIVENNRITRKIRDYNGGYILFAIFIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
             I      +   S   +    I++   I  L S+  +   ++ T  ++G+  F+YLEII
Sbjct: 177 LIIIYDAEPDYQGSLAIAYFLGIVVHESIGMLNSIFDTSHIDSSTVARNGIMGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ ++ L+  V IPE F+G+   +++F++   S+
Sbjct: 297 GFLAAVLLLKIFVHIPEWFSGSIGILVLFIAFIHSV 332


>gi|167626357|ref|YP_001676857.1| hypothetical protein Fphi_0136 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167596358|gb|ABZ86356.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 364

 Score =  282 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 197/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G    + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 26  ILKYFYGSFFVTLIGIGIAIFIY------PTAPLETIYSVLILAILEISLSFDNAVINAK 79

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN    + LA+  PQ Y  I+
Sbjct: 80  ILGQMSQKWQKIFIYLGLPIAVFGMRLLFPILLVSVTSGINFTNVVTLALNDPQQYQNIL 139

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E       +    G  I   + I 
Sbjct: 140 EHSMPYICSFGGSFLLMVFLNFFLSENEGHHWIPIVENNRITRKIRDYNGGYILFAIFIG 199

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
             I     ++   S   +    I++   I  L S+  +   ++ T  ++G+  F+YLEII
Sbjct: 200 LIIIYDAESDYQGSLAIAYFLGIVVHESIGMLNSIFDTSHIDSSTVARNGIMGFIYLEII 259

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 260 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 319

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ ++ L+  V IPE F+G+   +++F++   S+
Sbjct: 320 GFLAAVLLLKIFVHIPEWFSGSIGILVLFIAFIHSV 355


>gi|319789385|ref|YP_004151018.1| protein of unknown function DUF475 [Thermovibrio ammonificans HB-1]
 gi|317113887|gb|ADU96377.1| protein of unknown function DUF475 [Thermovibrio ammonificans HB-1]
          Length = 332

 Score =  281 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 116/324 (35%), Positives = 191/324 (58%), Gaps = 5/324 (1%)

Query: 22  VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR 81
           +A FL    + W       G I  V+    L+++EISLSF+NA++NA  L  MS +W++R
Sbjct: 7   LAEFLVIFAVSWVIEFAYMG-IKGVFEGTTLSLLEISLSFDNAVMNAVILAGMSQLWRRR 65

Query: 82  FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGG 141
           FLTWG++IAVFGMR +FP++IV + + +   + + LA   P+ Y   +  A   I  FGG
Sbjct: 66  FLTWGMVIAVFGMRFLFPVLIVAVTAGLPVTKVVELAFKEPEKYAHHLEHAEPLILAFGG 125

Query: 142 TFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYS 201
            FL+MV + + F++  +L WI  LE   S  +K+  +K+ I LS+IF +  +       +
Sbjct: 126 AFLLMVFINWLFDAGKELFWIRKLEEMASKAAKMGEVKLIIALSVIFTVGYL---KREPN 182

Query: 202 FVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFA 261
            + +    I++F  ++F++  +     +       GL  F+YLE++DAS SLDG + +FA
Sbjct: 183 IILALILGILLFEVVHFIKGAIEYFKEHGGAV-DAGLGSFIYLELLDASCSLDGTVGAFA 241

Query: 262 ITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD 321
           I+KN  II +GL++GA  +R++TL  ++ G L +  YLEHG+++ I  L ++M L+  + 
Sbjct: 242 ISKNLIIITVGLSVGAFILRTLTLYFVESGKLKELPYLEHGAHWGIGGLGIMMLLELFIH 301

Query: 322 IPEIFTGTSSTILIFLSIYSSIKN 345
           IPE    + + + I  S+YSS+K 
Sbjct: 302 IPEPVISSVALLFILSSLYSSVKR 325


>gi|325294438|ref|YP_004280952.1| hypothetical protein Dester_0236 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064886|gb|ADY72893.1| protein of unknown function DUF475 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 329

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 115/324 (35%), Positives = 198/324 (61%), Gaps = 6/324 (1%)

Query: 22  VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR 81
           +  F   L I W       G +  ++    L+++EISLSF+NA++NA  L  MS IW++R
Sbjct: 7   LLEFTLVLIISWIIEFFYMG-VKGIFEGTTLSLLEISLSFDNAVMNAVVLSGMSYIWRRR 65

Query: 82  FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGG 141
           FLTWG++IAVFGMR +FP++IV + + I   +   +A  +P++Y   +  A   I  FGG
Sbjct: 66  FLTWGMIIAVFGMRFLFPVLIVSLTAGIGIEKVTEMAFSNPEEYAHYLEIAEPLILSFGG 125

Query: 142 TFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYS 201
           +FL+MV + + F++  +L+WI FLE   + L+K+  IK+ + L+++F +  +    +  +
Sbjct: 126 SFLLMVFINWLFDAGKELYWIRFLEEKAAKLAKVGEIKLIVALTVVFIVGFL---KKDSN 182

Query: 202 FVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFA 261
            + +    I++F  ++F++  +     N+++ G  GL  F+YLE++DAS SLDG + +FA
Sbjct: 183 ILLAMILGILLFELVHFIKGAIEYFKRNSISSG--GLANFIYLELLDASCSLDGAVGAFA 240

Query: 262 ITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD 321
           I++N  II +GL++GA  +RS+T+  ++ G L +  YLEHG+++ I  L ++M  Q    
Sbjct: 241 ISQNLIIITLGLSVGAFILRSLTVYFVESGKLRELPYLEHGAHWGIGGLGIMMLAQLFHH 300

Query: 322 IPEIFTGTSSTILIFLSIYSSIKN 345
           IPE    T + + I  S+Y+SI+ 
Sbjct: 301 IPEPVISTVALVFILSSLYTSIRK 324


>gi|34557555|ref|NP_907370.1| hypothetical protein WS1186 [Wolinella succinogenes DSM 1740]
 gi|34483272|emb|CAE10270.1| INTEGRAL MEMBRANE PROTEIN [Wolinella succinogenes]
          Length = 333

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 115/342 (33%), Positives = 196/342 (57%), Gaps = 19/342 (5%)

Query: 7   YASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAIL 66
               + +FR++ ++ + G L              G +   YI  +LA++E+S+SF+NA++
Sbjct: 3   KRPSMKYFRFSFVLALVGVLVAYFF--------LGGLYAAYIVALLALLEVSISFDNAVI 54

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NAK L+ M+  W++RF+ +GI IAVFG+R I PI+IV + S    IE +NLA+     Y 
Sbjct: 55  NAKVLEGMTPKWRERFIIYGIPIAVFGVRFILPIIIVSLASGEGMIEILNLALSDAALYA 114

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVL 184
           + +      I  FGG FL+MV L FFF+   ++ W+  LE       +S+I  I++ + +
Sbjct: 115 EKLEGVMGKIYAFGGAFLLMVFLEFFFDEDREVVWLRRLEQNRITQRISQINFIELLVAI 174

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYL 244
            +   +S +   +       +    I ++  I  ++  L           + G+  FLYL
Sbjct: 175 LVGVVLSFL---SGELGVSLAYFIGIALYALIRGIDHAL------IKGGARSGVIGFLYL 225

Query: 245 EIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSY 304
           E++DAS SLDGVI +FA++ N FIIVIGL IGA +VRS+T+  +++ +L+++ YLEHG+ 
Sbjct: 226 EVLDASFSLDGVIGAFALSSNIFIIVIGLAIGAFFVRSLTIYFVEKKVLSEFIYLEHGAR 285

Query: 305 YSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           Y+I +L+++MF+Q  + + E   G+   ++I  ++  SI +K
Sbjct: 286 YAILILALMMFVQIFMHVSEAIVGSVGVVIILGALLHSIIHK 327


>gi|256391404|ref|YP_003112968.1| hypothetical protein Caci_2208 [Catenulispora acidiphila DSM 44928]
 gi|256357630|gb|ACU71127.1| protein of unknown function DUF475 [Catenulispora acidiphila DSM
           44928]
          Length = 356

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 100/332 (30%), Positives = 180/332 (54%), Gaps = 14/332 (4%)

Query: 24  GFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           G   G  +         G I +  +  +LAV+E++LSF+NA++NA  L++    WQ+ FL
Sbjct: 7   GVAYGATLLGLVLALWLGGIRSATVVAMLAVLEVALSFDNAVVNATVLRRFDLRWQRIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++ P+ ++  V+  +P   ++ +++ P  Y   I      I+ FGG F
Sbjct: 67  TVGVLIAVFGMRLVIPMAVLVAVTRQSPFHVLSSSVHDPNGYAHEILGVQPLIAAFGGVF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSK------IKGIKIFIVLSIIFGISNILPTN 197
           L+M+++ FF  S + L W+ F E  ++   +      ++  ++  V+  +F  +    T+
Sbjct: 127 LLMIAMDFFL-SGHDLIWLPFFERRLAAFGERFKPLALEAFQVVGVVLFLFVAAGTFATD 185

Query: 198 EMYSFVSSSTAAIIIFYGINFLESV-------LSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
                  +    +  ++ I  L          L+ ++      G+  L LF+YLE++DA+
Sbjct: 186 HPVGVPIAGVIGLATYFTIKRLSDAAADRSESLADEADETPPQGRQALMLFIYLEVLDAT 245

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S D V+  F++T +  +  IGL IGA YVRS+T+ ++++  L++Y YLEHG+YYSI VL
Sbjct: 246 FSFDSVMGGFSVTVDIALFTIGLGIGAAYVRSLTVFLVRKKTLDRYVYLEHGAYYSIGVL 305

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           +V++ ++   D+P+     + T +I  +   S
Sbjct: 306 AVLLLVEIGPDVPDWLASVAGTSMIVAAFIHS 337


>gi|167957390|ref|ZP_02544464.1| hypothetical protein cdiviTM7_01901 [candidate division TM7
           single-cell isolate TM7c]
          Length = 270

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 85/255 (33%), Positives = 149/255 (58%), Gaps = 3/255 (1%)

Query: 92  FGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTF 151
           F +R + PI+IV   S +N  E +++A+ +P+ Y  ++  A   I+ FGG FL+M+ L++
Sbjct: 1   FAVRFLLPIVIVMFASGLNLGEVVSMALNNPERYGHVLHNASPMINAFGGIFLLMIGLSY 60

Query: 152 FFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAII 211
           F +   ++HW+  +E  ++   K +  +  ++L ++  +   +        + SS    +
Sbjct: 61  FVDYNKQIHWVRGVEPWLARAGKFENFRACLILLVMVVLYFTVEEKYKAMILISSVLGTL 120

Query: 212 IFYGINFLESVLSSDSSNNVT--HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFII 269
           +  G+    S+  S SS ++    G      FLYLE++DAS S DGVI +FAIT +  +I
Sbjct: 121 LHIGLELFGSLFGSHSSKDIKLKTGWAAFAAFLYLEVLDASFSFDGVIGAFAITSSVILI 180

Query: 270 VIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTG 328
             GL+ GAI+VRS+T+ +++ G L+KY+YLEHG++++I  L V+M  +   V++PE  TG
Sbjct: 181 TSGLSAGAIWVRSLTIYLMRSGTLSKYRYLEHGAHWAIVALGVMMLFKLFHVELPEWITG 240

Query: 329 TSSTILIFLSIYSSI 343
           +     I L+I SS+
Sbjct: 241 SLGLAFIILAIGSSV 255


>gi|126178296|ref|YP_001046261.1| hypothetical protein Memar_0346 [Methanoculleus marisnigri JR1]
 gi|125861090|gb|ABN56279.1| protein of unknown function DUF475 [Methanoculleus marisnigri JR1]
          Length = 309

 Score =  231 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 77/303 (25%), Positives = 141/303 (46%), Gaps = 10/303 (3%)

Query: 46  VYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCI 105
           V     L+V EI  S +NAI+NA  L  M    ++ FL WG++ AVF +R + P +IV  
Sbjct: 7   VLTVAGLSVFEIVSSIDNAIINADVLATMGEKARRWFLLWGLIAAVFVVRGLLPWLIVWA 66

Query: 106 V-STINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHF 164
              ++ P++A+     S       I ++   +  FGGTFL+ +   + F  +        
Sbjct: 67  TNPSLGPVDALLATFSSDPAVTAAIEESAPILLIFGGTFLVFLFFHWLFAEEKTC----- 121

Query: 165 LEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS 224
             +        + +  + V+S++  I              ++      F+ ++       
Sbjct: 122 -GLRSERFFSRQSVWFYAVVSVLLAILVWFALQINVMMGFAAVLGSTAFFIVHGFRQNAE 180

Query: 225 SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMT 284
              +     G   L+   YLE++DA+ S+DGVI +FA T +  +I+IG  IGA+ VR +T
Sbjct: 181 VQEARLRRPGMSDLSKIAYLEVLDATFSIDGVIGAFAFTLSVPLILIGNGIGAVVVRELT 240

Query: 285 LLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSI 343
           +  + +  +  Y +L++G+ YSI VL  IM   +    IP   +  ++  ++   +Y S+
Sbjct: 241 VRGVDR--IRSYCFLKNGAMYSILVLGTIMLADSFGFHIPAWLSPVATFAIVGYFLYRSV 298

Query: 344 KNK 346
           + +
Sbjct: 299 QEQ 301


>gi|307353278|ref|YP_003894329.1| hypothetical protein Mpet_1125 [Methanoplanus petrolearius DSM
           11571]
 gi|307156511|gb|ADN35891.1| protein of unknown function DUF475 [Methanoplanus petrolearius DSM
           11571]
          Length = 308

 Score =  229 bits (585), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 81/303 (26%), Positives = 144/303 (47%), Gaps = 10/303 (3%)

Query: 42  TISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIM 101
            +S + +   L + EI  S +NAI+NA+ L  M    ++ FL WG+L+AVF +R + P +
Sbjct: 3   LLSLILVVSGLCLFEIISSIDNAIINAEVLSTMEEKARRWFLVWGLLLAVFVIRGLLPWL 62

Query: 102 IVCIVS-TINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           IV I + ++ P+EA+     S    ++ I  +   +   GGTFL+ +   + F  +    
Sbjct: 63  IVWITTPSLGPVEALFATFSSDPAVVEAIETSSPILLIGGGTFLIFLFFHWLFVDEKN-- 120

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLE 220
                 +        + +  F V+SI+                  +      F+ ++   
Sbjct: 121 ----FGLPGERFFSRQSVWFFAVVSILLCSIVWFAMQVSPMMGFGAVVGSTAFFIVHGFR 176

Query: 221 SVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
                  +         ++   YLE+IDA+ S+DGVI +FA T    +I+IG +IGA  V
Sbjct: 177 QNAEVQEARLKDRKISDISKIFYLEVIDATFSIDGVIGAFAFTLAVPLILIGNSIGAFVV 236

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSI 339
           R +T+  +++  +  Y++L++G+ YSIFVL  IM L +  V IP   +   + +++    
Sbjct: 237 RELTIRNIEK--IKCYQFLKNGAMYSIFVLGTIMILDSFGVHIPTWLSPVVTFVIVGYFF 294

Query: 340 YSS 342
           Y S
Sbjct: 295 YKS 297


>gi|239940903|ref|ZP_04692840.1| hypothetical protein SrosN15_07890 [Streptomyces roseosporus NRRL
           15998]
 gi|291444337|ref|ZP_06583727.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
 gi|291347284|gb|EFE74188.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
          Length = 214

 Score =  222 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 74/222 (33%), Positives = 124/222 (55%), Gaps = 19/222 (8%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G      I  IL+V+EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAIFY---------GGWQAFGIVAILSVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV + + + PIEA++L+   P  Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAVSAKLGPIEAIDLSFNDPDKYKELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F+    +HW+ ++E  ++ L K+  + + + L I+  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIFDEDRDIHWLRWIERPLAKLGKVDMLSVCVALIILLI 172

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLES 221
            +    T          ++  + + S  A +I +  +  L  
Sbjct: 173 TAMTFATQAHQHGGGHVDKSATVMLSGIAGLITYLIVGGLSG 214


>gi|88602334|ref|YP_502512.1| hypothetical protein Mhun_1043 [Methanospirillum hungatei JF-1]
 gi|88187796|gb|ABD40793.1| protein of unknown function DUF475 [Methanospirillum hungatei JF-1]
          Length = 294

 Score =  218 bits (556), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 76/294 (25%), Positives = 138/294 (46%), Gaps = 10/294 (3%)

Query: 54  VVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVST-INPI 112
           + EI  S +NAI+NA+ L  M   +++ FL WGIL AVF +R + P+++V   +  +   
Sbjct: 1   MFEIICSIDNAIINAEVLGSMQPKYRRWFLLWGILFAVFLVRGLLPLLLVWFSTPELTLW 60

Query: 113 EAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHL 172
           EA         D  + I  +   +   GGTFL+ +   + F  +          +     
Sbjct: 61  EAFTAMFSDNPDIKEAIETSSPILLIGGGTFLIFLFFHWLFLEEK------HFGLPGERY 114

Query: 173 SKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVT 232
              KG+  + V+SI+          +       +      F+ ++             + 
Sbjct: 115 FFSKGVWFYAVVSILLMAIVWFAIEKNAMMAFGAVVGSTAFFIVHGFRQNAELQEQKLIN 174

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
                ++  LYLE+IDA+ S+DGV+ +FA T +  +I+IG  +GAI VR +T+  + +  
Sbjct: 175 GDMSDISKILYLEVIDATFSIDGVLGAFAFTMSVPLILIGNALGAIAVRQITVGNIDR-- 232

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIKN 345
           + KY++L++G+ YSI  L +IM + +    IPE  +   +  ++ L    S++ 
Sbjct: 233 IKKYRFLKNGAMYSILCLGIIMLIDSFGFHIPEFVSPVITFTVVGLFYMKSVRE 286


>gi|256784165|ref|ZP_05522596.1| hypothetical protein SlivT_06733 [Streptomyces lividans TK24]
 gi|289768050|ref|ZP_06527428.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289698249|gb|EFD65678.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 256

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 70/236 (29%), Positives = 116/236 (49%), Gaps = 32/236 (13%)

Query: 142 TFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNIL------- 194
            FL+M+ L F F     + W+ +LE  ++ L K+  + + I L ++   +          
Sbjct: 1   MFLLMIFLDFIF-EDRDIKWLAWLERPLAKLGKVDMLSVCIALVVLLVSAITFGAHAHQH 59

