BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780228|ref|YP_003064641.1| hypothetical protein
CLIBASIA_00565 [Candidatus Liberibacter asiaticus str. psy62]
         (346 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|86359171|ref|YP_471063.1| hypothetical protein RHE_CH03581 [Rhizobium etli CFN 42]
 gi|86283273|gb|ABC92336.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 463

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 161/345 (46%), Positives = 242/345 (70%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +    S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 101 MNQSQTDKSSLGYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICAVLAVLEISLS 160

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 161 FDNAIVNANKLKEMTPVWQKRFLTWGIIIAVFGMRIVFPLAIVAIAARIGPWDALVLAAR 220

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I++ AH+PI+ FGGTFLMMV L++FF+S+ K+HW+  LE  M+  + I+GI+I
Sbjct: 221 EPEEYARIMNDAHLPIAAFGGTFLMMVGLSYFFDSEKKIHWLRGLEKVMARSATIRGIEI 280

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   E   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 281 AFVLALMLVFSWLIGGEEASVFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 340

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 341 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 400

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +L+VIM+ QT++ IPE+ TG     LI LS++SSI++
Sbjct: 401 HGAFYAILILAVIMYAQTLMHIPEVITGLGGAALIGLSLWSSIRH 445


>gi|190893419|ref|YP_001979961.1| hypothetical protein RHECIAT_CH0003846 [Rhizobium etli CIAT 652]
 gi|190698698|gb|ACE92783.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 389

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 161/345 (46%), Positives = 243/345 (70%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  ++ + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 28  MNQSATHKSSLGYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 87

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 88  FDNAIVNANKLKEMTPLWQKRFLTWGIIIAVFGMRIVFPLAIVAIAARIGPWDALVLAAR 147

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I++ AH+PI+ FGGTFLMMV L++FF+ + K+HW+  LE  M+  + I+GI+I
Sbjct: 148 EPEEYARIMNDAHLPIAAFGGTFLMMVGLSYFFDHEKKIHWLRGLEKVMARSATIRGIEI 207

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   E   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 208 AFVLALMLVFSWLIGGEEASIFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 267

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 268 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 327

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +L+VIM+ QT+V IPE+ TG     LI LS++SSI++
Sbjct: 328 HGAFYAILILAVIMYAQTLVHIPEVITGLGGAALIGLSLWSSIRH 372


>gi|327189635|gb|EGE56785.1| hypothetical protein RHECNPAF_570029 [Rhizobium etli CNPAF512]
          Length = 362

 Score =  261 bits (667), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 161/345 (46%), Positives = 243/345 (70%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  ++ + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQSATHKSSLGYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATAFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 61  FDNAIVNANKLKEMTPLWQKRFLTWGIIIAVFGMRIVFPLAIVAIAARIGPWDALVLAAR 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I++ AH+PI+ FGGTFLMMV L++FF+ + K+HW+  LE  M+  + I+GI+I
Sbjct: 121 EPEEYARIMNDAHLPIAAFGGTFLMMVGLSYFFDHEKKIHWLRGLEKVMARSATIRGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   E   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 181 AFVLALMLVFSWLIGGEEASIFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 241 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +L+VIM+ QT+V IPE+ TG     LI LS++SSI++
Sbjct: 301 HGAFYAILILAVIMYAQTLVHIPEVITGLGGAALIGLSLWSSIRH 345


>gi|209550908|ref|YP_002282825.1| hypothetical protein Rleg2_3332 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536664|gb|ACI56599.1| protein of unknown function DUF475 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 363

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 161/345 (46%), Positives = 241/345 (69%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M   + + S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQPATHHSSLSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 61  FDNAIVNANKLKEMTPVWQKRFLTWGIIIAVFGMRIVFPLAIVAIAARIGPWDALVLAAR 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I++ AH+PI+ FGGTFLMMV L++FF+ + K+HW   LE  M+  + I+GI+I
Sbjct: 121 EPEEYARIMTDAHLPIAAFGGTFLMMVGLSYFFDHEKKIHWFRGLEKVMARSATIRGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   +   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 181 AFVLALMLVFSWLIGGEQASVFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 241 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSVIM+ QT+V IPE+ TG     LI LS++SSI++
Sbjct: 301 HGAFYAILILSVIMYAQTLVHIPEVITGLGGATLIGLSLWSSIRH 345


>gi|119383066|ref|YP_914122.1| hypothetical protein Pden_0312 [Paracoccus denitrificans PD1222]
 gi|119372833|gb|ABL68426.1| protein of unknown function DUF475 [Paracoccus denitrificans
           PD1222]
          Length = 364