Query: 195 ---PTNEMYSFVSSSTAAIIIFYGINFLESVLSS---------------------DSSNN 230
                ++  + + +  A +I +  +  L                             S  
Sbjct: 60  GGAHADKAETVLLAGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEEEAARTGKPKSAV 119

Query: 231 VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQ 290
              GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++Q
Sbjct: 120 RLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQ 179

Query: 291 GILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           G L+ Y YLEHG++Y+I  L+VI+ +    +I EI TG     LI  S +SS++  
Sbjct: 180 GTLDDYVYLEHGAHYAIVALAVILLVTIQYEIHEIITGLVGVALIGWSFFSSVRRN 235


>gi|300853967|ref|YP_003778951.1| hypothetical protein CLJU_c07810 [Clostridium ljungdahlii DSM
           13528]
 gi|300434082|gb|ADK13849.1| putative membrane protein [Clostridium ljungdahlii DSM 13528]
          Length = 308

 Score =  209 bits (532), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 79/294 (26%), Positives = 141/294 (47%), Gaps = 12/294 (4%)

Query: 53  AVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVS-TINP 111
            + E+  S +NA++NA+ L  MS   +K FL +GIL AVF +R + P  IV   + ++ P
Sbjct: 14  CLFEVVSSIDNAVINAEVLSTMSEKAKKWFLLYGILFAVFIVRGLLPWAIVWATNQSLGP 73

Query: 112 IEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSH 171
           I A+     +    ++ I  +   +   GG FL+ + L + F           L +A   
Sbjct: 74  IGALTATFSNDPHIIESIEYSTPILMLGGGVFLVFLFLHWLFIEDK------HLGLATEE 127

Query: 172 LSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV 231
                G   + V+S+I                 S+      F+  +  +     +    +
Sbjct: 128 FFLKNGTWFYAVVSVILVGIVAAALKYNPVLALSAVIGSSAFFITDGFKKNAEENEKKLI 187

Query: 232 --THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLK 289
             T     ++  LYLEIID + S+DGV+ +FA T +  +I++G  IGAI VR +T+  ++
Sbjct: 188 DNTSEMSDISKILYLEIIDTTFSIDGVLGAFAFTMSIPLIILGNGIGAIVVRKITMGSIE 247

Query: 290 QGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSS 342
           +  + KY YL++G+ YS+  L ++M L+   V++PE  +   + ++I    + S
Sbjct: 248 K--IKKYIYLKNGAMYSVLCLGIVMVLEGFHVEVPEYISPLLTILIIMFFFFKS 299


>gi|154151171|ref|YP_001404789.1| hypothetical protein Mboo_1629 [Candidatus Methanoregula boonei
           6A8]
 gi|153999723|gb|ABS56146.1| protein of unknown function DUF475 [Methanoregula boonei 6A8]
          Length = 307

 Score =  208 bits (531), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 87/304 (28%), Positives = 147/304 (48%), Gaps = 10/304 (3%)

Query: 43  ISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMI 102
           +S +     L + E   S +NAI+NA+ L  MS   ++ FL WG+L AVF +R + P +I
Sbjct: 4   LSILLTIAGLCLFETITSIDNAIINAEVLSTMSQKARRWFLIWGLLFAVFVIRGVLPWLI 63

Query: 103 VCIVS-TINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHW 161
           V   + ++ P+ A+     S    +  I+QA   +   GGTFL+ + L + F  + +   
Sbjct: 64  VWASAPSLGPVGALTATFSSDPAVVAAIAQAAPILLVGGGTFLIFLFLHWIFLEEKEY-- 121

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
                I        KG+  F V+SI       L  ++       +      F+ ++    
Sbjct: 122 ----GICGERYIATKGVWFFAVVSIFLAGLVWLAISKNPMMAFGAVVGSSAFFIVHGFRQ 177

Query: 222 VLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
                    V+     ++   YLEIIDA+ S+DGV+ +FA T    +I+IG  IGA+ VR
Sbjct: 178 NAEEHERKMVSGDLSDISKIFYLEIIDATFSIDGVMGAFAFTMAVPLIIIGNGIGALIVR 237

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIY 340
            +T+  +    +  Y+YL++G+ YSI +L +IM L      IPE  +  ++  ++   +Y
Sbjct: 238 ELTVRNVD--TIRNYRYLKNGAMYSILILGIIMILDGFGAGIPEYVSPIATFGIVGYFLY 295

Query: 341 SSIK 344
            SI+
Sbjct: 296 RSIR 299


>gi|300853571|ref|YP_003778555.1| hypothetical protein CLJU_c03710 [Clostridium ljungdahlii DSM
           13528]
 gi|300433686|gb|ADK13453.1| putative membrane protein [Clostridium ljungdahlii DSM 13528]
          Length = 308

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 78/280 (27%), Positives = 137/280 (48%), Gaps = 12/280 (4%)

Query: 53  AVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVS-TINP 111
            + E+  S +NA++NA+ L  MS   +K FL +GIL AVF +R + P +IV   + ++ P
Sbjct: 14  CLFEVVSSIDNAVINAEVLSTMSEKAKKWFLLYGILFAVFIVRGLLPWVIVWATNRSLGP 73

Query: 112 IEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSH 171
           I A+     +    ++ I  +   +   GG FL+ + L + F           L +A   
Sbjct: 74  IGALTATFSNDPHIIESIEYSTPILMLGGGVFLVFLFLHWLFIEDK------HLGLATEE 127

Query: 172 LSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN-- 229
                G   + V+S+I      +          S+      F+  +  +     +     
Sbjct: 128 FFLKNGTWFYAVVSVILVGIVAVALKYNPVLALSAVIGSSAFFITDGFKKNAEENEKKLL 187

Query: 230 NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLK 289
           N T     ++  LYLEIID + S+DGV+ +FA T +  +I++G  +GAI VR +T+  ++
Sbjct: 188 NNTSEMSDISKILYLEIIDTTFSIDGVLGAFAFTMSIPLIILGNGLGAIVVRKITMGSIE 247

Query: 290 QGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTG 328
           +  + KY YL++G+ YSI  L ++M L+   V++PE  + 
Sbjct: 248 K--IKKYIYLKNGAMYSILCLGIVMVLEGFHVEVPEYISP 285


>gi|219852709|ref|YP_002467141.1| hypothetical protein Mpal_2120 [Methanosphaerula palustris E1-9c]
 gi|219546968|gb|ACL17418.1| Integral membrane protein TerC [Methanosphaerula palustris E1-9c]
          Length = 308

 Score =  205 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 80/306 (26%), Positives = 141/306 (46%), Gaps = 10/306 (3%)

Query: 43  ISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMI 102
           +S + +   L + E   S +NAI+NA+ L  M    ++ FL WG+LIAVF +R + P +I
Sbjct: 4   LSILVVIGGLVLFETVSSIDNAIINAEVLSSMGEKARRWFLVWGLLIAVFVVRGLLPWLI 63

Query: 103 VCIVS-TINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHW 161
           V + + ++ PI+A      S    L+ I ++   +   GGTFL+ +   + F        
Sbjct: 64  VWMATPSLGPIQAFTAMFSSDPMVLEAIERSSPILLIAGGTFLLFLFFNWLFVEHKHY-- 121

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
                +      + KG+  + V+S++                  +      F+ +N  + 
Sbjct: 122 ----GLRGERFIQSKGVWFYAVISLLLTGIVWFALKTDPMMAFGAVVGSTAFFIVNGFKQ 177

Query: 222 VLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
                           L+   YLE+IDA+ S+DGV+ +FA T    +I+IG  IGA+ VR
Sbjct: 178 NAEVQEKRLSGGHLTDLSKLFYLEVIDATFSIDGVVGAFAFTLLVPLIMIGNGIGALVVR 237

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIY 340
            +T+  + +  + +Y  L++G+ YSI  L  IM L    +  P   +   + I++   +Y
Sbjct: 238 ELTIGNIDR--IRRYPLLKNGAMYSILFLGGIMVLDAFGIKSPSWLSPLITFIVVGFFLY 295

Query: 341 SSIKNK 346
            SI+  
Sbjct: 296 RSIQWN 301


>gi|124486447|ref|YP_001031063.1| hypothetical protein Mlab_1635 [Methanocorpusculum labreanum Z]
 gi|124363988|gb|ABN07796.1| protein of unknown function DUF475 [Methanocorpusculum labreanum Z]
          Length = 323

 Score =  203 bits (518), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 80/313 (25%), Positives = 142/313 (45%), Gaps = 18/313 (5%)

Query: 43  ISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMI 102
           +  V + I L   E   S +NAI+NA  L  M +  ++ FLTWG++IAVFG+R + P  I
Sbjct: 4   LYAVVVIIGLVAFETVASIDNAIINADILSTMKAWARRWFLTWGLIIAVFGVRGLLPWAI 63

Query: 103 VCIVS-TINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHW 161
           +   + ++ PI A+       +     I  +   +   GG F++ + L +F   Q     
Sbjct: 64  IWASAPSLGPIGALTATFSGDETAALAIEHSAPFLLLAGGVFMIFLFLHWFMVEQKNCI- 122

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
                +         G   +   +II                 ++ A   IF+ +     
Sbjct: 123 -----VPGELAFSKTGPWFYAAAAIILLAIVYFTVQINPFLAVAAVAGSAIFFIMQGFRL 177

Query: 222 VLSSDSSN--------NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
              + S          N T  K  ++  + LE+IDA+ S+DGV+ +FA T +  +I+IG 
Sbjct: 178 FADAKSLELETKTVDVNETGHKSDISKLMLLEVIDATFSIDGVVGAFAFTMSVPLILIGN 237

Query: 274 TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSST 332
            IGA+ VR +T+  +    + KY YL++G+ YSIF L +IM  +   +++P       + 
Sbjct: 238 GIGALVVRELTIRNVDS--IRKYAYLKNGAMYSIFCLGIIMCSEGFGLELPIWIAPVLTV 295

Query: 333 ILIFLSIYSSIKN 345
            ++ +  + S++ 
Sbjct: 296 SIVAVFFWLSLRR 308


>gi|85858091|ref|YP_460293.1| hypothetical protein SYN_01442 [Syntrophus aciditrophicus SB]
 gi|85721182|gb|ABC76125.1| hypothetical membrane protein [Syntrophus aciditrophicus SB]
          Length = 313

 Score =  195 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 80/305 (26%), Positives = 154/305 (50%), Gaps = 10/305 (3%)

Query: 43  ISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMI 102
           IST+ I   L + E+  S +NAI+NA  L+ MS  ++K FL WGIL AVF +R + P +I
Sbjct: 3   ISTLIIIFGLCLFEVICSVDNAIINATVLKTMSVKYRKIFLFWGILFAVFVVRGMLPFVI 62

Query: 103 VCIVST-INPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHW 161
           V   +  ++ +E       S     + + ++   +   GG +L+ V+L++ F  + K  +
Sbjct: 63  VWATNPALSLVEVFKACFSSYGGAAEAMEKSKPLLLLGGGVYLLYVALSWLFLEEKKYAF 122

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
           +        H    +G+  + ++S++  +   +          ++T  +  F+  +  + 
Sbjct: 123 LA------EHFIHRQGVWFYAIVSLLTTLLVYVSLRIDPILALAATIGVSAFFITDGFKK 176

Query: 222 VLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
                    +T      +  LYLE++D S S+DGVI +FA T +  +I++G  +GA  VR
Sbjct: 177 NAEEKEKELLTGNLSAWSKILYLEVLDTSFSIDGVIGAFAFTMSVPLIILGNGLGAFVVR 236

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIY 340
            +T+  +   ++ +Y YL++G+ YSI VL V+M L++     P      ++ +L+   ++
Sbjct: 237 ELTIKGID--VIARYAYLKNGAMYSIGVLGVLMILESFGQHHPFWLAPLNTLVLLCFFLF 294

Query: 341 SSIKN 345
            S++ 
Sbjct: 295 LSVRE 299


>gi|328676825|gb|AEB27695.1| Integral membrane protein [Francisella cf. novicida Fx1]
          Length = 242

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 85/234 (36%), Positives = 130/234 (55%), Gaps = 2/234 (0%)

Query: 112 IEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAM 169
           +  + LA+ +PQ Y  I+  +   I  FGG+FL+MV L FF +     HWI  +E  I  
Sbjct: 1   MNVVTLALDNPQQYQAILEHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIIT 60

Query: 170 SHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN 229
             +    G  I + + I          N   S   +    I++   I  L S+  +   +
Sbjct: 61  KKIRNYDGGYILLAVIIGVITIYYSDPNYQGSLAIAFLLGIVVHESIGLLNSLFDTAKVS 120

Query: 230 NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLK 289
                ++GL  F+YLEIIDAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L ++
Sbjct: 121 TTDVARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVE 180

Query: 290 QGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +  L KY YLEHG++Y+I  L+ I+ L+  + IPE F+G+   +++ L+   S+
Sbjct: 181 KKTLAKYIYLEHGAHYAIGFLAAILLLKIFMHIPEWFSGSIGILVLTLAFIHSV 234


>gi|325917232|ref|ZP_08179456.1| hypothetical protein XVE_3449 [Xanthomonas vesicatoria ATCC 35937]
 gi|325536527|gb|EGD08299.1| hypothetical protein XVE_3449 [Xanthomonas vesicatoria ATCC 35937]
          Length = 204

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 66/196 (33%), Positives = 115/196 (58%), Gaps = 3/196 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV           G     T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFREFRMSLLVAAVCLGVAAWWG---HTTSMGLWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P+ Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPERYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + ++++  
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVTVLLC 177

Query: 190 ISNILPTNEMYSFVSS 205
               LP     S + +
Sbjct: 178 TKLFLPEAIFQSVLFA 193


>gi|218506716|ref|ZP_03504594.1| hypothetical protein RetlB5_03449 [Rhizobium etli Brasil 5]
          Length = 173

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 72/172 (41%), Positives = 113/172 (65%)

Query: 169 MSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSS 228
           M+  + I+GI+I  VL+++   S ++   E   FV  +   ++ F  +  +  +L +   
Sbjct: 1   MARSATIRGIEIAFVLALMLVFSWLIGGEEASIFVHCAIYGLLTFLVVEVVGELLDASQQ 60

Query: 229 NNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLML 288
                 K GL  F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++
Sbjct: 61  TMSAAAKGGLGAFIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLV 120

Query: 289 KQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
           ++G L +Y+YLEHG++Y+I +L+VIM+ QT+V IPE+ TG     LI LS+ 
Sbjct: 121 EKGTLAEYRYLEHGAFYAILILAVIMYAQTLVHIPEVITGRGGAALIGLSLL 172


>gi|325918801|ref|ZP_08180887.1| hypothetical protein XVE_4920 [Xanthomonas vesicatoria ATCC 35937]
 gi|325535001|gb|EGD06911.1| hypothetical protein XVE_4920 [Xanthomonas vesicatoria ATCC 35937]
          Length = 149

 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 55/139 (39%), Positives = 98/139 (70%), Gaps = 3/139 (2%)

Query: 211 IIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEIIDASLSLDGVISSFAITKNFF 267
           +++  +  ++++  S+ S + + G   + G+  FLYLE++DAS S DGVI +FAIT++  
Sbjct: 1   MLYLLVGSVDALFESEESEDGSMGPAKRSGIAAFLYLEVLDASFSFDGVIGAFAITRDVV 60

Query: 268 IIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFT 327
           II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I VL++IM + T+  +PE+ T
Sbjct: 61  IIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAIGVLAIIMLVGTVYHVPEVLT 120

Query: 328 GTSSTILIFLSIYSSIKNK 346
           G      I  S++SSI+ +
Sbjct: 121 GLIGVAFIAASVWSSIRYR 139


>gi|218679607|ref|ZP_03527504.1| putative transmembrane protein [Rhizobium etli CIAT 894]
          Length = 134

 Score =  159 bits (403), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 90/117 (76%)

Query: 230 NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLK 289
                K GL  F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT+++++
Sbjct: 1   MSAAAKGGLGAFIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVE 60

Query: 290 QGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +G L +Y+YLEHG++Y+I +LSVIM+ QT+V IPE+ TG     LI LS++SSI++ 
Sbjct: 61  KGTLAEYRYLEHGAFYAILILSVIMYAQTLVHIPEVITGLGGAALIGLSLWSSIRHN 117


>gi|218680742|ref|ZP_03528639.1| hypothetical protein RetlC8_18509 [Rhizobium etli CIAT 894]
          Length = 116

 Score =  145 bits (367), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 83/115 (72%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M     + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQPVTHTSSLSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+
Sbjct: 61  FDNAIVNANKLKEMTPVWQKRFLTWGIIIAVFGMRIVFPLAIVAIAAQIGPWDAL 115


>gi|169839791|ref|ZP_02872979.1| hypothetical protein cdivTM_22142 [candidate division TM7
           single-cell isolate TM7a]
          Length = 161

 Score =  141 bits (357), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 58/145 (40%), Positives = 90/145 (62%), Gaps = 3/145 (2%)

Query: 202 FVSSSTAAIIIFYGINFLESVLSSDSSNNVT--HGKHGLNLFLYLEIIDASLSLDGVISS 259
            + SS    ++  G+    S+  S SS ++    G      FLYLE++DAS S DGVI +
Sbjct: 2   ILISSVLGTLLHIGLELFGSLFGSHSSKDIKLKTGWAAFAAFLYLEVLDASFSFDGVIGA 61

Query: 260 FAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI 319
           FAIT +  +I  GL+ GAI+VRS+T+ +++ G L+KY+YLEHG++++I  L V+M  +  
Sbjct: 62  FAITSSVILITSGLSAGAIWVRSLTIYLMRSGTLSKYRYLEHGAHWAIVALGVMMLFKLF 121

Query: 320 -VDIPEIFTGTSSTILIFLSIYSSI 343
            V++PE  TG+     I L+I SS+
Sbjct: 122 HVELPEWITGSLGLAFIILAIGSSV 146


>gi|218510480|ref|ZP_03508358.1| hypothetical protein RetlB5_25371 [Rhizobium etli Brasil 5]
          Length = 101

 Score =  131 bits (329), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/101 (53%), Positives = 76/101 (75%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  ++ + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQSATHKSSLGYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIM 101
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ 
Sbjct: 61  FDNAIVNANKLKEMTPLWQKRFLTWGIIIAVFGMRIVFPLA 101


>gi|255596348|ref|XP_002536514.1| conserved hypothetical protein [Ricinus communis]
 gi|223519419|gb|EEF25867.1| conserved hypothetical protein [Ricinus communis]
          Length = 120

 Score =  110 bits (275), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/105 (42%), Positives = 69/105 (65%)

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              LYLE++DAS S DGVI +FA+T N  II +GL IGA++VRS+TL +++ G L +Y++
Sbjct: 1   MGLLYLELLDASFSFDGVIGAFAVTNNILIITLGLGIGAMFVRSITLHLVETGKLAEYRF 60

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           LEH ++++I  L+ +       DIP+   G    +LI L + SS+
Sbjct: 61  LEHSAFWAIGALAALTISGVHWDIPDGVAGLLGGLLIGLGLLSSM 105


>gi|218674533|ref|ZP_03524202.1| hypothetical protein RetlG_25252 [Rhizobium etli GR56]
          Length = 83

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 58/83 (69%)

Query: 1  MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
          M   + + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1  MNQPATHESSLGYFRWAFIVTALGLILGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 60

Query: 61 FENAILNAKNLQKMSSIWQKRFL 83
          F+NAI+NA  L++M+ +WQKRFL
Sbjct: 61 FDNAIVNANKLKEMTPLWQKRFL 83


>gi|262340884|ref|YP_003283739.1| integral membrane protein TerC family [Blattabacterium sp.
           (Blattella germanica) str. Bge]
 gi|262272221|gb|ACY40129.1| integral membrane protein TerC family [Blattabacterium sp.
           (Blattella germanica) str. Bge]
          Length = 235

 Score = 76.4 bits (187), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 62/111 (55%), Gaps = 4/111 (3%)

Query: 211 IIFYGINFL--ESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFI 268
           +IF G N    ++  SS +S N+        + L++EI+D S S+D + +S A+++NF +
Sbjct: 90  LIFVGFNHFLTKNNFSSKNSKNIKRKDSFWKIVLFIEIMDLSFSIDNIFASVALSENFLL 149

Query: 269 IVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI 319
           I +G+ IG + +R +    ++  ++ K+  L++ ++  I VL + +   + 
Sbjct: 150 IFLGVFIGILSMRLIAQFFIQ--LMEKFPELKNSAFLIIIVLGIKLIFSSF 198


>gi|78189682|ref|YP_380020.1| hypothetical protein Cag_1726 [Chlorobium chlorochromatii CaD3]
 gi|78171881|gb|ABB28977.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 255

 Score = 68.3 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
             +  L +E++D + S+D V ++ A T+N  +I +G+ IG + +R +    +  G++ ++
Sbjct: 127 FWSTVLLIEMMDLAFSIDNVFAAVAFTENLLLIYLGVFIGILAMRFVAQGFV--GLMERF 184

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVD 321
            +LE  ++  I VL V + L ++  
Sbjct: 185 PFLETSAFLVIGVLGVKLLLSSLSH 209


>gi|189347345|ref|YP_001943874.1| Integral membrane protein TerC [Chlorobium limicola DSM 245]
 gi|189341492|gb|ACD90895.1| Integral membrane protein TerC [Chlorobium limicola DSM 245]
          Length = 266

 Score = 66.0 bits (160), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
              +  + +E++D + S+D V ++ A + N  +I +G+ IG + +R +    ++  ++ +
Sbjct: 131 AFWSTVILIEVMDLAFSIDNVFAAVAFSDNIVLIWLGVFIGILAMRFVAQGFVR--LMEE 188

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVD 321
           Y +LE  ++  + +L V +       
Sbjct: 189 YPFLETCAFIVLGILGVKLSFSVFEH 214


>gi|256420221|ref|YP_003120874.1| integral membrane protein TerC [Chitinophaga pinensis DSM 2588]
 gi|256035129|gb|ACU58673.1| Integral membrane protein TerC [Chitinophaga pinensis DSM 2588]
          Length = 271

 Score = 64.9 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 2/86 (2%)

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
                   +EI+D + S+D V ++ A + N  +I  G+ IG + +R +    ++  ++ K
Sbjct: 137 QFWATVALVEIMDLAFSIDNVFAAVAFSDNIVLIWTGVFIGILAMRFVAQGFVR--LMEK 194

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVD 321
           Y +LE  ++  I VL + + L     
Sbjct: 195 YPFLETAAFLVIGVLGIKLMLAIYEH 220


>gi|149279507|ref|ZP_01885637.1| hypothetical protein PBAL39_16946 [Pedobacter sp. BAL39]
 gi|149229800|gb|EDM35189.1| hypothetical protein PBAL39_16946 [Pedobacter sp. BAL39]
          Length = 266

 Score = 63.7 bits (154), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
           +       +E++D + S+D V ++ A T++ ++I IG+ IG + +R +    +K  ++ K
Sbjct: 127 NFWATVALVEVMDLAFSIDNVFAAVAFTEHIWLIYIGVFIGILAMRFVAQGFVK--LMEK 184

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVD 321
           + +LE  ++  I VL + +       
Sbjct: 185 FPFLETVAFIVIGVLGIKLTSSIFTH 210


>gi|110597246|ref|ZP_01385534.1| Integral membrane protein TerC [Chlorobium ferrooxidans DSM 13031]
 gi|110341082|gb|EAT59550.1| Integral membrane protein TerC [Chlorobium ferrooxidans DSM 13031]
          Length = 254

 Score = 63.7 bits (154), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 47/91 (51%), Gaps = 3/91 (3%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
             +  L +E++D + S+D + ++ A T N  +I  G+ IG + +R +    ++  ++ KY
Sbjct: 127 FWSTVLLIEMMDLAFSIDNIFAAVAFTDNIVLIWTGVFIGILAMRFVAQGFVR--LMEKY 184

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVDI-PEIF 326
            +LE  ++  I +L + + L  +    PE  
Sbjct: 185 PFLETSAFVVIGLLGLKLTLSAVEHFYPETV 215


>gi|327404595|ref|YP_004345433.1| integral membrane protein, YkoY family [Fluviicola taffensis DSM
           16823]
 gi|327320103|gb|AEA44595.1| integral membrane protein, YkoY family [Fluviicola taffensis DSM
           16823]
          Length = 251

 Score = 62.9 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
             +  L +E +D   S+D + +  A ++N  +I IG+ IG + +R +    +   ++ KY
Sbjct: 132 FWSTVLAVEFMDIVFSIDNIFAVVAYSENIVLICIGVFIGILAMRYVAKYFV--VLMEKY 189

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVD 321
            +LE+ ++  I +L V + L  +V 
Sbjct: 190 PFLENSAFLVIGILGVKLCLALLVH 214


>gi|194337745|ref|YP_002019539.1| Integral membrane protein TerC [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194310222|gb|ACF44922.1| Integral membrane protein TerC [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 255

 Score = 62.9 bits (152), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
              +  L +E++D + S+D + ++ A T N  +I +G+ IG + +R +    +  G++ +
Sbjct: 126 AFWSTVLLIEMMDLAFSIDNIFAAVAFTDNLILICVGVFIGILAMRFVAQGFV--GLMER 183

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVD 321
           Y +LE  ++  I +L + +    I  
Sbjct: 184 YPFLETCAFVVIGLLGIKLSFSVIEH 209


>gi|119357573|ref|YP_912217.1| integral membrane protein TerC [Chlorobium phaeobacteroides DSM
           266]
 gi|119354922|gb|ABL65793.1| Integral membrane protein TerC [Chlorobium phaeobacteroides DSM
           266]
          Length = 259

 Score = 60.6 bits (146), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
             +  + +E++D + S+D + ++ A T N  +I  G+ IG + +R +    ++  ++  Y
Sbjct: 127 FWSTVILIELMDLAFSIDNIFAAVAFTDNIILIWFGVFIGILAMRFVAQGFVR--LMELY 184

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVD 321
            +LE  ++  I VL V + +     
Sbjct: 185 PFLETCAFIVIGVLGVKLSVSVFEH 209


>gi|300776093|ref|ZP_07085952.1| TerC family membrane protein [Chryseobacterium gleum ATCC 35910]
 gi|300505226|gb|EFK36365.1| TerC family membrane protein [Chryseobacterium gleum ATCC 35910]
          Length = 263

 Score = 60.2 bits (145), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 42/86 (48%), Gaps = 2/86 (2%)

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
                   +E++D + S+D V ++ A + N  +I +G+ IG + +R +    ++  ++  
Sbjct: 135 QFWATVAIVEVMDLAFSIDNVFAAVAFSDNLLLITLGVFIGILAMRFIAQWFVR--LMQV 192

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVD 321
           + +LE  ++  I VL + + L     
Sbjct: 193 FPFLETAAFIVIAVLGIKLSLSLYEH 218


>gi|312886205|ref|ZP_07745820.1| Integral membrane protein TerC [Mucilaginibacter paludis DSM 18603]
 gi|311301312|gb|EFQ78366.1| Integral membrane protein TerC [Mucilaginibacter paludis DSM 18603]
          Length = 272

 Score = 59.1 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                  +E++D + S+D V ++ A T + F+I  G+ IG + +R +    +K  ++ K+
Sbjct: 129 FWATVALVELMDLAFSIDNVFAAVAFTDHVFLIYTGVFIGILAMRFVAQAFVK--LMEKF 186

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVD 321
            +LE  ++  I VL + +     V 
Sbjct: 187 SFLETVAFIVIGVLGIKLTASIYVH 211


>gi|184156167|ref|YP_001844507.1| hypothetical protein LAF_1691 [Lactobacillus fermentum IFO 3956]
 gi|227515297|ref|ZP_03945346.1| TerC family membrane protein [Lactobacillus fermentum ATCC 14931]
 gi|260662397|ref|ZP_05863292.1| integral membrane protein [Lactobacillus fermentum 28-3-CHN]
 gi|183227511|dbj|BAG28027.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956]
 gi|227086357|gb|EEI21669.1| TerC family membrane protein [Lactobacillus fermentum ATCC 14931]
 gi|260553088|gb|EEX26031.1| integral membrane protein [Lactobacillus fermentum 28-3-CHN]
 gi|299783638|gb|ADJ41636.1| Integral membrane protein [Lactobacillus fermentum CECT 5716]
          Length = 269

 Score = 59.1 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 33/159 (20%), Positives = 68/159 (42%), Gaps = 2/159 (1%)

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
           +     I      Y    +     + F+G + L     S     +T  K    +   +E 
Sbjct: 86  LIHFWEIKALGAAYLMYMAYRFFHVKFFGKHSLHKDKKSSRLGKLTGRKRFWAVVAQIEF 145

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
            D   S+D V+++ A++ N  I++IG  IG + +R +   +++  ++ K   LE  +Y  
Sbjct: 146 TDIVFSIDSVLAALAVSNNPVIVLIGGLIGILCMRGIAEFIMR--LMRKVPELEPMAYVL 203

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           I V++V +FL       EI +G     ++ +   + + +
Sbjct: 204 IAVIAVKLFLTIPAIDIEIPSGLFGIFILLVFALTGVVH 242


>gi|310640471|ref|YP_003945229.1| terc-like protein [Paenibacillus polymyxa SC2]
 gi|309245421|gb|ADO54988.1| TerC-like protein [Paenibacillus polymyxa SC2]
          Length = 244

 Score = 58.3 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 31/182 (17%), Positives = 71/182 (39%), Gaps = 4/182 (2%)

Query: 167 IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD 226
             +    + + +   I+ + IF    I     +  F             I +     S  
Sbjct: 58  KHLPKEQQKRALFYGILGAYIFRFLAIGLGTFLIKFTLIKVLGAAYLLYIAYKGLFKSEG 117

Query: 227 SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLL 286
                          L +E++D + S+D VI++F +++  +++ +G  +G + +R +  +
Sbjct: 118 DGEVKNKPTSFWKTVLMVELMDIAFSIDSVIAAFGVSEKVWVLFLGGILGVLMMRGVAQV 177

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIF-TGTSSTILIFLSIYSSIK 344
            LK  +++K+  LE  ++  I ++   M        + ++   G    + +   I SS K
Sbjct: 178 FLK--LIDKFPELEQTAFIMIAIIGGKMLAAAFGFHMSQVLFFGILIAVFVGTMILSSAK 235

Query: 345 NK 346
            K
Sbjct: 236 RK 237


>gi|308067725|ref|YP_003869330.1| hypothetical protein PPE_00943 [Paenibacillus polymyxa E681]
 gi|305857004|gb|ADM68792.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 244

 Score = 57.9 bits (139), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 30/182 (16%), Positives = 71/182 (39%), Gaps = 4/182 (2%)

Query: 167 IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD 226
             +    + + +   I+ + IF    I     +  F             I +     S  
Sbjct: 58  KHLPKEQQKRALFYGILGAYIFRFLAIGLGTFLIKFTLIKVLGAAYLLYIAYKGLFKSEG 117

Query: 227 SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLL 286
                          L +E++D + S+D VI++F +++  +++ +G  +G + +R +  +
Sbjct: 118 DGEVKNKPTSFWKTVLMVELMDIAFSIDSVIAAFGVSEKVWVLFLGGILGVLMMRGVAQV 177

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIF-TGTSSTILIFLSIYSSIK 344
            LK  +++K+  LE  ++  I ++   M        + ++   G    + +   + SS K
Sbjct: 178 FLK--LIDKFPELEQTAFIMIAIIGGKMLAAAFGFHMSQVLFFGILIAVFVGTMVISSAK 235

Query: 345 NK 346
            K
Sbjct: 236 RK 237


>gi|21674882|ref|NP_662947.1| hypothetical protein CT2072 [Chlorobium tepidum TLS]
 gi|21648106|gb|AAM73289.1| membrane protein, putative [Chlorobium tepidum TLS]
          Length = 257

 Score = 57.5 bits (138), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                L++E++D + S+D V ++ A T N  ++  G+ IG + +R +    ++  ++ +Y
Sbjct: 128 FWATVLFVEMMDIAFSIDNVFAAVAFTDNLILVCTGVFIGILVMRFVAYGFIR--LMEEY 185

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVDI 322
            +LE  +Y  + VL + +       +
Sbjct: 186 PFLESCAYIVLAVLGLRLTFSFFEHL 211


>gi|78212834|ref|YP_381613.1| TerC family protein [Synechococcus sp. CC9605]
 gi|78197293|gb|ABB35058.1| TerC family protein [Synechococcus sp. CC9605]
          Length = 245

 Score = 57.5 bits (138), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 81/186 (43%), Gaps = 16/186 (8%)

Query: 170 SHLSKIKGIKIFIVL-SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSS 228
             L+   GI I +VL   +  ++  +  N     ++++    +++  ++   +    D  
Sbjct: 57  EKLALNLGIGIALVLRIALIIVAQWVLQNAWVQLLAAA---YLVWLVVDHFNNRSGPDGE 113

Query: 229 NNVTHGKHGLN-----LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSM 283
           +N ++   GL+       L L   D + S+D V ++ AI+    +I  G  IG + +R  
Sbjct: 114 SNESNESSGLSRPFLNTVLLLAFTDLAFSIDSVAAAVAISDQIVLISTGAFIGIVALRFT 173

Query: 284 TLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDI---PEIFTGTSSTILIFLSIY 340
           + L ++   L+ Y  LE   + ++  +++ + +  ++     P+  T     +L    + 
Sbjct: 174 SALFIR--WLDLYPRLETAGFLAVAFVALRLIVHVVLPSLNQPDWLTLLVVLMLFAWGM- 230

Query: 341 SSIKNK 346
            SI++ 
Sbjct: 231 -SIRSN 235


>gi|261749599|ref|YP_003257285.1| TerC family membrane protein [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
 gi|261497692|gb|ACX84142.1| integral membrane protein TerC family [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 242

 Score = 57.2 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 58/113 (51%), Gaps = 4/113 (3%)

Query: 211 IIFYGINFL--ESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFI 268
           +I+ G+N+       S   + +         + L +EI+D + S+D + ++ A+++NF +
Sbjct: 92  LIYLGLNYFFSSKNSSLKKNKDRKLRNSFWMVLLSIEIMDLAFSIDNLFAAVALSENFLL 151

Query: 269 IVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD 321
           I +G+ IG + +R      +K  +L  Y +L++ ++  I +L + + L   + 
Sbjct: 152 IFLGVFIGILAMRFAAQGFVK--LLEFYPFLKNSAFSVILLLGIKLLLSPFIH 202


>gi|167957193|ref|ZP_02544267.1| integral membrane protein [candidate division TM7 single-cell
          isolate TM7c]
          Length = 75

 Score = 57.2 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 45/82 (54%), Gaps = 9/82 (10%)

Query: 5  SLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENA 64
              +L+  FR++I +TV          WQ +         +++  +L ++E++ SF+NA
Sbjct: 3  RKQNNLLGIFRFSIFLTVI---LAGLTFWQLS------WQGLWLFFVLLILEVTFSFDNA 53

Query: 65 ILNAKNLQKMSSIWQKRFLTWG 86
          ++N++ L  MS IWQ+ FLT G
Sbjct: 54 VVNSRTLASMSLIWQRIFLTVG 75


>gi|28379085|ref|NP_785977.1| integral membrane protein [Lactobacillus plantarum WCFS1]
 gi|254557217|ref|YP_003063634.1| integral membrane protein [Lactobacillus plantarum JDM1]
 gi|300767994|ref|ZP_07077901.1| tellurium resistance protein [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308181281|ref|YP_003925409.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|28271923|emb|CAD64828.1| integral membrane protein [Lactobacillus plantarum WCFS1]
 gi|254046144|gb|ACT62937.1| integral membrane protein [Lactobacillus plantarum JDM1]
 gi|300494447|gb|EFK29608.1| tellurium resistance protein [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308046772|gb|ADN99315.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 257

 Score = 57.2 bits (137), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 74/174 (42%), Gaps = 10/174 (5%)

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGI----NFLESVLSSDSSNNVTHGKH 236
           +I   +I GI   L +      + ++    +++       N  +               +
Sbjct: 74  YIFRFLIIGIGTYLISFWEIKVLGAAYLGYLVYRYFSQPKNGAKVAQKPKQQRRFFGLSN 133

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
             ++ + +E++D   S+D V++S AI+ N  I++IG  IG   +R +  ++++  ++ K 
Sbjct: 134 FWSVVIQIEMMDIIFSIDSVLASLAISDNPVIVLIGGMIGIACMRGIAEVIMR--LMRKI 191