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 160/344 (46%), Positives = 234/344 (68%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
            +N  +   +H+F+W+ +VT  G   G  +GWQ T T+ GT++  +IC +LAV+EISLSF
Sbjct: 12  STNGTHRPTLHYFKWSFIVTALGLALGAVLGWQTTGTVGGTLTIFFICAVLAVLEISLSF 71

Query: 62  ENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYS 121
           +NAI+NA  L++M+  WQ+RFLTWGILIAVFGMRI+FP++IV I + I P +AM LA   
Sbjct: 72  DNAIVNANKLKEMTPKWQRRFLTWGILIAVFGMRIVFPLLIVVIAANIGPWQAMVLAASQ 131

Query: 122 PQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIF 181
           P +Y +I+  AH+PI+ FGGTFLMMV L+FFF+ +  +HW+ +LE  M   + ++GI++ 
Sbjct: 132 PDEYSRIMHDAHLPIAAFGGTFLMMVGLSFFFDHEKDVHWVRWLEHRMQRYATVRGIEVA 191

Query: 182 IVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLF 241
           +VL  +   S  L   +   F  S+   ++ F  +  L  +L S         K G+  F
Sbjct: 192 VVLVTVLIFSRFLEGADSQVFFHSAIWGLLTFLLVEVLGGLLDSSQEAMQAGAKGGIGAF 251

Query: 242 LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEH 301
           LYLE++DAS S DGVI +FA+T N F+I IGL IGA+YVRSMT++++++G L +Y++LEH
Sbjct: 252 LYLEVLDASFSFDGVIGAFALTHNLFVIAIGLGIGAMYVRSMTIMLVERGTLAEYRFLEH 311

Query: 302 GSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           G++Y+I  LSVIMF+Q +V IPE+ TG     LI +S +SSI+ 
Sbjct: 312 GAFYAIIALSVIMFVQPLVHIPEVITGLGGATLIGISFWSSIRW 355


>gi|126462873|ref|YP_001043987.1| hypothetical protein Rsph17029_2112 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104537|gb|ABN77215.1| protein of unknown function DUF475 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 360

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 160/343 (46%), Positives = 232/343 (67%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           + +   S I +F WA   TV G   G  +GWQ T T+ GT +  +IC +LAV+EISLSF+
Sbjct: 2   TTASGKSTISYFTWAFAFTVVGLALGGFLGWQTTGTIEGTATIFFICCVLAVLEISLSFD 61

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NAI+NA  L+ M+  WQ RFLTWGI+IAVFGMRIIFP++IV I + + P EA+ LA   P
Sbjct: 62  NAIVNANKLKTMTPEWQHRFLTWGIIIAVFGMRIIFPLLIVVIAAHLGPWEALKLAATQP 121

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
            +Y +I+ +AH PI+ FGGTFLMMV LT+FF+ +  +HW+ ++E   S  S I+G+++ +
Sbjct: 122 AEYSRIMHEAHTPIAAFGGTFLMMVGLTYFFDQEKDIHWVRWIEEQASRYSSIRGVEVAV 181

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFL 242
           VL  + G S +L   E   F++S+   ++ F  +  L   L           K G   FL
Sbjct: 182 VLCAVLGFSRLLEGAEQQVFINSALYGLLTFLLVEVLGGFLDHRQQALDAAAKGGFGAFL 241

Query: 243 YLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           YLE++DAS S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG
Sbjct: 242 YLEVLDASFSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVERGTLAQYRYLEHG 301

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           ++Y+I +LSVIM++QT+  IPE+ TG     LI +S++SSI+ 
Sbjct: 302 AFYAILILSVIMYVQTLTHIPEVITGLGGAGLIGISLWSSIRW 344


>gi|221639890|ref|YP_002526152.1| hypothetical protein RSKD131_1791 [Rhodobacter sphaeroides KD131]
 gi|221160671|gb|ACM01651.1| Hypothetical Protein RSKD131_1791 [Rhodobacter sphaeroides KD131]
          Length = 360

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 160/343 (46%), Positives = 232/343 (67%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           + +   S I +F WA   TV G   G  +GWQ T T+ GT +  +IC +LAV+EISLSF+
Sbjct: 2   TTASGKSTISYFTWAFAFTVVGLALGGFLGWQTTGTIEGTATIFFICCVLAVLEISLSFD 61

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NAI+NA  L+ M+  WQ RFLTWGI+IAVFGMRIIFP++IV I + + P EA+ LA   P
Sbjct: 62  NAIVNANKLKTMTPEWQHRFLTWGIIIAVFGMRIIFPLLIVVIAAHLGPWEALKLAATQP 121