Query: 297 KYLEHGSYYSIFVLSVIMFLQ---TIVDIPE-IFTGTSSTILIFLSIYSSIKNK 346
             LE  +Y  I ++++ +F+       DIP   F G      I   +    + +
Sbjct: 192 PELETMAYCLIVLIAIKLFISIPAIGWDIPATAFGGIVLVAFIITLLIHFWRRR 245


>gi|218458418|ref|ZP_03498509.1| hypothetical protein RetlK5_02743 [Rhizobium etli Kim 5]
          Length = 56

 Score = 56.8 bits (136), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 1  MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVE 56
          M       S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+E
Sbjct: 1  MNQIGTDKSSLSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICAVLAVLE 56


>gi|86608562|ref|YP_477324.1| TerC family membrane protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557104|gb|ABD02061.1| membrane protein, TerC family [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 295

 Score = 56.4 bits (135), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 64/159 (40%), Gaps = 12/159 (7%)

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYL 244
             I   +  L       F+ +     + +                ++T   +     + +
Sbjct: 70  IAIVFAAVWLVEYPPAQFLGACYLLWLAWQHFRG----EEEGQEQDITRHANFWQTLVMV 125

Query: 245 EIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSY 304
           E+ D   S D + +S  +++  ++I++G  +G   +R M  L L+   L+++ +LE  ++
Sbjct: 126 ELTDLVFSFDSIAASVGVSRKAWVIILGGILGITLMRYMASLFLR--WLDEFSHLEDAAF 183

Query: 305 YSIFVLSVIMFLQTIV---DIPEIFTGTSSTILIFLSIY 340
             I ++   M L+      ++PE   G     +I L ++
Sbjct: 184 AIIALVGSTMLLEVFFPQIELPEW--GMV-VAVIPLFVW 219



 Score = 37.9 bits (87), Expect = 2.1,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 42  TISTVYICIILAVVEISLSFENAILNAKNLQKM-SSIWQKRFLTWGILIAVFGMRIIFPI 100
           T + +++ + L  +E +LS +NA+  A  ++ + +   Q R L WGI I  +  RI    
Sbjct: 16  TWTDIFLVVALVFLEAALSADNAVALAALVKHLPTPQQQNRALRWGI-IGAYSFRIAIVF 74

Query: 101 MIVCIV 106
             V +V
Sbjct: 75  AAVWLV 80


>gi|172037084|ref|YP_001803585.1| hypothetical protein cce_2169 [Cyanothece sp. ATCC 51142]
 gi|171698538|gb|ACB51519.1| hypothetical protein cce_2169 [Cyanothece sp. ATCC 51142]
          Length = 252

 Score = 56.0 bits (134), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 71/168 (42%), Gaps = 8/168 (4%)

Query: 174 KIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAA--IIIFYGINFLESVLSSDSSNNV 231
           +   + + +V++ +  +S IL    +  F          +++   N+  S  +    ++ 
Sbjct: 51  QRSALNVGLVVAYVLRMSLILTATWVVQFWQFELLGATYLLWLVFNYFTSEENEQDHHHG 110

Query: 232 THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
                       + + D + SLD V ++ A+    ++I+ G TIG I +R +  L ++  
Sbjct: 111 PEFASLWQAIPLIAVTDLAFSLDSVTTAIALADEIWLILAGGTIGVITLRFLAELFIR-- 168

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQTI---VDIPEIF-TGTSSTILI 335
            L +Y YLE   + ++  + + + ++ I      PE    G  + I I
Sbjct: 169 WLKEYTYLEDAGFITVGFVGLRLLVRVINPEWVPPEWLMIGAIAVIFI 216


>gi|304406511|ref|ZP_07388167.1| Integral membrane protein TerC [Paenibacillus curdlanolyticus YK9]
 gi|304344569|gb|EFM10407.1| Integral membrane protein TerC [Paenibacillus curdlanolyticus YK9]
          Length = 246

 Score = 55.2 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/182 (14%), Positives = 72/182 (39%), Gaps = 4/182 (2%)

Query: 167 IAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD 226
             +    + + +   ++ + +F    I     +                I +      SD
Sbjct: 60  RHLPKEQQKRALFYGLLGAYVFRFLAIGLGTYLVKITLVKVLGAAYLLFIAYKGLFKGSD 119

Query: 227 SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLL 286
                          L +E++D + S+D VI++F ++   +++ +G  +G + +R +  +
Sbjct: 120 EGETSNKNYGFWKTVLMVELMDIAFSIDSVIAAFGVSDQVWVLFVGGILGVLMMRGVAQV 179

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPE-IFTGTSSTILIFLSIYSSIK 344
            LK  +++++  LE  ++  I V++V M        +   +F      +     + S+++
Sbjct: 180 FLK--LIDRFPELEQAAFILIAVIAVKMLAGAFGYHVSHYLFFAAMIVVFGGTMVLSAMR 237

Query: 345 NK 346
           +K
Sbjct: 238 SK 239


>gi|227508668|ref|ZP_03938717.1| TerC family membrane protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227192000|gb|EEI72067.1| TerC family membrane protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 253

 Score = 55.2 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 74/161 (45%), Gaps = 3/161 (1%)

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH-GLNLFLYL 244
           +I G+   L        + S     +++      + V +   +N   H      ++ L +
Sbjct: 78  LIIGLGTYLIHFWEIKVIGSLYLIYLVYSFFRKTKVVRTKKLANQKKHRISLFWSVVLQI 137

Query: 245 EIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSY 304
           E +D   S+D V++S AI+ N  I++IG  IG + +R +  +++K  +++K   L+  +Y
Sbjct: 138 EFMDVVFSVDSVLASLAISPNPVIVLIGGMIGILAMRGVAEVIMK--LMSKIPELQPMAY 195

Query: 305 YSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
             I ++++ + L   +   EI       I+I   I + I +
Sbjct: 196 VLIGIIALKLLLSIPMIDIEIPAPLFGVIVIAAVIITLIIH 236


>gi|227511650|ref|ZP_03941699.1| TerC family membrane protein [Lactobacillus buchneri ATCC 11577]
 gi|227524859|ref|ZP_03954908.1| TerC family membrane protein [Lactobacillus hilgardii ATCC 8290]
 gi|227085144|gb|EEI20456.1| TerC family membrane protein [Lactobacillus buchneri ATCC 11577]
 gi|227087979|gb|EEI23291.1| TerC family membrane protein [Lactobacillus hilgardii ATCC 8290]
          Length = 253

 Score = 55.2 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 74/161 (45%), Gaps = 3/161 (1%)

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH-GLNLFLYL 244
           +I G+   L        + S     +++      + V +   +N   H      ++ L +
Sbjct: 78  LIIGLGTYLIHFWEIKVIGSLYLLYLVYSFFRKTKVVRTKKLANQKKHRISLFWSVVLQI 137

Query: 245 EIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSY 304
           E +D   S+D V++S AI+ N  I++IG  IG + +R +  +++K  +++K   L+  +Y
Sbjct: 138 EFMDVVFSVDSVLASLAISPNPVIVLIGGMIGILAMRGVAEVIMK--LMSKIPELQPMAY 195

Query: 305 YSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
             I ++++ + L   +   EI       I+I   I + I +
Sbjct: 196 VLIGIIALKLLLSIPMIDIEIPAPLFGVIVIAAVIITLIIH 236


>gi|15894694|ref|NP_348043.1| TerC family protein, ortholog of stress responce protein
           [Clostridium acetobutylicum ATCC 824]
 gi|15024355|gb|AAK79383.1|AE007653_4 TerC family protein, ortholog of stress responce protein
           [Clostridium acetobutylicum ATCC 824]
 gi|325508832|gb|ADZ20468.1| TerC family protein [Clostridium acetobutylicum EA 2018]
          Length = 246

 Score = 54.9 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 69/185 (37%), Gaps = 5/185 (2%)

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
           +  L       +   GI    +   I            +  + ++   ++     +F   
Sbjct: 55  VKHLPKKQQKRALFYGIWGAYIFRFIAIGVGTYLIKIWWVKLIAALY-LLKMTYSHFAGK 113

Query: 222 VLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
               D   +    K        +E++D + S+D V ++F ++   +++ +G   G + +R
Sbjct: 114 AEDDDVDESKVSKKGFWATVATVELMDIAFSIDSVSAAFGVSSKVWVLFLGAVFGILAMR 173

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPE-IFTGTSSTILIFLSI 339
            +  + +   ++ K   +E  +Y  I ++ + M L    ++IP  IF G    +      
Sbjct: 174 GVAQIFV--ALIEKVPEMESSAYVLIGIIGIKMLLNLINIEIPNTIFFGVIVVVFGGTIA 231

Query: 340 YSSIK 344
           +  I+
Sbjct: 232 FHYIR 236


>gi|148658301|ref|YP_001278506.1| tellurium resistance protein TerC [Roseiflexus sp. RS-1]
 gi|148570411|gb|ABQ92556.1| Membrane protein TerC possibly involved in tellurium
           resistance-like protein [Roseiflexus sp. RS-1]
          Length = 285

 Score = 54.9 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/176 (12%), Positives = 74/176 (42%), Gaps = 13/176 (7%)

Query: 153 FNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIII 212
           F ++   H + +   A   +  +     +I   ++  +++I+        + ++    ++
Sbjct: 48  FLTEWSQHVLGYQREAALKVGLLGA---YIGRGLMLALASIIIHVPWLRIIGAA---YLV 101

Query: 213 FYGINFLESVL-----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFF 267
           +  I+    +       +             +  L +E+ D + S+D VI++ A++  F+
Sbjct: 102 YLAIHHFAELYHAHRAETGQEELSRVRGGFWSTVLAIELADLAFSIDNVIAAVALSDEFW 161

Query: 268 IIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIP 323
           ++++G+ IG + +R    +  +  +++    L+ G++  +  +   +  + +  I 
Sbjct: 162 VVMLGVAIGILVMRFAATIFTR--MISWEPALQTGAFLLLMAIGAELLAEEVWHIH 215


>gi|301066616|ref|YP_003788639.1| hypothetical protein LCAZH_1558 [Lactobacillus casei str. Zhang]
 gi|300439023|gb|ADK18789.1| conserved hypothetical protein [Lactobacillus casei str. Zhang]
          Length = 329

 Score = 54.5 bits (130), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 54/124 (43%), Gaps = 5/124 (4%)

Query: 225 SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMT 284
           S +  N           + +E +D   S+D ++++ A++ N  I++IG  +G   +R + 
Sbjct: 195 SQTGTNKKRSHGLWGTVIQIESLDIVFSVDSILAALAVSSNPVIVLIGGCLGIFAMRLVA 254

Query: 285 LLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ---TIVDIPEIFTGTSSTILIFLSIYS 341
              +    +++   LE  +Y  + ++++ + L      V  P+        ++   + + 
Sbjct: 255 Q--VITTFIDRVPELETAAYILVGLIAIKLGLSLPMIDVKTPDWLFSVLVVLVFIWAGWR 312

Query: 342 SIKN 345
            +++
Sbjct: 313 HVEH 316


>gi|78184744|ref|YP_377179.1| TerC family protein [Synechococcus sp. CC9902]
 gi|78169038|gb|ABB26135.1| TerC family protein [Synechococcus sp. CC9902]
          Length = 246

 Score = 54.1 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 34/177 (19%), Positives = 76/177 (42%), Gaps = 9/177 (5%)

Query: 170 SHLSKIKGIKIFIVLSI-IFGISNILPTNEMYSFVSSSTAAIIIFYGI---NFLESVLSS 225
             LS   GI + +VL I +  ++  +  +     V++     ++F      N  E+ + S
Sbjct: 57  ERLSLNIGITLALVLRIGLIVVAQWVLQHPWVQLVAAVYLMWLVFDHFWQRNHKEAEIES 116

Query: 226 DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTL 285
           D  +     +  +   + L   D + S+D V ++ AI+    +IV G  IG + +R  + 
Sbjct: 117 DDQDIKKMPRGLVKTVVLLAFTDLAFSIDSVAAAVAISDQVILIVTGAIIGIVALRFTSG 176

Query: 286 LMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSI 339
           L ++   L++Y  LE   + ++  +++ + L      ++ P+  T     +     +
Sbjct: 177 LFIR--WLDEYPRLETAGFLAVAFVALRLILHVVLPFLNQPDWLTLIVVLVFFSWGL 231


>gi|89099926|ref|ZP_01172797.1| YceF [Bacillus sp. NRRL B-14911]
 gi|89085318|gb|EAR64448.1| YceF [Bacillus sp. NRRL B-14911]
          Length = 242

 Score = 54.1 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 31/132 (23%), Positives = 60/132 (45%), Gaps = 4/132 (3%)

Query: 217 NFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIG 276
              E          VT         + +E++D + S+D ++++ A+++  ++I++G  IG
Sbjct: 106 EGEEDEARKPKGWLVTTFGLFWATVISVELMDLAFSVDSILTALAVSEEVWVILLGGMIG 165

Query: 277 AIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIP-EIFTGTSSTIL 334
            + +R +    +   ++NK   LE  +Y  I  ++V M L    + IP EIF G      
Sbjct: 166 ILLMRGVATFFI--SLMNKVPELETTAYALITFIAVKMGLTLVEIHIPNEIFIGVMILAF 223

Query: 335 IFLSIYSSIKNK 346
           I   I  +I+  
Sbjct: 224 IVTFIIHAIRKN 235


>gi|256847650|ref|ZP_05553095.1| integral membrane protein TerC [Lactobacillus coleohominis
           101-4-CHN]
 gi|256715339|gb|EEU30315.1| integral membrane protein TerC [Lactobacillus coleohominis
           101-4-CHN]
          Length = 265

 Score = 53.7 bits (128), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 77/168 (45%), Gaps = 13/168 (7%)

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------SSNNVTHGKHG 237
           +I GI   L        + +     +++    F ++ L+           +  +T  K  
Sbjct: 78  LIIGIGTFLINFWEIKVLGA---IYLMYLSYRFFKNQLTGQHHRRQRKSRAAGLTGRKRF 134

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
             +   +E ID   S+D V++S A++ N  I++IG  IG   +R +  ++++  ++ K  
Sbjct: 135 WAVVAQIEFIDIVFSIDSVLASLAVSSNPVIVLIGGCIGIACMRGVAEIIMR--LMRKIP 192

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            LE  +Y  IF++++ +FL   +   EI +G     ++ + I + I +
Sbjct: 193 ELEPMAYVLIFLIAIKLFLTIPMIDIEIPSGQFGIFIVGVFIATFIVH 240


>gi|260434904|ref|ZP_05788874.1| TerC family protein [Synechococcus sp. WH 8109]
 gi|260412778|gb|EEX06074.1| TerC family protein [Synechococcus sp. WH 8109]
          Length = 245

 Score = 53.3 bits (127), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 31/147 (21%), Positives = 67/147 (45%), Gaps = 5/147 (3%)

Query: 177 GIKIFIVL-SIIFGISNILPTNEMYSFVSSS--TAAIIIFYGINFLESVLSSDSSNNVTH 233
           GI I +VL   +  ++  +  N     V++S     ++  +     +   SS+ + +   
Sbjct: 64  GIGIALVLRIALIVVAQWVLQNAWVQLVAASYLVWLVVDHFSNRSGDDAESSEGNESDGL 123

Query: 234 GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
            +  LN  L L   D + S+D V ++ AI+    +I  G  IG + +R  + L ++   L
Sbjct: 124 SRPFLNTVLLLAFTDLAFSIDSVAAAVAISDQIVLISTGAFIGIVALRFTSALFIR--WL 181

Query: 294 NKYKYLEHGSYYSIFVLSVIMFLQTIV 320
           + Y  LE   + ++  +++ + +  +V
Sbjct: 182 DLYPRLETAGFLAVAFVALRLIVHVVV 208


>gi|291295377|ref|YP_003506775.1| Integral membrane protein TerC [Meiothermus ruber DSM 1279]
 gi|290470336|gb|ADD27755.1| Integral membrane protein TerC [Meiothermus ruber DSM 1279]
          Length = 245

 Score = 53.3 bits (127), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 26/114 (22%), Positives = 53/114 (46%), Gaps = 9/114 (7%)

Query: 223 LSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRS 282
           L +  +  V   +        +E+ D + ++D V+ + A++ N +II  G+ IG + +R 
Sbjct: 99  LEAPQTLQVVTPRQFWATVAQIELADLAFAVDSVLVAVALSDNLWIIFTGVFIGILALRF 158

Query: 283 MTLLMLKQGILNKYKYLEHGSYYSIFVLSVIM-------FLQTIVDIPEIFTGT 329
           + +L +  G+L KY   E  ++  +    V +       F + ++  PE  TG 
Sbjct: 159 VAVLFV--GLLEKYPRFESVAFAVVGFAGVKLAIGGWDKFAKEVLSRPEWVTGI 210



 Score = 37.9 bits (87), Expect = 2.4,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 44  STVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVF--GMRIIFPIM 101
             + +  IL V+E  LS +NA++    ++++   W++R L +GIL A    GM ++F + 
Sbjct: 6   QALIVIGILIVLEAVLSADNAMVLGVMVRQLPPPWRQRALFYGILGAYVLRGMALVFAVY 65

Query: 102 IV 103
           ++
Sbjct: 66  LI 67


>gi|116070619|ref|ZP_01467888.1| TerC family protein [Synechococcus sp. BL107]
 gi|116066024|gb|EAU71781.1| TerC family protein [Synechococcus sp. BL107]
          Length = 246

 Score = 52.9 bits (126), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 72/179 (40%), Gaps = 13/179 (7%)

Query: 170 SHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN 229
             LS   GI + +VL I   ++       ++  + ++    +++   +       ++  +
Sbjct: 57  ERLSLNIGITMALVLRIGLIVAAQWVLQHLWVQLVAAAY--LMWLVFDHFWQRNQAEIQD 114

Query: 230 NVTHG------KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSM 283
           N          +  +   + L   D + S+D V ++ A++    +I     IG + +R  
Sbjct: 115 NRDEKVIDRLPRSLVKTVILLAFTDLAFSIDSVAAAVAVSDQVILIATAAMIGIVALRFT 174

Query: 284 TLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDI---PEIFTGTSSTILIFLSI 339
           + L ++   L++Y  LE   + ++  +S+ + L  +  +   P+ FT     +     +
Sbjct: 175 SGLFIR--WLDEYPRLETAGFLAVGFVSIRLILHVLFPLLNQPDWFTLLIVLVFFGWGL 231


>gi|239631352|ref|ZP_04674383.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|239525817|gb|EEQ64818.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
          Length = 212

 Score = 52.5 bits (125), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 54/124 (43%), Gaps = 5/124 (4%)

Query: 225 SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMT 284
           S +  N           + +E +D   S+D ++++ A++ N  I++IG  +G   +R + 
Sbjct: 78  SQTGTNKKRSHGLWGTVIQIESLDIVFSVDSILAALAVSSNPVIVLIGGCLGIFAMRLVA 137

Query: 285 LLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ---TIVDIPEIFTGTSSTILIFLSIYS 341
              +    +++   LE  +Y  + ++++ + L      V  P+        ++   + + 
Sbjct: 138 Q--VITTFIDRVPELETAAYILVGLIAIKLGLSLPMIDVKTPDWLFSVLVVLVFIWAGWR 195

Query: 342 SIKN 345
            +++
Sbjct: 196 HVEH 199


>gi|317970139|ref|ZP_07971529.1| membrane protein, TerC family protein [Synechococcus sp. CB0205]
          Length = 242

 Score = 52.5 bits (125), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 70/167 (41%), Gaps = 11/167 (6%)

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL---- 240
            I+   +  +        +++     +    +   E+       ++ +     +      
Sbjct: 73  LILIAAAQWVLDFWPLQLLAAGYLLWLCVTNLRSSEAEPGDPEPSDDSAADGAVKGLSGV 132

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + L + D + SLD V ++ A++ N  +++IG  +G + +R  ++L ++   L  Y++LE
Sbjct: 133 VVTLALTDLAFSLDSVAAAVAVSDNLLLVMIGGVLGVVALRLTSVLFIR--WLEVYRHLE 190

Query: 301 HGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSIYSSIK 344
              Y ++ ++ + + L+     V  PE   G  + + +  +   S +
Sbjct: 191 AAGYLAVGLVGIRLLLRLVAPQVVPPEW--GLLAVVALLFAWGFSQR 235


>gi|116334366|ref|YP_795893.1| hypothetical protein LVIS_1797 [Lactobacillus brevis ATCC 367]
 gi|116099713|gb|ABJ64862.1| hypothetical protein LVIS_1797 [Lactobacillus brevis ATCC 367]
          Length = 249

 Score = 52.5 bits (125), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 30/144 (20%), Positives = 67/144 (46%), Gaps = 10/144 (6%)

Query: 211 IIFYGINFLESVLSSDSSNNVTHGKH-----GLNLFLYLEIIDASLSLDGVISSFAITKN 265
           +++    F        +    +  KH        + L +E++D   S+D V++S AI+ N
Sbjct: 101 LLYLVFQFFTRTRVKHTRKLASEKKHRWLPLFWAVVLQIEMMDIIFSVDSVLASLAISSN 160

Query: 266 FFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ---TIVDI 322
             I++IG  IG + +R +  ++++  ++ K   LE  +Y  I +++V +F+      ++I
Sbjct: 161 PVIVLIGGLIGILAMRGVAEVIMR--LMQKIPELEPMAYILIALIAVKLFISIPAIDIEI 218

Query: 323 PEIFTGTSSTILIFLSIYSSIKNK 346
           P    G      I +++   +  +
Sbjct: 219 PATLFGLLVVGAIIVTLIIHVIRR 242


>gi|258513899|ref|YP_003190121.1| Integral membrane protein TerC [Desulfotomaculum acetoxidans DSM
           771]
 gi|257777604|gb|ACV61498.1| Integral membrane protein TerC [Desulfotomaculum acetoxidans DSM
           771]
          Length = 247

 Score = 52.2 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/140 (17%), Positives = 65/140 (46%), Gaps = 4/140 (2%)

Query: 208 AAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFF 267
           A+ +++  + F     +    +            + +E++D + S+D ++++F ++   +
Sbjct: 99  ASYLLWIALKFFIKKNNESEESVNVKATGFWGTVITVELMDITFSVDSILAAFGVSDKVW 158

Query: 268 IIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPE-I 325
           ++ +G  +G + +R +  L L   +L K+  LE  +Y  I ++   +      + +PE +
Sbjct: 159 VLYLGGILGILMMRGVAQLFL--LLLEKFPELEATAYILIALIGAKLMGSAFGLHLPEFV 216

Query: 326 FTGTSSTILIFLSIYSSIKN 345
           F    +++ I   +YS  + 
Sbjct: 217 FFPVMASVFIGTLVYSHFRK 236


>gi|67922090|ref|ZP_00515605.1| Integral membrane protein TerC [Crocosphaera watsonii WH 8501]
 gi|67855990|gb|EAM51234.1| Integral membrane protein TerC [Crocosphaera watsonii WH 8501]
          Length = 250

 Score = 51.8 bits (123), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 34/177 (19%), Positives = 78/177 (44%), Gaps = 9/177 (5%)

Query: 174 KIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAA--IIIFYGINFLESVLSSDSSNNV 231
           +   + + +V++ +  +S IL    +  F          +++   N+  S  + + +++ 
Sbjct: 51  QRSALNLGLVVAYVLRMSLILTATWVVKFWQFELLGAIYLLWLVFNYFTSQDNEEDNHHG 110

Query: 232 THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
                       + + D + SLD V ++ A+    ++I++G TIG I +R +  L ++  
Sbjct: 111 PEFASLWQAIPLIAVTDLAFSLDSVTTAIALADEIWLILLGGTIGVITLRFLAELFIR-- 168

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTG---TSSTILIFLSIYSSIKN 345
            LN+Y YLE   + ++  + + +  + I   PE+        S I +  +   S +N
Sbjct: 169 WLNEYTYLEDAGFITVGFVGLRLLFRVIN--PELVPPQWLMISAIALVFAWGFSKRN 223


>gi|226315455|ref|YP_002775351.1| tellurium resistance protein [Brevibacillus brevis NBRC 100599]
 gi|226098405|dbj|BAH46847.1| putative tellurium resistance protein [Brevibacillus brevis NBRC
           100599]
          Length = 296

 Score = 51.8 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 49/289 (16%), Positives = 112/289 (38%), Gaps = 49/289 (16%)

Query: 30  GIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILI 89
              W+    +    +   I + L ++E  LS +NA++ A  +  +    +KR L +G+L 
Sbjct: 14  FFSWEVLQGVLTNPANWTIILSLVILEGLLSADNALVLAVMVNHLPEKQKKRALFYGLLG 73

Query: 90  AVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSL 149
           A      +F  + + +   +  + A+ +                      G  +L+ ++ 
Sbjct: 74  A-----YLFRFLAIGLGVFLVKMTAIKVM---------------------GALYLLKIAA 107

Query: 150 TFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAA 209
             FF    K                    +  I L +  G++  L    +          
Sbjct: 108 DHFFGHNEK-------------------AQKAIDLLLYLGMAACLYFIPIPVVQILG--G 146

Query: 210 IIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFII 269
           ++I + +  L      + +     GK      L +E++D + S+D V+++F ++   +++
Sbjct: 147 LLIVWLLYRLFKSGGEEENETENKGKGFWQTVLAVEMMDIAFSIDSVLAAFGVSNQVWVL 206

Query: 270 VIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
            +G  +G + +R +  + LK  ++ +    E  ++  I ++SV MFL  
Sbjct: 207 FLGGILGVLMMRGVAQIFLK--LIERIPEFETTAFVLIALISVKMFLGA 253


>gi|86606211|ref|YP_474974.1| TerC family membrane protein [Synechococcus sp. JA-3-3Ab]
 gi|86554753|gb|ABC99711.1| membrane protein, TerC family [Synechococcus sp. JA-3-3Ab]
          Length = 268

 Score = 51.4 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/158 (15%), Positives = 61/158 (38%), Gaps = 9/158 (5%)

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYL 244
             I   +  L       F+ +     +++                ++T   +     + +
Sbjct: 75  IAIVFAAVWLVEYPPAQFLGAC---YLLWLAWQHFRGEEEGPEQ-DITRQANFWQTLVMV 130

Query: 245 EIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSY 304
           E+ D   S D + +S  +++  ++I++G  +G   +R M  L L+   L+++  LE  ++
Sbjct: 131 ELTDLVFSFDSIAASVGVSRKAWVIILGGILGITLMRYMASLFLR--WLDEFSRLEDAAF 188

Query: 305 YSIFVLSVIMFLQTIV---DIPEIFTGTSSTILIFLSI 339
             I ++  +M L+      ++PE     +   L     
Sbjct: 189 AIIALVGSLMLLEVFFPQIELPEWGMVLAVLPLFVWGF 226



 Score = 37.9 bits (87), Expect = 2.1,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 42  TISTVYICIILAVVEISLSFENAILNAKNLQKM-SSIWQKRFLTWGILIAVFGMRIIFPI 100
           T + +++ + L  +E +LS +NA+  A  ++ + +   Q R L WGI I  +G RI    
Sbjct: 21  TWTDLFLVVALVFLEAALSADNAVALAALVKHLPTPQQQNRALRWGI-IGAYGFRIAIVF 79

Query: 101 MIVCIV 106
             V +V
Sbjct: 80  AAVWLV 85


>gi|126659845|ref|ZP_01730971.1| hypothetical protein CY0110_24471 [Cyanothece sp. CCY0110]
 gi|126618902|gb|EAZ89645.1| hypothetical protein CY0110_24471 [Cyanothece sp. CCY0110]
          Length = 252

 Score = 51.4 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 29/168 (17%), Positives = 72/168 (42%), Gaps = 8/168 (4%)

Query: 174 KIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAA--IIIFYGINFLESVLSSDSSNNV 231
           +   + + +V++ +  +S IL    +  +          +++   N+  S  +    ++ 
Sbjct: 51  QRSALNVGLVVAYVLRMSLILTATWVVQYWQFELLGATYLLWLVFNYFTSEENEQDEHHG 110

Query: 232 THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
                       + + D + SLD V ++ A+    ++I+ G TIG I +R +  L ++  
Sbjct: 111 PTFTSLWQAIPLIAVTDLAFSLDSVTTAIALADEIWLILAGGTIGVITLRFLAELFIR-- 168

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQTI---VDIPEIF-TGTSSTILI 335
            L +Y +LE   + ++  + + + ++ I      PE    G  ++I +
Sbjct: 169 WLQEYTHLEDAGFITVGFVGLRLLVRVINPEWVPPEWLMIGVIASIFV 216


>gi|156740463|ref|YP_001430592.1| tellurium resistance protein TerC [Roseiflexus castenholzii DSM
           13941]
 gi|156231791|gb|ABU56574.1| membrane protein TerC possibly involved in tellurium
           resistance-like protein [Roseiflexus castenholzii DSM
           13941]
          Length = 281

 Score = 51.0 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 55/126 (43%), Gaps = 7/126 (5%)

Query: 203 VSSSTAAIIIFYGINFLESVLSSDSSNN-----VTHGKHGLNLFLYLEIIDASLSLDGVI 257
           + +  AA +++   +    +  +  +               +  L +E+ D + S+D VI
Sbjct: 92  LRAIGAAYLVYLAFHHFAELYHAHRAEAGHDPIPRARGGFWSTVLAIELADLAFSIDNVI 151

Query: 258 SSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ 317
           ++ A++  F++++ G+ IG + +R    +  +  ++     L+ G++  +  +   +  +
Sbjct: 152 AAVALSDAFWVVMTGVAIGILVMRFAATIFTR--MIAWEPALQTGAFLLLLAIGAELLAE 209

Query: 318 TIVDIP 323
            +  + 
Sbjct: 210 EMWHVH 215


>gi|116492175|ref|YP_803910.1| hypothetical protein PEPE_0372 [Pediococcus pentosaceus ATCC 25745]
 gi|116102325|gb|ABJ67468.1| hypothetical protein PEPE_0372 [Pediococcus pentosaceus ATCC 25745]
          Length = 245

 Score = 51.0 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 75/165 (45%), Gaps = 9/165 (5%)

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
           +I   I+ GI   L        + +     + +    F +       +  +   +  L++
Sbjct: 73  YIFRFIVIGIGTFLIDLWEIKVIGAL---YLAYLVFRFFDKQKRGRKTRKLVKKEGRLSV 129

Query: 241 F----LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
           F    + +E +D   S+D V++S AI+ N  I++IG  IG + +R +  +++K  ++ K 
Sbjct: 130 FWRVVIQIEFMDIVFSVDSVLASLAISSNPVIVLIGGLIGILAMRGIAEVIMK--MMQKI 187

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYS 341
             LE  +Y  I ++++ + L   +   EI +   + I+I   + +
Sbjct: 188 PELETMAYVLIGIIALKLLLSIPMIDIEIPSIVFAGIVILAFLIT 232


>gi|116495053|ref|YP_806787.1| hypothetical protein LSEI_1571 [Lactobacillus casei ATCC 334]
 gi|227534936|ref|ZP_03964985.1| TerC family membrane protein [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|116105203|gb|ABJ70345.1| hypothetical protein LSEI_1571 [Lactobacillus casei ATCC 334]
 gi|227187393|gb|EEI67460.1| TerC family membrane protein [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
          Length = 212

 Score = 51.0 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 56/126 (44%), Gaps = 8/126 (6%)

Query: 226 DSSNNVTHGK---HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRS 282
             +   THGK         + +E +D   S+D ++++ A++ N  I++IG  +G   +R 
Sbjct: 76  PKNQRGTHGKRPHGLWGTVIQIESLDIVFSVDSILAALAVSSNPVIVLIGGCLGIFAMRL 135

Query: 283 MTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ---TIVDIPEIFTGTSSTILIFLSI 339
           +    +    +++   LE  +Y  + ++++ + L      V  P+        ++   + 
Sbjct: 136 VAQ--VITTFIDRVPELETAAYILVGLIAIKLGLSLPMIDVKTPDWLFSVLVVLVFIWAG 193

Query: 340 YSSIKN 345
           +  +++
Sbjct: 194 WRHVEH 199


>gi|218247521|ref|YP_002372892.1| integral membrane protein TerC [Cyanothece sp. PCC 8801]
 gi|257061143|ref|YP_003139031.1| integral membrane protein TerC [Cyanothece sp. PCC 8802]
 gi|218167999|gb|ACK66736.1| Integral membrane protein TerC [Cyanothece sp. PCC 8801]
 gi|256591309|gb|ACV02196.1| Integral membrane protein TerC [Cyanothece sp. PCC 8802]
          Length = 247

 Score = 51.0 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 68/159 (42%), Gaps = 9/159 (5%)

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
           +++  I+   +  +     +  + +     ++F   N+  S       ++    +     
Sbjct: 63  YVLRMILILTATWVIKYWQFELLGALYLLWLVF---NYFTSQEDEKHHHHSIQFQSLWQA 119

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
              + + D + SLD V ++ AI  + ++I++G TIG I +R +  L ++   L ++ YLE
Sbjct: 120 IPLIAVTDLAFSLDSVTTAIAIADDLWLILMGGTIGVITLRFLAELFIR--WLQEFTYLE 177

Query: 301 HGSYYSIFVLSVIMFLQTIVD---IPEIF-TGTSSTILI 335
              + ++  + + + L+ I      PE       + + +
Sbjct: 178 DAGFVTVGFVGIRLLLRVINPELVPPEWLMISLIAMVFV 216


>gi|86158438|ref|YP_465223.1| integral membrane protein TerC [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774949|gb|ABC81786.1| Integral membrane protein TerC [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 320

 Score = 50.2 bits (119), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 55/331 (16%), Positives = 112/331 (33%), Gaps = 74/331 (22%)

Query: 15  RWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM 74
            W  +      +    + W+F    +    T Y+       E SLS +N  +        
Sbjct: 49  GWTAVWAALAAVFAGFVWWRFGANKAIEFVTGYLI------EQSLSVDNLFVFVLVFATF 102

Query: 75  S--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQA 132
           +     Q R L WGI  A F +R++   MIV   +                    ++++ 
Sbjct: 103 AIPPKLQHRVLFWGITTA-FVLRLV---MIVGGTA--------------------LLTRF 138

Query: 133 HVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISN 192
           H  I  F G FL++  +  FF+ + + H     E +++                   +  
Sbjct: 139 HWLIYVF-GAFLVVTGIRIFFHEEQEHH----PEKSVAFR----------------VLRR 177

Query: 193 ILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLS 252
           ++P+                F+ +            N              +E+ D   +
Sbjct: 178 LVPSTSRMEGHH--------FFLVE-----------NGRRVATPLFLALCMIEVSDVVFA 218

Query: 253 LDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSV 312
           LD V + F IT + FI+        + +RS+        +L +++YL+ G    +  + +
Sbjct: 219 LDSVPAIFGITLDPFIVFTSNIFAIMGLRSL--YFAVAQLLRRFEYLKAGLALVLVFIGL 276

Query: 313 IMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            M + + V +    +      L+  ++  S+
Sbjct: 277 KMVVSSWVHVNAFASLGVVVALLGGAMGYSL 307


>gi|148545030|ref|YP_001272400.1| integral membrane protein TerC [Lactobacillus reuteri DSM 20016]
 gi|184154364|ref|YP_001842705.1| hypothetical protein LAR_1709 [Lactobacillus reuteri JCM 1112]
 gi|194467272|ref|ZP_03073259.1| Integral membrane protein TerC [Lactobacillus reuteri 100-23]
 gi|227364178|ref|ZP_03848275.1| TerC family membrane protein [Lactobacillus reuteri MM2-3]
 gi|325683381|ref|ZP_08162897.1| tellurium resistance protein [Lactobacillus reuteri MM4-1A]
 gi|148532064|gb|ABQ84063.1| Integral membrane protein TerC [Lactobacillus reuteri DSM 20016]
 gi|183225708|dbj|BAG26225.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|194454308|gb|EDX43205.1| Integral membrane protein TerC [Lactobacillus reuteri 100-23]
 gi|227070817|gb|EEI09143.1| TerC family membrane protein [Lactobacillus reuteri MM2-3]
 gi|324977731|gb|EGC14682.1| tellurium resistance protein [Lactobacillus reuteri MM4-1A]
          Length = 251

 Score = 50.2 bits (119), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 62/120 (51%), Gaps = 2/120 (1%)