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
            +Y +I+ +AH PI+ FGGTFLMMV LT+FF+ +  +HW+ ++E   S  S I+G+++ +
Sbjct: 122 AEYSRIMHEAHTPIAAFGGTFLMMVGLTYFFDQEKDIHWVRWIEEQASRYSSIRGVEVAV 181

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFL 242
           VL  + G S +L   E   F++S+   ++ F  +  L   L           K G   FL
Sbjct: 182 VLCAVLGFSRLLEGAEQQVFINSALYGLLTFLLVEVLGGFLDHRQQALDAAAKGGFGAFL 241

Query: 243 YLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           YLE++DAS S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG
Sbjct: 242 YLEVLDASFSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVERGTLAQYRYLEHG 301

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           ++Y+I +LSVIM++QT+  IPE+ TG     LI +S++SSI+ 
Sbjct: 302 AFYAILILSVIMYVQTLTHIPEVITGLGGAGLIGISLWSSIRW 344


>gi|241206320|ref|YP_002977416.1| hypothetical protein Rleg_3632 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860210|gb|ACS57877.1| protein of unknown function DUF475 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 363

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 164/345 (47%), Positives = 238/345 (68%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M       S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLS
Sbjct: 1   MNQTVTSKSSLSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQKRFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA  
Sbjct: 61  FDNAIVNANKLKEMTPVWQKRFLTWGIIIAVFGMRIVFPLAIVAIAAQIGPWDALVLAAR 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P +Y +I++ AH+PI+ FGGTFLMMV L +FFN + ++HWI  LE  M+  + IKGI+I
Sbjct: 121 EPAEYARIMNDAHLPIAAFGGTFLMMVGLNYFFNHEKQVHWIGGLEKMMARSATIKGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL+++   S ++   E   FV  +   ++ F  +  +  +L +         K GL  
Sbjct: 181 AFVLALMLVFSWLIGGEEATVFVHCAIYGLLTFLAVEVVGGLLDASQQTMSAAAKGGLGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLE
Sbjct: 241 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSVIM+ QT+V IPE+ TG     LI LS++SSI++
Sbjct: 301 HGAFYAILILSVIMYAQTMVHIPEVITGLGGAALIGLSLWSSIRH 345


>gi|150376529|ref|YP_001313125.1| hypothetical protein Smed_4388 [Sinorhizobium medicae WSM419]
 gi|150031076|gb|ABR63192.1| protein of unknown function DUF475 [Sinorhizobium medicae WSM419]
          Length = 365

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 169/345 (48%), Positives = 246/345 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M   S   S + +F+WA +VT AG L G  +GWQ T TL G ++  +IC +LAV+EISLS
Sbjct: 1   MTGGSTQTSSLGYFKWAFIVTGAGLLLGAWLGWQSTGTLGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I ++I PIEA+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAASIGPIEAVILAAT 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 QPEEYSRIMHEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L  +E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSKLLEADEAVVFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++  L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKKTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSV+M+ QT+V IPE+ TG     LI LS++SS+++
Sbjct: 301 HGAFYAILILSVVMYFQTLVHIPEVITGLGGAGLIGLSLWSSVRH 345


>gi|77464028|ref|YP_353532.1| hypothetical protein RSP_0459 [Rhodobacter sphaeroides 2.4.1]
 gi|77388446|gb|ABA79631.1| hypothetical protein RSP_0459 [Rhodobacter sphaeroides 2.4.1]
          Length = 360

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 159/343 (46%), Positives = 232/343 (67%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           + +   S I +F WA   T+ G   G  +GWQ T T+ GT +  +IC +LAV+EISLSF+
Sbjct: 2   TTASGKSTISYFTWAFAFTLVGLALGGFLGWQTTGTIEGTATIFFICCVLAVLEISLSFD 61

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NAI+NA  L+ M+  WQ RFLTWGI+IAVFGMRIIFP++IV I + + P EA+ LA   P
Sbjct: 62  NAIVNANKLKTMTPEWQHRFLTWGIIIAVFGMRIIFPLLIVVIAAHLGPWEALKLAATQP 121

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
            +Y +I+ +AH PI+ FGGTFLMMV LT+FF+ +  +HW+ ++E   S  S I+G+++ +
Sbjct: 122 AEYSRIMHEAHTPIAAFGGTFLMMVGLTYFFDQEKDIHWVRWIEEQASRYSSIRGVEVAV 181

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFL 242
           VL  + G S +L   E   F++S+   ++ F  +  L   L           K G   FL
Sbjct: 182 VLCAVLGFSRLLEGAEQQVFINSALYGLLTFLLVEVLGGFLDHRQQALDAAAKGGFGAFL 241