Query: 226 DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTL 285
           +    +T  K    + L +E +D   S+D V++S A++ N  I++IG  IG   +R +  
Sbjct: 123 EGKTRLTGRKLFWTVVLQIEFMDIIFSIDSVLASLAVSNNPVIVLIGGLIGIACMRGIAE 182

Query: 286 LMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +++K  ++ K   LE  +Y  IFV+++ +FL       EI +G   + ++ +   + I +
Sbjct: 183 VIMK--LMRKVPELEPMAYILIFVIAIKLFLTIPAIDIEIPSGIFGSFILLVFAVTIIIH 240


>gi|134298216|ref|YP_001111712.1| integral membrane protein TerC [Desulfotomaculum reducens MI-1]
 gi|134050916|gb|ABO48887.1| Integral membrane protein TerC [Desulfotomaculum reducens MI-1]
          Length = 255

 Score = 50.2 bits (119), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 64/149 (42%), Gaps = 13/149 (8%)

Query: 208 AAIIIFYGINFLESVLSSDSSNNVTHGKHG---------LNLFLYLEIIDASLSLDGVIS 258
           A  +++    F  S        +      G             + +E++D + S+D +++
Sbjct: 103 AGYLLWMAGKFFLSKGEEADEGDGEAKVSGFWLKMVGPFWATVITVELMDITFSVDSILA 162

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
           +FA++   +++ +G  +G + +R +  + +K  +L KY  LE  +Y  I ++   +  Q 
Sbjct: 163 AFAMSNEVWVLFMGGILGILMMRGVATIFIK--LLEKYPELEASAYVLIALIGGKLMGQA 220

Query: 319 I-VDIPE-IFTGTSSTILIFLSIYSSIKN 345
               IP  IF    + +L+   +   ++ 
Sbjct: 221 FGYHIPHGIFFSIMAAVLLGTIVLHHLRE 249


>gi|191638556|ref|YP_001987722.1| Tellurium resistance protein [Lactobacillus casei BL23]
 gi|190712858|emb|CAQ66864.1| Tellurium resistance protein [Lactobacillus casei BL23]
 gi|327382594|gb|AEA54070.1| Putative transporter [Lactobacillus casei LC2W]
 gi|327385792|gb|AEA57266.1| Putative transporter [Lactobacillus casei BD-II]
          Length = 263

 Score = 50.2 bits (119), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 56/126 (44%), Gaps = 8/126 (6%)

Query: 226 DSSNNVTHGK---HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRS 282
             +   THGK         + +E +D   S+D ++++ A++ N  I++IG  +G   +R 
Sbjct: 127 PKNQRGTHGKRPHGLWGTVIQIESLDIVFSVDSILAALAVSSNPVIVLIGGCLGIFAMRL 186

Query: 283 MTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ---TIVDIPEIFTGTSSTILIFLSI 339
           +    +    +++   LE  +Y  + ++++ + L      V  P+        ++   + 
Sbjct: 187 VAQ--VITTFIDRVPELETAAYILVGLIAIKLGLSLPMIDVKTPDWLFSVLVVLVFIWAG 244

Query: 340 YSSIKN 345
           +  +++
Sbjct: 245 WRHVEH 250


>gi|254423338|ref|ZP_05037056.1| Integral membrane protein TerC family [Synechococcus sp. PCC 7335]
 gi|196190827|gb|EDX85791.1| Integral membrane protein TerC family [Synechococcus sp. PCC 7335]
          Length = 270

 Score = 50.2 bits (119), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 72/172 (41%), Gaps = 9/172 (5%)

Query: 174 KIKGIKIFIVLSIIFGISNILPTN---EMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN 230
           + K + I ++++ I  IS IL  +   + + F  +    ++     +FL         + 
Sbjct: 51  QKKALNIGLIVAFILRISLILAASWVLKYWQFEIAGAVYLLWLVYQHFLADD-DDADEHT 109

Query: 231 VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQ 290
                        + + D + SLD V ++ A++K+  I+++G TIG I +R M  L ++ 
Sbjct: 110 GPRFSSLWKAIPTIALTDLAFSLDSVTTAIALSKDVLIVLLGGTIGIIALRFMAGLFIR- 168

Query: 291 GILNKYKYLEHGSYYSIFVLS---VIMFLQTIVDIPEIFTGTSSTILIFLSI 339
             L+ Y +LE   + ++ ++    ++  +      PE    +    L     
Sbjct: 169 -WLSIYVHLEDAGFVTVAIVGLRLIVRVINPEWVPPEWVMVSLIFGLFAWGF 219


>gi|239940902|ref|ZP_04692839.1| hypothetical protein SrosN15_07885 [Streptomyces roseosporus NRRL
           15998]
          Length = 65

 Score = 49.8 bits (118), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 26/42 (61%)

Query: 305 YSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           Y+I  LS+I+ +    +I E+ TG+   ILI LS +SS+K  
Sbjct: 1   YAIGALSIILLITIQHEINELITGSVGVILIALSFWSSVKRN 42


>gi|297565726|ref|YP_003684698.1| Integral membrane protein TerC [Meiothermus silvanus DSM 9946]
 gi|296850175|gb|ADH63190.1| Integral membrane protein TerC [Meiothermus silvanus DSM 9946]
          Length = 245

 Score = 49.8 bits (118), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 57/121 (47%), Gaps = 9/121 (7%)

Query: 216 INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
           +    + L+++        +   ++   +E+ D + ++D V+ + A++ NF+II+ G+ I
Sbjct: 95  LEGETAELTAEGVLKNVTPRQFWSIVAQIELADLAFAVDSVLVAVALSDNFWIILTGVFI 154

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIM-------FLQTIVDIPEIFTG 328
           G + +R +  + +  G+L KY   E  ++  +    V +         + ++  PE  TG
Sbjct: 155 GILALRLVAGVFV--GLLEKYPRFEAVAFAVVGFAGVKLAIGSWDKLAKELLSRPEWVTG 212

Query: 329 T 329
            
Sbjct: 213 I 213


>gi|227545267|ref|ZP_03975316.1| TerC family membrane protein [Lactobacillus reuteri CF48-3A]
 gi|300908663|ref|ZP_07126126.1| tellurium resistance protein [Lactobacillus reuteri SD2112]
 gi|227184757|gb|EEI64828.1| TerC family membrane protein [Lactobacillus reuteri CF48-3A]
 gi|300894070|gb|EFK87428.1| tellurium resistance protein [Lactobacillus reuteri SD2112]
          Length = 251

 Score = 49.8 bits (118), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 63/120 (52%), Gaps = 2/120 (1%)

Query: 226 DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTL 285
           +   ++T  K    + L +E +D   S+D V++S A++ N  I++IG  IG   +R +  
Sbjct: 123 EGKTHLTGRKLFWTVVLQIEFMDIIFSIDSVLASLAVSNNPVIVLIGGLIGIACMRGIAE 182

Query: 286 LMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +++K  ++ K   LE  +Y  IFV+++ +FL       EI +G   + ++ +   + I +
Sbjct: 183 VIMK--LMRKVPELEPMAYILIFVIAIKLFLTIPAIDIEIPSGIFGSFILLVFAVTIIIH 240


>gi|172057348|ref|YP_001813808.1| integral membrane protein TerC [Exiguobacterium sibiricum 255-15]
 gi|171989869|gb|ACB60791.1| Integral membrane protein TerC [Exiguobacterium sibiricum 255-15]
          Length = 301

 Score = 49.8 bits (118), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 55/108 (50%), Gaps = 2/108 (1%)

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L   +++E+ D   ++D V +SFA +++ FII     +  + +RS+    +   +++++ 
Sbjct: 191 LIALIFIEVSDIVFAVDSVAASFAYSRDPFIIFYANIMAILGLRSL--YFVLANLIDRFY 248

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           YL+HG  + +  +   M    +  +P   +  +  ++I +S+  S K 
Sbjct: 249 YLKHGLSFMLVFIGAKMIFSDVYKMPIWMSLGTIVLVILISVIYSFKK 296


>gi|308172156|ref|YP_003918861.1| stress adaptation transporter [Bacillus amyloliquefaciens DSM 7]
 gi|307605020|emb|CBI41391.1| putative stress adaptation transporter [Bacillus amyloliquefaciens
           DSM 7]
 gi|328551966|gb|AEB22458.1| stress adaptation transporter [Bacillus amyloliquefaciens TA208]
 gi|328910234|gb|AEB61830.1| putative stress adaptation transporter [Bacillus amyloliquefaciens
           LL3]
          Length = 257

 Score = 49.5 bits (117), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 55/106 (51%), Gaps = 4/106 (3%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                + +E++D + S+D ++++FA+++  ++++IG  +G + +R  T+  +   +++K 
Sbjct: 135 FWATVVSVELMDLAFSVDSILAAFAVSEKVWVLLIGGMLGILMMR--TVAKVFLVLIDKI 192

Query: 297 KYLEHGSYYSIFVLSVIMFLQTI-VDIPEIF-TGTSSTILIFLSIY 340
             LE+ ++  I +++V M       ++P +   G      +   + 
Sbjct: 193 PELENTAFVLIGIIAVKMAASAFDYEMPHVVFFGIIIAAFVVTFVI 238


>gi|154684787|ref|YP_001419948.1| YceF [Bacillus amyloliquefaciens FZB42]
 gi|154350638|gb|ABS72717.1| YceF [Bacillus amyloliquefaciens FZB42]
          Length = 257

 Score = 49.5 bits (117), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 55/106 (51%), Gaps = 4/106 (3%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                + +E++D + S+D ++++FA+++  ++++IG  +G + +R  T+  +   +++K 
Sbjct: 135 FWATVVSVELMDLAFSVDSILAAFAVSEKVWVLLIGGMLGILMMR--TVAKVFLVLIDKI 192

Query: 297 KYLEHGSYYSIFVLSVIMFLQTI-VDIPEIF-TGTSSTILIFLSIY 340
             LE+ ++  I +++V M       ++P +   G      +   I 
Sbjct: 193 PELENTAFVLIGIIAVKMAASAFDYEMPHVVFFGIIIAAFVVTFII 238


>gi|320159570|ref|YP_004172794.1| hypothetical protein ANT_01600 [Anaerolinea thermophila UNI-1]
 gi|319993423|dbj|BAJ62194.1| hypothetical membrane protein [Anaerolinea thermophila UNI-1]
          Length = 311

 Score = 49.5 bits (117), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 27/184 (14%), Positives = 73/184 (39%), Gaps = 6/184 (3%)

Query: 160 HWIHFLEIAMSHLSKIKGIKIFIVL--SIIFGISNILPTNEMYSFVSSSTAAIIIFYGIN 217
           HW+  +       +   G+    V    ++   S I+    +    ++    + +     
Sbjct: 77  HWLDGVLGPQRLAALRVGLLGAYVGRGLMLLAASFIIRNPWLKLVGAAYLIRLALDDLSA 136

Query: 218 FLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGA 277
             E     D               L +E++D + SLD V+++ +++ +  ++++G+ IG 
Sbjct: 137 PGEQGAEEDGEVRPVRQAGFWLTVLNVELMDLAFSLDNVVAAVSLSDHILVVMLGVAIGI 196

Query: 278 IYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ--TIVDIPEIFTGTSSTILI 335
           + +R    +     ++ +   L+  +Y  +  + + + L+   I++  +      S  +I
Sbjct: 197 LVMRFAAGIF--SYVVEREPILKSAAYILVLSIGIELVLEELGIMEFSDWARFGISMSII 254

Query: 336 FLSI 339
            LS+
Sbjct: 255 ALSL 258


>gi|77920375|ref|YP_358190.1| membrane protein TerC [Pelobacter carbinolicus DSM 2380]
 gi|77546458|gb|ABA90020.1| membrane protein TerC [Pelobacter carbinolicus DSM 2380]
          Length = 284

 Score = 49.5 bits (117), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 61/162 (37%), Gaps = 5/162 (3%)

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAA--IIIFYGI-NF 218
           +  L   +    + + +   I+ + +F    ++    +  F          +I+  + + 
Sbjct: 42  LAILVRNLPRQQQKRALTYGIIGAFVFRFIALVFAAHLMRFGFFKLIGGGYLIYLAMKHM 101

Query: 219 LESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                                + + +E+ D + S+D + ++ A+T    ++ +G  +G I
Sbjct: 102 FFFYKEDAHQLRDKPAAGFWKIVIMVELTDIAFSIDSITTAVAMTDKLLVVWVGGILGII 161

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIV 320
           ++R      ++  +L +   LE  +Y  IF +   +FL    
Sbjct: 162 FLRFAASFFVR--LLERLPRLEDLAYQLIFFIGTKLFLDGFH 201



 Score = 37.5 bits (86), Expect = 2.8,   Method: Composition-based stats.
 Identities = 32/169 (18%), Positives = 63/169 (37%), Gaps = 31/169 (18%)

Query: 46  VYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCI 105
           +     LA++E  LS +NA++ A  ++ +    QKR LT+GI+ A      +F  + +  
Sbjct: 21  LLTIGTLAILEGILSVDNALVLAILVRNLPRQQQKRALTYGIIGA-----FVFRFIALVF 75

Query: 106 VSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLT-FFFNSQNKLHWIHF 164
            + +       L                      GG +L+ +++   FF  +   H +  
Sbjct: 76  AAHLMRFGFFKL---------------------IGGGYLIYLAMKHMFFFYKEDAHQLR- 113

Query: 165 LEIAMSHLSKIKGIKIF--IVLSIIFGISNILPTNEMYSFVSSSTAAII 211
            +   +   KI  +     I  SI    + +  T+++          II
Sbjct: 114 -DKPAAGFWKIVIMVELTDIAFSIDSITTAVAMTDKLLVVWVGGILGII 161


>gi|296332649|ref|ZP_06875109.1| putative stress adaptation transporter [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305672993|ref|YP_003864665.1| putative stress adaptation transporter [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296149929|gb|EFG90818.1| putative stress adaptation transporter [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305411237|gb|ADM36356.1| putative stress adaptation transporter [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 257

 Score = 49.5 bits (117), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 48/84 (57%), Gaps = 2/84 (2%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                + +E++D + S+D ++++FA+++  ++++IG  +G + +R  T+  +   +++K 
Sbjct: 135 FWATVISVELMDLAFSVDSILAAFAVSEKVWVLLIGGMLGILMMR--TVAKVFLVLIDKI 192

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIV 320
             LE+ ++  I ++++ M      
Sbjct: 193 PELENTAFVLIGIIALKMAASAFH 216


>gi|170078439|ref|YP_001735077.1| hypothetical protein SYNPCC7002_A1833 [Synechococcus sp. PCC 7002]
 gi|169886108|gb|ACA99821.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
          Length = 235

 Score = 49.1 bits (116), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 57/128 (44%), Gaps = 5/128 (3%)

Query: 215 GINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT 274
              +  S     + ++    K        + + D + SLD V ++ A+ ++ ++IV+G T
Sbjct: 94  VFRYFTSPEDDKNHHHSLEFKSLWQAIPMIAVTDLAFSLDSVTTAIAVAEDIWLIVLGGT 153

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD---IPEIFTGTSS 331
           IG + +R +  L ++   L+++  LE   + ++  + V + L+ +     +PE    T+ 
Sbjct: 154 IGVLTLRFLAGLFIR--WLDEFTNLEDAGFVTVGFVGVRLLLKAVYPSFVMPEWLMITAI 211

Query: 332 TILIFLSI 339
             +     
Sbjct: 212 AAMFIWGF 219


>gi|197337780|ref|YP_002157869.1| tellurium resistance protein TerC [Vibrio fischeri MJ11]
 gi|197315032|gb|ACH64481.1| tellurium resistance protein TerC [Vibrio fischeri MJ11]
          Length = 318

 Score = 49.1 bits (116), Expect = 0.001,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 74/168 (44%), Gaps = 6/168 (3%)

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
           IF V  II G+       E  S  +SS   +     I F +    +     V+       
Sbjct: 141 IFAVFLIITGVKLWFADTEENSDFASSKLVMFFKKHIPFDDKYHGNQLFAKVSGKTIATP 200

Query: 240 LFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
           L L + +I   D   +LD + + FAIT+  F++        + +RS+    + QG+L+K+
Sbjct: 201 LLLVVIVIMFTDIMFALDSIPAIFAITQEPFLVFAANVFALLGLRSL--YFVLQGMLDKF 258

Query: 297 KYLEHGSYYSIFVLSVIM-FLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            YL+    + +  + + M  + T  ++P + +  +   +I L+I  SI
Sbjct: 259 CYLQPALAFILSFIGIKMFLVGTKYEVPTVISLLTIVAIITLAIIGSI 306


>gi|311070941|ref|YP_003975864.1| putative stress adaptation transporter [Bacillus atrophaeus 1942]
 gi|310871458|gb|ADP34933.1| putative stress adaptation transporter [Bacillus atrophaeus 1942]
          Length = 257

 Score = 48.7 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/106 (20%), Positives = 57/106 (53%), Gaps = 4/106 (3%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                L +E++D + S+D ++++FA+++  ++++IG  +G + +R++  L L   +++K 
Sbjct: 135 FWATVLSVELMDLAFSVDSILAAFAVSEKVWVLLIGGMLGILMMRTVAKLFL--VLIDKI 192

Query: 297 KYLEHGSYYSIFVLSVIMFLQTI-VDIPEI-FTGTSSTILIFLSIY 340
             LE+ ++  I ++++ M       ++P + F G      +   I 
Sbjct: 193 PELENTAFVLIGIIALKMGASAFHYEMPHVYFFGIIIAAFVVTFII 238


>gi|269839441|ref|YP_003324133.1| integral membrane protein TerC [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269791171|gb|ACZ43311.1| Integral membrane protein TerC [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 313

 Score = 48.7 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/107 (19%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E  D   ++D + + FA+T+  F++        + +R++    L  G+++++ 
Sbjct: 195 LAVLIVVETTDVIFAIDSIPAIFAVTREPFLVFTSNAFAILGLRAL--YFLLAGMMHRFV 252

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           YL++G    +  +   M L  I  +P   +    ++L+ +S+ +S++
Sbjct: 253 YLKYGLAGILVFVGAKMLLSDIYKVPIWISLAVISVLVGVSVVASLR 299


>gi|116074915|ref|ZP_01472176.1| TerC family protein [Synechococcus sp. RS9916]
 gi|116068137|gb|EAU73890.1| TerC family protein [Synechococcus sp. RS9916]
          Length = 243

 Score = 48.7 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 73/184 (39%), Gaps = 14/184 (7%)

Query: 172 LSKIKGIKIFIVLSIIFGISNILPTNEMYSF----VSSSTAAIIIFYG-----INFLESV 222
           L + + + + I L+     + IL    + +F    + +    + +F G            
Sbjct: 55  LRERQALNLGIGLAFALRTALILMAQWILAFKPIQLIAGAYLVWLFIGHLRSKTAASGDD 114

Query: 223 LSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRS 282
           + +D +         L   L L + D + S+D V ++ AI+    ++V G  IG I +R 
Sbjct: 115 IDADGTPESASAGSLLRTVLALALTDLAFSVDSVATAVAISDQLILVVTGALIGVIALRF 174

Query: 283 MTLLMLKQGILNKYKYLEHGSYYSIFVLSV---IMFLQTIVDIPEIFTGTSSTILIFLSI 339
            + L ++   L  +  LE   Y ++ ++     I  L   + +PE    +S   L+    
Sbjct: 175 TSGLFVR--WLEIFPRLETAGYVAVGLVGFKLLITLLLNTLHVPEWVMLSSVIALLVWGF 232

Query: 340 YSSI 343
            + I
Sbjct: 233 STRI 236


>gi|59713461|ref|YP_206236.1| putative membrane-bound redox modulator that IS induced by high pH
           [Vibrio fischeri ES114]
 gi|59481709|gb|AAW87348.1| putative membrane-bound redox modulator that is induced by high pH
           [Vibrio fischeri ES114]
          Length = 318

 Score = 48.7 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 74/168 (44%), Gaps = 6/168 (3%)

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
           IF V  II G+       E  S  +SS   +     I F +    +     V+       
Sbjct: 141 IFAVFLIITGVKLWFADTEENSDFASSKLVMFFKKHIPFDDKYHGNQLFAKVSGKTIATP 200

Query: 240 LFLYLEII---DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
           L L + +I   D   +LD + + FAIT+  F++        + +RS+    + QG+L+K+
Sbjct: 201 LLLVVIVIMFTDIMFALDSIPAIFAITQEPFLVFAANVFALLGLRSL--YFVLQGMLDKF 258

Query: 297 KYLEHGSYYSIFVLSVIM-FLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            YL+    + +  + + M  + T  ++P + +  +   +I L+I  SI
Sbjct: 259 CYLQPALAFILSFIGIKMFLVGTKYEVPTVISLLTIVAIITLAIIGSI 306


>gi|228904836|ref|ZP_04068890.1| Tellurium resistance protein terC [Bacillus thuringiensis IBL 4222]
 gi|228854850|gb|EEM99454.1| Tellurium resistance protein terC [Bacillus thuringiensis IBL 4222]
          Length = 237

 Score = 48.3 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E +D + S+D + ++ A++  F+++ +G  +G I +RS+  + +K  ++N+
Sbjct: 104 QFWAIVVSIEFMDLAFSIDSITAALALSDKFWVLALGGVLGIIMMRSVAGVFIK--LINR 161

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIV 320
              +EH ++  I ++ V M L T+ 
Sbjct: 162 VPEMEHTAFVLIAIIGVKMLLGTVH 186


>gi|88808733|ref|ZP_01124243.1| TerC family protein [Synechococcus sp. WH 7805]
 gi|88787721|gb|EAR18878.1| TerC family protein [Synechococcus sp. WH 7805]
          Length = 239

 Score = 48.3 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/162 (16%), Positives = 67/162 (41%), Gaps = 5/162 (3%)

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
           F++   +  ++  +        ++      + +      +    + +S + +        
Sbjct: 69  FVLRVALILMAQWVLAFPPIQLLAGGYLLWLCYQHWRPTDLDDDAKTSLDSSSTVSFRRT 128

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + L + D + S+D V ++ AI+   F+++ G  IG + +R  + L ++   L  Y  LE
Sbjct: 129 VVTLAVTDLAFSIDSVAAAVAISDQLFLVITGALIGVVALRFTSGLFIQ--WLKIYSRLE 186

Query: 301 HGSYYSIFVLSVIMFLQTIV---DIPEIFTGTSSTILIFLSI 339
              Y ++  +   + +Q +    D+PE+ T +   +L+    
Sbjct: 187 SAGYLAVAFVGFKLLIQLVFPMIDVPELLTLSVVALLMVWGF 228


>gi|238854340|ref|ZP_04644682.1| tellurium resistance protein [Lactobacillus jensenii 269-3]
 gi|260665033|ref|ZP_05865883.1| tellurium resistance protein [Lactobacillus jensenii SJ-7A-US]
 gi|282931744|ref|ZP_06337229.1| tellurium resistance protein [Lactobacillus jensenii 208-1]
 gi|313472954|ref|ZP_07813441.1| tellurium resistance protein [Lactobacillus jensenii 1153]
 gi|238832962|gb|EEQ25257.1| tellurium resistance protein [Lactobacillus jensenii 269-3]
 gi|239528857|gb|EEQ67858.1| tellurium resistance protein [Lactobacillus jensenii 1153]
 gi|260561087|gb|EEX27061.1| tellurium resistance protein [Lactobacillus jensenii SJ-7A-US]
 gi|281304051|gb|EFA96168.1| tellurium resistance protein [Lactobacillus jensenii 208-1]
          Length = 254

 Score = 48.3 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/107 (19%), Positives = 53/107 (49%), Gaps = 5/107 (4%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                + +E++D   S+D V+++ AI +N  I++IG  IG + +R +  ++++  ++   
Sbjct: 136 FWRTVISIELMDIVFSIDSVLAALAIAENPVIVLIGGMIGILCMRGVAEIIIR--LMEHI 193

Query: 297 KYLEHGSYYSIFVLSVIMFLQTI---VDIPEIFTGTSSTILIFLSIY 340
             LE  +Y  I ++++ + L       +IP          ++ +++ 
Sbjct: 194 PELEPMAYILIGIIALKLLLNLPPLEFEIPNSIFALIVFGILGITVL 240


>gi|119485409|ref|ZP_01619737.1| hypothetical protein L8106_09716 [Lyngbya sp. PCC 8106]
 gi|119457165|gb|EAW38291.1| hypothetical protein L8106_09716 [Lyngbya sp. PCC 8106]
          Length = 230

 Score = 48.3 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 32/174 (18%), Positives = 75/174 (43%), Gaps = 7/174 (4%)

Query: 171 HLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAA--IIIFYGINFLESVLSSDSS 228
              + K + I ++L+ +  I+ I+    +  F          +++   N+  S    ++S
Sbjct: 49  KRMQRKALNIGLILAFVLRIALIIAATWIIQFWQFELIGALYLLWLVFNYFTSKEDEENS 108

Query: 229 NNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLML 288
           ++         +   + + D + SLD V ++ A+    ++I+IG T+G I +R +  L +
Sbjct: 109 SSGKSYSSLWQVIPLIAMTDLAFSLDSVTAAIAVADETWLIIIGATLGIITLRFLAGLFI 168

Query: 289 KQGILNKYKYLEHGSYYSIFVLSVIMFLQTI---VDIPEIFTGTSSTILIFLSI 339
           +   L +Y +LE   Y ++ ++ + + ++ I      PE      +  L     
Sbjct: 169 R--WLTEYTHLETAGYLTVGLVGMRLLVRVINPEYIPPEWILVVFTVGLFVWGF 220


>gi|116696037|ref|YP_841613.1| tellurium resistance protein TerC [Ralstonia eutropha H16]
 gi|113530536|emb|CAJ96883.1| Membrane protein TerC, possibly involved in tellurium resistance
           [Ralstonia eutropha H16]
          Length = 339

 Score = 48.3 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 51/337 (15%), Positives = 112/337 (33%), Gaps = 71/337 (21%)

Query: 15  RWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLSFENAILNAKNLQ 72
            W +  +    L G+ + W    +     +   +       ++E+SLS +N  + A    
Sbjct: 43  GWTLAWSTLAVLFGIALWWLLAGSAGRETADRKVLEFYTGYLIELSLSVDNMFVFAMIFG 102

Query: 73  KMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
             +     Q+R L +G++ A+  MR +  ++ V                        +IS
Sbjct: 103 YFAVPPELQRRVLLFGVVGAI-VMRAVMILLGVW-----------------------LIS 138

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +    +  FG  FL+   +   F S+                                  
Sbjct: 139 EFSWILYVFG-VFLLFTGIKMLFVSRR--------------------------------- 164

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           +  L  N +  F+ +       ++G +F   V     +  +        + L +E  D  
Sbjct: 165 APDLSRNPIVRFLCAHMRITADYHGEHFFVRVDGLRHATPM------FLVVLLVEATDLV 218

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            ++D + + FA+T + FI+        + +R++    L   +   + YL++G    +  +
Sbjct: 219 FAVDSIPAIFAVTTDPFIVFTSNIFAIMGLRAL--YFLLANLAQHFHYLKYGLAIVLAFI 276

Query: 311 SVIMFLQTIVDIP-EIFTGTSSTILIFLSIYSSIKNK 346
              M  +    +P     G  +  L    + S  + +
Sbjct: 277 GAKMLAEPWFHVPVHWSLGAVAMTLFVSVLVSRARAR 313


>gi|299534998|ref|ZP_07048324.1| YceF [Lysinibacillus fusiformis ZC1]
 gi|298729494|gb|EFI70043.1| YceF [Lysinibacillus fusiformis ZC1]
          Length = 247

 Score = 48.3 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 47/91 (51%), Gaps = 3/91 (3%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                + +E++D + S+D + ++FAI+   ++++IG  +G + +R  T+  +   I+ K 
Sbjct: 135 FWATVISVELMDIAFSIDSIFAAFAISDQVWVLLIGGMLGILMMR--TIAGVFLIIIEKI 192

Query: 297 KYLEHGSYYSIFVLSVIMFLQTI-VDIPEIF 326
             LE  ++  I V+ + M +    + IP   
Sbjct: 193 PELEATAFIIIGVIGLKMLVSVFNIHIPHYL 223


>gi|75758212|ref|ZP_00738337.1| Tellurium resistance protein terC [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|74494266|gb|EAO57357.1| Tellurium resistance protein terC [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
          Length = 255

 Score = 48.3 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E +D + S+D + ++ A++  F+++ +G  +G I +RS+  + +K  ++N+
Sbjct: 122 QFWAIVVSIEFMDLAFSIDSITAALALSDKFWVLALGGVLGIIMMRSVAGVFIK--LINR 179

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIV 320
              +EH ++  I ++ V M L T+ 
Sbjct: 180 VPEMEHTAFVLIAIIGVKMLLGTVH 204


>gi|33865725|ref|NP_897284.1| TerC family protein [Synechococcus sp. WH 8102]
 gi|33632895|emb|CAE07706.1| TerC family protein [Synechococcus sp. WH 8102]
          Length = 242

 Score = 48.3 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 69/167 (41%), Gaps = 6/167 (3%)

Query: 177 GIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV-THGK 235
           G+ + + + +I     +L +  +    ++    + I +   F +      ++  V T  +
Sbjct: 66  GLAMLLRVGLIALAQWVLQSAWVQLLAAAYLFWLFINHLRQFSQDNADDAAATVVSTQAR 125

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             +   L L   D + S+D V ++ A++    +I  G  IG I +R  + L ++   L++
Sbjct: 126 SLMQTVLLLGFTDLAFSIDSVAAAVAVSDQLLLISTGAVIGIIALRFTSGLFIR--WLDE 183

Query: 296 YKYLEHGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSI 339
           Y  LE   + S+  +++ + +       + P+  T     +L     
Sbjct: 184 YARLETAGFLSVAFVALRLLVHVLIPQFNQPDWLTMLVVFLLFAWGF 230


>gi|229916980|ref|YP_002885626.1| Integral membrane protein TerC [Exiguobacterium sp. AT1b]
 gi|229468409|gb|ACQ70181.1| Integral membrane protein TerC [Exiguobacterium sp. AT1b]
          Length = 306

 Score = 48.3 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 54/105 (51%), Gaps = 2/105 (1%)

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
               +++E+ D   ++D V +SFA +++ +II     +  + +RS+    +   +++++ 
Sbjct: 192 FIALIFIELSDIVFAVDSVAASFAYSRDPYIIFYANIMAILGLRSL--YFVLANLIDRFY 249

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           YL+HG  + +  +   M L  +  +P   +  +  ++I +S+  S
Sbjct: 250 YLKHGLSFMLVFIGAKMILGDVYKMPIWMSLGTIVLVILISVLYS 294


>gi|126650935|ref|ZP_01723146.1| YceF [Bacillus sp. B14905]
 gi|126592136|gb|EAZ86185.1| YceF [Bacillus sp. B14905]
          Length = 247

 Score = 48.3 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 48/88 (54%), Gaps = 3/88 (3%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                + +E++D + S+D + ++FAI+   ++++IG  +G + +R  T+  +   ++ K 
Sbjct: 135 FWATVISVELMDIAFSIDSIFAAFAISDQVWVLLIGGMLGILMMR--TIAGVFLIMIEKI 192

Query: 297 KYLEHGSYYSIFVLSVIMFLQTI-VDIP 323
             LE  ++  I V+ + M +  + + IP
Sbjct: 193 PELEATAFIIIGVIGLKMLVSVVNIHIP 220


>gi|16077361|ref|NP_388174.1| stress adaptation transporter [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221308108|ref|ZP_03589955.1| hypothetical protein Bsubs1_01608 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221312431|ref|ZP_03594236.1| hypothetical protein BsubsN3_01621 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221317364|ref|ZP_03598658.1| hypothetical protein BsubsJ_01613 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221321629|ref|ZP_03602923.1| hypothetical protein BsubsS_01639 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|6226422|sp|O34447|YCEF_BACSU RecName: Full=Uncharacterized membrane protein yceF
 gi|2415743|dbj|BAA22253.1| YceF [Bacillus subtilis]
 gi|2632578|emb|CAB12086.1| putative stress adaptation transporter [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 257

 Score = 48.3 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 48/84 (57%), Gaps = 2/84 (2%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                + +E++D + S+D ++++FA+++  ++++IG  +G + +R  T+  +   +++K 
Sbjct: 135 FWATVISVELMDLAFSVDSILAAFAVSEKVWVLLIGGMLGILMMR--TVAKVFLVLIDKI 192

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIV 320
             LE+ ++  I ++++ M      
Sbjct: 193 PELENTAFVLIGIIALKMAGSAFH 216


>gi|321313962|ref|YP_004206249.1| putative stress adaptation transporter [Bacillus subtilis BSn5]
 gi|291482677|dbj|BAI83752.1| hypothetical protein BSNT_00516 [Bacillus subtilis subsp. natto
           BEST195]
 gi|320020236|gb|ADV95222.1| putative stress adaptation transporter [Bacillus subtilis BSn5]
          Length = 257

 Score = 47.9 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 48/84 (57%), Gaps = 2/84 (2%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                + +E++D + S+D ++++FA+++  ++++IG  +G + +R  T+  +   +++K 
Sbjct: 135 FWATVISVELMDLAFSVDSILAAFAVSEKVWVLLIGGMLGILMMR--TVAKVFLVLIDKI 192

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIV 320
             LE+ ++  I ++++ M      
Sbjct: 193 PELENTAFVLIGIIALKMAGSAFH 216


>gi|259649912|dbj|BAI42074.1| conserved hypothetical protein [Lactobacillus rhamnosus GG]
          Length = 223

 Score = 47.9 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 50/106 (47%), Gaps = 5/106 (4%)

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
               L +E +D   S+D ++++ A++ N  I++IG  +G + +R +    +    +++  
Sbjct: 102 WGTILQIESLDIVFSVDSILAALAVSPNPVIVLIGGCLGILAMRIVAQ--VITTFIDRVP 159

Query: 298 YLEHGSYYSIFVLSVIMFLQ---TIVDIPEIFTGTSSTILIFLSIY 340
            LE  +Y  + ++++ + L      V+ P+        ++   + +
Sbjct: 160 ELETAAYVLVGLIAIKLGLSLPMIHVETPDWLFSVLVVVIFIWAGW 205


>gi|205374653|ref|ZP_03227447.1| YceF [Bacillus coahuilensis m4-4]
          Length = 251

 Score = 47.9 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 49/84 (58%), Gaps = 2/84 (2%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                + +EI+D + S+D ++++FAI++  +++++G  +G I +R++  + +   ++++ 
Sbjct: 135 FWGTVISVEIVDIAFSVDSILAAFAISEQVWVLLVGGMLGIIMMRTVARVFI--ALIDRI 192

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIV 320
             LE  ++  I ++S+ M L    
Sbjct: 193 PELETTAFVLIGIISLKMLLSVFH 216


>gi|256370812|ref|YP_003108637.1| integral membrane protein TerC family [Candidatus Sulcia muelleri
           SMDSEM]
 gi|256009604|gb|ACU52964.1| integral membrane protein TerC family [Candidatus Sulcia muelleri
           SMDSEM]
          Length = 240

 Score = 47.9 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 211 IIFYGIN-FLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFII 269
           +I+ GIN FL++     +   +          LY+E+ID   S+D +++  + + N  +I
Sbjct: 92  LIYLGINHFLKTQKEEKNLFKINFFSKIWVTILYVELIDFLFSIDNILAGISYSNNPLLI 151

Query: 270 VIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
            +G+ I    +R  T+ +LK  +  KY  LE  +++
Sbjct: 152 FLGVFISLFLLRISTVKLLK--LTEKYSSLEDSAFF 185


>gi|199597095|ref|ZP_03210527.1| hypothetical protein LRH_07166 [Lactobacillus rhamnosus HN001]
 gi|229552413|ref|ZP_04441138.1| TerC family membrane protein [Lactobacillus rhamnosus LMS2-1]
 gi|258508605|ref|YP_003171356.1| tellurium resistance protein [Lactobacillus rhamnosus GG]
 gi|258539782|ref|YP_003174281.1| tellurium resistance protein [Lactobacillus rhamnosus Lc 705]
 gi|199591899|gb|EDY99973.1| hypothetical protein LRH_07166 [Lactobacillus rhamnosus HN001]
 gi|229314239|gb|EEN80212.1| TerC family membrane protein [Lactobacillus rhamnosus LMS2-1]
 gi|257148532|emb|CAR87505.1| Tellurium resistance protein [Lactobacillus rhamnosus GG]
 gi|257151458|emb|CAR90430.1| Tellurium resistance protein [Lactobacillus rhamnosus Lc 705]
          Length = 259