Query: 243 YLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           YLE++DAS S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG
Sbjct: 242 YLEVLDASFSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVERGTLAQYRYLEHG 301

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           ++Y+I +LSVIM++QT+  IPE+ TG     LI +S++SSI+ 
Sbjct: 302 AFYAILILSVIMYVQTLTHIPEVITGLGGAGLIGISLWSSIRW 344


>gi|116253837|ref|YP_769675.1| hypothetical protein RL4100 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258485|emb|CAK09589.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 362

 Score =  255 bits (651), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 160/339 (47%), Positives = 238/339 (70%)

Query: 7   YASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAIL 66
             S + +FRWA +VT  G + G  +GWQ T T+ G  +  +IC +LAV+EISLSF+NAI+
Sbjct: 6   TQSSLSYFRWAFIVTALGLVLGAVLGWQTTGTIGGMATVFFICTVLAVLEISLSFDNAIV 65

Query: 67  NAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
           NA  L++M+ +WQ+RFLTWGI+IAVFGMRI+FP+ IV I + I P +A+ LA   P +Y 
Sbjct: 66  NANKLKEMTPVWQQRFLTWGIIIAVFGMRIVFPLAIVAIAAQIGPWDALVLAAREPAEYA 125

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
           +I++ AH+PI+ FGGTFLMMV L++FF+ + K+HW+  LE  M+  + I+GI+I  VL++
Sbjct: 126 RIMNDAHLPIAAFGGTFLMMVGLSYFFDHEKKIHWLRGLEKVMARSATIRGIEIAFVLAL 185

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
           +   S ++   E   FV  +   ++ F  +  +  +L +         K GL  F+YLE+
Sbjct: 186 MLVFSWLIGGEEASVFVHCAIYGLLTFLAVEVVGELLDASQQTMSAAAKGGLGAFIYLEV 245

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG++Y+
Sbjct: 246 LDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLEHGAFYA 305

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           I +LSVIM+ QT+V IPE+ TG     LI LS++SSI++
Sbjct: 306 ILILSVIMYAQTLVHIPEVITGLGGAALIGLSLWSSIRH 344


>gi|227820093|ref|YP_002824064.1| hypothetical protein NGR_b18640 [Sinorhizobium fredii NGR234]
 gi|227339092|gb|ACP23311.1| integral membrane protein [Sinorhizobium fredii NGR234]
          Length = 362

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 165/345 (47%), Positives = 246/345 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +   +S + +F+WA L T AG + G  +GWQ T TLSG ++  ++C +LAV+EISLS
Sbjct: 1   MTQSRSQSSTLDYFKWAFLTTAAGLILGAWVGWQSTGTLSGMMTVFFVCAVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGI+IAVFGMRI+FP++IV I + I PI+A+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGIIIAVFGMRIVFPLLIVVIAANIGPIDAVILAAA 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+  AH+PI+ FGGTFLMMV L +FF+ +  +HWI ++E  M+  + I+GI+I
Sbjct: 121 RPEEYSRIMHDAHLPIAAFGGTFLMMVGLNYFFDHEKDVHWIAWIERKMARFATIRGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L   E  +FV ++   ++ F  +  +  +L +         + G   
Sbjct: 181 AFVLALILGFSTLLEGEEAVAFVHAAVYGLLTFLVVEIVGGLLDATEQTMSAAARGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTVMLVEKGTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I VLSV+M+ QT+V IPE+ TG     LI LS++SSI++
Sbjct: 301 HGAFYAILVLSVVMYFQTLVHIPEVITGLGGAGLIGLSLWSSIRH 345


>gi|222107044|ref|YP_002547835.1| hypothetical protein Avi_6115 [Agrobacterium vitis S4]
 gi|221738223|gb|ACM39119.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 353