 Score = 47.9 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 50/106 (47%), Gaps = 5/106 (4%)

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
               L +E +D   S+D ++++ A++ N  I++IG  +G + +R +    +    +++  
Sbjct: 138 WGTILQIESLDIVFSVDSILAALAVSPNPVIVLIGGCLGILAMRIVAQ--VITTFIDRVP 195

Query: 298 YLEHGSYYSIFVLSVIMFLQ---TIVDIPEIFTGTSSTILIFLSIY 340
            LE  +Y  + ++++ + L      V+ P+        ++   + +
Sbjct: 196 ELETAAYVLVGLIAIKLGLSLPMIHVETPDWLFSVLVVVIFIWAGW 241


>gi|126661430|ref|ZP_01732489.1| conserved membrane protein TerC [Cyanothece sp. CCY0110]
 gi|126617287|gb|EAZ88097.1| conserved membrane protein TerC [Cyanothece sp. CCY0110]
          Length = 215

 Score = 47.9 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 58/136 (42%), Gaps = 8/136 (5%)

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYL 244
            ++   +  +        +++     + +   ++   + S  +          +   ++ 
Sbjct: 56  IVLIFCATWIIRYWQLKLLAA---IYLFYLVFDYFWDLSSDSNFKTKKSLMSAIVAVVF- 111

Query: 245 EIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSY 304
              D + SLD V ++  I+  F II+ G  IG + +R +T L   Q  + K+ YLE   Y
Sbjct: 112 --TDLAFSLDSVSAAVGISDRFLIIIAGCGIGVLALRFLTELF--QVWMEKFTYLELSGY 167

Query: 305 YSIFVLSVIMFLQTIV 320
            +I ++++ + ++ I 
Sbjct: 168 LAIGLVAIKLLIEIIY 183


>gi|159899091|ref|YP_001545338.1| tellurium resistance protein TerC [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159892130|gb|ABX05210.1| membrane protein TerC possibly involved in tellurium
           resistance-like protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 295

 Score = 47.5 bits (112), Expect = 0.003,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 77/199 (38%), Gaps = 21/199 (10%)

Query: 160 HWIHFLEIAMSHLSKIKG--------IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAII 211
            W+ +++        ++         I  ++   ++  ++ I+  N    +V +  +  +
Sbjct: 47  KWLQWMQGHGERFLGMQQAAALKVGLIGAYVGRGLMLAVAFIITENP---WVLAIGSGYL 103

Query: 212 IFYGINFLESVLS----SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAI--TKN 265
           ++  +N    +       + S             L +E+ID + SLD V+ +      K 
Sbjct: 104 VWLSVNHFAHMHRRDQIDEHSEVKQRTTGFWQTVLIIEMIDLAFSLDNVVVAVNADPQKR 163

Query: 266 FFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDI--P 323
           F++I +G+ IG + +R    +     ++     LEH ++  +  +     ++ +  +  P
Sbjct: 164 FWVIGLGVAIGILVMRFAAQIF--TSLIEWEPNLEHAAFALLLAIGTESVIKIVWHLETP 221

Query: 324 EIFTGTSSTILIFLSIYSS 342
                  S  ++ L++  S
Sbjct: 222 HWLKFAISMTILALTVALS 240


>gi|260892890|ref|YP_003238987.1| Integral membrane protein TerC [Ammonifex degensii KC4]
 gi|260865031|gb|ACX52137.1| Integral membrane protein TerC [Ammonifex degensii KC4]
          Length = 312

 Score = 47.5 bits (112), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 49/106 (46%), Gaps = 2/106 (1%)

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
             + L +E  D   + D V ++ A+++  FI+        + +RS+    +   I+  ++
Sbjct: 193 FLVLLAVETTDVIFAFDSVPAALAVSREPFIVWTSNAFAILGLRSL--YFVLAHIMGLFR 250

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           YL++G    +  +   M L ++  IP   +      ++ LS+ +S+
Sbjct: 251 YLKYGLSVILVFIGTKMLLNSLYHIPIHISLGVVIAIVGLSVMASL 296


>gi|81299360|ref|YP_399568.1| hypothetical protein Synpcc7942_0549 [Synechococcus elongatus PCC
           7942]
 gi|81168241|gb|ABB56581.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 253

 Score = 47.5 bits (112), Expect = 0.003,   Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 76/172 (44%), Gaps = 8/172 (4%)

Query: 174 KIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAA--IIIFYGINFLE-SVLSSDSSNN 230
           + K + + +V++ I  +  IL  + +  F  +  A    +++   N+       ++   +
Sbjct: 60  QRKALNLGLVVAYILRMLLILTASWVTQFRLAELAGALYLLWLAFNYFRPDGSDTEGEKH 119

Query: 231 VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQ 290
                        + + D + SLD V ++ A+++  +++++G TIG I +R +  L ++ 
Sbjct: 120 HHRFTSLWASIPTIALTDLAFSLDSVTTAIAVSRETWLVLLGGTIGVITLRFLAGLFIR- 178

Query: 291 GILNKYKYLEHGSYYSIFVLSVIMFLQTIVDI---PEIFTGTSSTILIFLSI 339
             L +Y  LE   Y ++ ++ + + ++ I +    PE    +   +L     
Sbjct: 179 -WLKEYDNLESAGYGAVALVGLRLLVRAINESLTPPEWVMVSCIVVLFIWGF 229


>gi|312869348|ref|ZP_07729513.1| integral membrane protein, YkoY family [Lactobacillus oris
           PB013-T2-3]
 gi|311095143|gb|EFQ53422.1| integral membrane protein, YkoY family [Lactobacillus oris
           PB013-T2-3]
          Length = 252

 Score = 47.5 bits (112), Expect = 0.003,   Method: Composition-based stats.
 Identities = 37/162 (22%), Positives = 75/162 (46%), Gaps = 9/162 (5%)

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGIN----FLESVLSSDSSNNVTHGKHGLNLF 241
           +I GI   L        + ++    +++   +             +++ VT  K    + 
Sbjct: 78  LIIGIGVYLINFWEIKVIGAAYLMYLVYRFFHNRYHGRRRRKVRTTADRVTGRKRFWLVV 137

Query: 242 LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEH 301
             +E +D   S+D V++S A++ N  I++IG  IG   +R +  +++K  ++ K   LE 
Sbjct: 138 AQIEFMDIIFSVDSVLASLAVSPNPVIVLIGGLIGIACMRGVAEIIMK--LMRKIPELEP 195

Query: 302 GSYYSIFVLSVIMFLQ---TIVDIPEIFTGTSSTILIFLSIY 340
            +Y  IFV+++ +FL      ++IP  + G    I+  L+I 
Sbjct: 196 MAYALIFVIAIKLFLTIPAIDIEIPSQYFGIFMLIVFGLTII 237


>gi|259502333|ref|ZP_05745235.1| tellurium resistance protein [Lactobacillus antri DSM 16041]
 gi|259169713|gb|EEW54208.1| tellurium resistance protein [Lactobacillus antri DSM 16041]
          Length = 255

 Score = 47.5 bits (112), Expect = 0.003,   Method: Composition-based stats.
 Identities = 35/162 (21%), Positives = 75/162 (46%), Gaps = 9/162 (5%)

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGIN----FLESVLSSDSSNNVTHGKHGLNLF 241
           +I G+   L        + ++    +++   +             +++ VT  K    + 
Sbjct: 78  LIIGVGVYLIHFWEIKVIGAAYLMYLVYRFFHNRYHGRRRRKVRTTADRVTGRKRFWLVV 137

Query: 242 LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEH 301
             +E +D   S+D V++S A++ N  I++IG  IG   +R +  +++K  ++ K   LE 
Sbjct: 138 AQIEFMDIIFSVDSVLASLAVSPNPVIVLIGGLIGIACMRGVAEIIMK--LMRKIPELEP 195

Query: 302 GSYYSIFVLSVIMFLQ---TIVDIPEIFTGTSSTILIFLSIY 340
            +Y  IFV+++ +FL      ++IP  + G    ++  L+I 
Sbjct: 196 MAYALIFVIAIKLFLTIPAIDIEIPSQYFGIFMLVVFGLTII 237


>gi|119510059|ref|ZP_01629199.1| hypothetical protein N9414_19592 [Nodularia spumigena CCY9414]
 gi|119465246|gb|EAW46143.1| hypothetical protein N9414_19592 [Nodularia spumigena CCY9414]
          Length = 243

 Score = 47.1 bits (111), Expect = 0.003,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 79/184 (42%), Gaps = 13/184 (7%)

Query: 165 LEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS 224
           LE    +   +     +++   +   +  +     +  + ++    +++       S  +
Sbjct: 51  LERKALNFGLVVA---YVLRISLILTATWIQKYWQFELLGAA---YLLWLVFQHFTSEEA 104

Query: 225 SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMT 284
            D  ++       L     +   D + SLD V ++ A+++  ++++ G TIG I +R MT
Sbjct: 105 KDDHHHGPRFNSLLQAIPVIAFTDLAFSLDSVTTAIAVSQEKWLVLTGATIGIITLRFMT 164

Query: 285 LLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD---IPEIFTGTSSTILIFLSIYS 341
            L ++   L+++K LE   Y ++  + + + ++ I +    PE      S I I L    
Sbjct: 165 GLFIR--WLDEFKNLEDAGYITVAFVGLRLLMRVINENLVPPEWI--VISAIAIILVWGF 220

Query: 342 SIKN 345
           S++N
Sbjct: 221 SVRN 224


>gi|134100191|ref|YP_001105852.1| integral membrane protein TerC [Saccharopolyspora erythraea NRRL
           2338]
 gi|291006588|ref|ZP_06564561.1| integral membrane protein TerC [Saccharopolyspora erythraea NRRL
           2338]
 gi|133912814|emb|CAM02927.1| integral membrane protein TerC [Saccharopolyspora erythraea NRRL
           2338]
          Length = 310

 Score = 47.1 bits (111), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 49/105 (46%), Gaps = 2/105 (1%)

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E  D   ++D + + FA+T + F++        + +R++    L  G ++++ 
Sbjct: 196 LVVLVAVETTDLVFAVDSIPAVFAVTSDPFLVFTSNAFAILGLRAL--YFLLAGAMHRFT 253

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           YL +G    +  +   M L  +  IP   + +    LI  +I +S
Sbjct: 254 YLRYGLAAILVFVGAKMLLTDLYKIPIWISLSVIIALIGGAIAAS 298


>gi|298252100|ref|ZP_06975903.1| Integral membrane protein TerC [Ktedonobacter racemifer DSM 44963]
 gi|297546692|gb|EFH80560.1| Integral membrane protein TerC [Ktedonobacter racemifer DSM 44963]
          Length = 321

 Score = 47.1 bits (111), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/102 (23%), Positives = 50/102 (49%), Gaps = 2/102 (1%)

Query: 242 LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEH 301
           + +E  D   ++D + + FA+T + FI+        + +RS+    +   +++K+ YL+ 
Sbjct: 201 IVVETTDLVFAVDSIPAIFAVTNDPFIVYTSNVFAILGLRSL--YFVFANVIHKFYYLKA 258

Query: 302 GSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           G    +  + V M L  I  IP   +     I++ L+I +S+
Sbjct: 259 GLAVILTYVGVKMLLADIFHIPTALSLLVIAIVLALAIVASV 300


>gi|320449709|ref|YP_004201805.1| TerC family protein [Thermus scotoductus SA-01]
 gi|320149878|gb|ADW21256.1| TerC family protein [Thermus scotoductus SA-01]
          Length = 231

 Score = 47.1 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 83/195 (42%), Gaps = 11/195 (5%)

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN--EMYS 201
           L++V+L    ++ N L     ++    HL +       +   ++ G++ +      +++ 
Sbjct: 10  LILVALEVILSADNALILGVIVQRLPVHLRRRALFYGILGAYVLRGLALLFAALVIKLWW 69

Query: 202 FVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFA 261
                 A ++     +FL +  +  +                +E++D + ++D V+ + A
Sbjct: 70  VQVLGAAYLLYVALKHFLRAEGAHAAPPLEVSAAQFWKTVAQVELMDLAFAVDSVLVAVA 129

Query: 262 ITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT--- 318
           ++   ++I  G+ +G + +R +  L++   +L++Y   +H +Y  + +  V + +     
Sbjct: 130 LSDKLWVIYTGVFLGILALRMLASLVV--TLLDRYPRFKHLAYVVVGLAGVKLLVGGWDK 187

Query: 319 ----IVDIPEIFTGT 329
               ++  PE+  G 
Sbjct: 188 LTKEVLHRPELAVGL 202


>gi|254414686|ref|ZP_05028451.1| Integral membrane protein TerC family [Microcoleus chthonoplastes
           PCC 7420]
 gi|196178534|gb|EDX73533.1| Integral membrane protein TerC family [Microcoleus chthonoplastes
           PCC 7420]
          Length = 238

 Score = 47.1 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 33/171 (19%), Positives = 68/171 (39%), Gaps = 7/171 (4%)

Query: 174 KIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAA--IIIFYGINFLESVLSSDSSNNV 231
           + + +   +V++ I  IS IL    +  F          +++       S       ++ 
Sbjct: 51  QRQALNFGLVVAYILRISLILTATWVVKFWQFELLGAAYLLWLVFEHFTSEEDEQHHHHG 110

Query: 232 THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
                 L +   + I D + SLD V ++ AI+   ++++ G TIG I +R M  L ++  
Sbjct: 111 PRFTSLLQVIPLIAITDLAFSLDSVTTAIAISDQIWLVLAGGTIGVITLRFMAGLFIR-- 168

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFL---QTIVDIPEIFTGTSSTILIFLSI 339
            L +Y  LE   Y ++ ++ + + +         PE    T   ++     
Sbjct: 169 WLQEYANLEDAGYITVGIVGLRLLVRAINPEFVPPEWLMITIIALIFLWGF 219


>gi|332170272|gb|AEE19527.1| Integral membrane protein TerC [Krokinobacter diaphorus 4H-3-7-5]
          Length = 314

 Score = 47.1 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 46/106 (43%), Gaps = 2/106 (1%)

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
               + +E+ D   +LD + +  AITK+ FI+        + +RS+        +L +++
Sbjct: 204 FGALVTIELTDLLFALDSIPAILAITKDPFIVYSSNIFAIMGLRSL--YFFLANMLERFR 261

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           YL++  +  +  ++  + +      PE  +     + +   +  S+
Sbjct: 262 YLKYSVFVILLFVAAKLIVGHYYPFPEWLSLVVIFVCLGAGVIYSL 307


>gi|169841549|ref|ZP_02874662.1| hypothetical protein cdivTM_30640 [candidate division TM7
           single-cell isolate TM7a]
          Length = 52

 Score = 47.1 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 28/44 (63%)

Query: 86  GILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
           G  IAVF +R + PI+IV   S +N  E +++A+ +P+ Y  ++
Sbjct: 9   GDFIAVFAVRFLLPIVIVMFASGLNLGEVVSMALNNPERYGHVL 52


>gi|169826517|ref|YP_001696675.1| YceF [Lysinibacillus sphaericus C3-41]
 gi|168991005|gb|ACA38545.1| YceF [Lysinibacillus sphaericus C3-41]
          Length = 247

 Score = 47.1 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 48/88 (54%), Gaps = 3/88 (3%)

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
                + +E++D + S+D + ++FA++   ++++IG  +G + +R  T+  +   ++ K 
Sbjct: 135 FWATVISVELMDIAFSIDSIFAAFAVSDQVWVLLIGGMLGILMMR--TIAGVFLIMIEKV 192

Query: 297 KYLEHGSYYSIFVLSVIMFLQTI-VDIP 323
             LE  ++  I V+ + M +  + + IP
Sbjct: 193 PELEATAFIIIGVIGLKMLVSVVNLHIP 220


>gi|186686303|ref|YP_001869499.1| integral membrane protein TerC [Nostoc punctiforme PCC 73102]
 gi|186468755|gb|ACC84556.1| Integral membrane protein TerC [Nostoc punctiforme PCC 73102]
          Length = 240

 Score = 47.1 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 75/171 (43%), Gaps = 7/171 (4%)

Query: 174 KIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAA--IIIFYGINFLESVLSSDSSNNV 231
           + K +   +V++ +  IS IL    +  F          +++       S  + D  ++ 
Sbjct: 52  ERKALNFGLVVAYVLRISLILTATWVQQFWQFELLGAAYLLWLVFQHFTSEETKDEHHHG 111

Query: 232 THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQG 291
                 L     +   D + SLD V ++ A+++  ++++ G TIG I +R M  L ++  
Sbjct: 112 PRFNSLLQAIPVIAFTDLAFSLDSVTTAIAVSQEKWLVLTGATIGIITLRFMAGLFIR-- 169

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMFLQTIVD---IPEIFTGTSSTILIFLSI 339
            L++Y+ LE   Y ++  + + + L+ + D    PE    T+  +++    
Sbjct: 170 WLDEYENLEDAGYVTVAFVGLRLLLKVVNDNLVPPEWIMITAIFLILGWGF 220


>gi|197122268|ref|YP_002134219.1| integral membrane protein TerC [Anaeromyxobacter sp. K]
 gi|196172117|gb|ACG73090.1| Integral membrane protein TerC [Anaeromyxobacter sp. K]
          Length = 320

 Score = 47.1 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 57/331 (17%), Positives = 111/331 (33%), Gaps = 74/331 (22%)

Query: 15  RWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM 74
            W  +           + W+F    +    T Y+       E SLS +N  +        
Sbjct: 49  GWTAVWASLAAAFAGFVWWRFGANKAIEFVTGYLI------EQSLSVDNLFVFVLVFASF 102

Query: 75  S--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQA 132
           +     Q R L WGI  A F +R++   MIV   +                    ++S+ 
Sbjct: 103 AIPPKLQHRVLFWGITTAFF-LRLV---MIVGGTA--------------------LLSRF 138

Query: 133 HVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISN 192
           H  I  FGG FL++  +  FF+ + + H     E +++                   +  
Sbjct: 139 HWLIYVFGG-FLVVTGIRIFFHEEQEHH----PEKSVAFR----------------VLRR 177

Query: 193 ILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLS 252
           ++P+                F+ +            +              +E