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 166/345 (48%), Positives = 243/345 (70%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M + +   S++ +F+WA +VT+AG   G  +GW  T TL G  S  +IC +LAV+EISLS
Sbjct: 1   MSTATSSNSVLSYFKWAFIVTIAGLALGAWLGWNMTGTLGGMASVFFICAVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQ+RFLTWGILIAVFGMRIIFP+ IV I + I PIEA+ LA  
Sbjct: 61  FDNAIVNANKLKEMTPVWQQRFLTWGILIAVFGMRIIFPLAIVAIAAQIGPIEALKLAAA 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P +Y +I+++AH+PI+ FGGTFLMMV L +FF+ +  +HWI F+E  M+  + IKGI++
Sbjct: 121 EPAEYARIMNEAHLPIAAFGGTFLMMVGLNYFFDQEKDVHWIAFIEKHMARYASIKGIEV 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL +I   S+ L   E  +F+ S+   ++ F  +  +  +L +         K GL  
Sbjct: 181 AFVLVLILLFSSFLEGAEAITFLYSAIYGLLTFLAVELVGGLLDASQQTMSAAAKGGLGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+YLE++DAS S DGVI +FA+T+N F+I IGL +GA+YVRSMT++++++G L +Y+YLE
Sbjct: 241 FIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGVGAMYVRSMTIMLVEKGTLAEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSVIM+ QT+V IPE+ TG     LI +S++SSI+ 
Sbjct: 301 HGAFYAILILSVIMYCQTLVHIPEVITGLGGAALIGISLWSSIRY 345


>gi|15887561|ref|NP_353242.1| hypothetical protein Atu0209 [Agrobacterium tumefaciens str. C58]
 gi|15155096|gb|AAK86027.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 368

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 155/350 (44%), Positives = 236/350 (67%), Gaps = 8/350 (2%)

Query: 4   NSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFEN 63
           ++   + + +F+WA +VTV G + G  +GW+ T T+ GT +  +IC +LAV+EISLSF+N
Sbjct: 2   SAAQKTTLSYFKWAFIVTVVGLILGGYLGWEMTGTIGGTATIFFICAVLAVLEISLSFDN 61

Query: 64  AILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQ 123
           AI+NA  L+ M+ +WQ RFLTWGILIAVFGMRI+FP++IV + + + P  A+ +A   P+
Sbjct: 62  AIVNANKLKDMTPVWQHRFLTWGILIAVFGMRIVFPLLIVVVAANVGPWTALVMAATQPE 121

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV 183
            Y +I+  AH+PI+ FGGTFLMMV L FFF+ +  +HW+ ++E   +  S +KGI+I  V
Sbjct: 122 RYAEIMRDAHLPIAAFGGTFLMMVGLNFFFDHEKDVHWVRWIEEKAATYSSVKGIEIAFV 181

Query: 184 LSIIFGISNILPTNEMY--------SFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
           L ++   S I+  ++          +F  S+   ++ F  +  +  +L           K
Sbjct: 182 LIVMLVFSRIIGASDNPELGPVAANTFFHSAIWGLLTFLLVEVVGGILDRSQEMLEGAAK 241

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
            G   FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L +
Sbjct: 242 GGFGAFLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLAE 301

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           Y+YLEHG++Y+I +LSVIM++QT+  IPE+ TG     LI +S++SSI++
Sbjct: 302 YRYLEHGAFYAILILSVIMYVQTMFHIPEVITGLGGATLIGISLWSSIRH 351


>gi|222087106|ref|YP_002545641.1| hypothetical protein Arad_3862 [Agrobacterium radiobacter K84]
 gi|221724554|gb|ACM27710.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 366

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 168/345 (48%), Positives = 236/345 (68%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M   +   S++ +F WA  VT AG   G  +GW  T T  G  +  +IC +LAV+EISLS
Sbjct: 1   MTQPTSSKSVLGYFGWAFAVTAAGLALGALLGWNATGTFGGLATAFFICAVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L++M+ +WQ RFLTWGI+IAVFGMRIIFP+ IV I + INP EA+ LA  
Sbjct: 61  FDNAIVNANKLKEMTPLWQHRFLTWGIVIAVFGMRIIFPLAIVAIAAWINPWEALKLAAA 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P+ Y +I+  AH+PI+ FGGTFLMMV LT+FFN +  +HWI F+E AM+  + IKGI+I
Sbjct: 121 EPEQYARIMHDAHLPIAAFGGTFLMMVGLTYFFNHEKDVHWIAFVEKAMARFATIKGIEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL +I   S++L   +  +F+ +S   ++ F  +  L   L +         K G   
Sbjct: 181 AFVLILILVFSSLLDGEDSTTFLHASIYGLLTFLLVEVLAGFLDASQKTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L  Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLAHYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSVIM++QT++ IPE+ TG     LI +S++SSI+ 
Sbjct: 301 HGAFYAILILSVIMYVQTLMHIPEVITGLGGAALIGISLWSSIRY 345


>gi|325291647|ref|YP_004277511.1| hypothetical protein AGROH133_03244 [Agrobacterium sp. H13-3]
 gi|325059500|gb|ADY63191.1| hypothetical protein AGROH133_03244 [Agrobacterium sp. H13-3]
          Length = 368

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 154/350 (44%), Positives = 238/350 (68%), Gaps = 8/350 (2%)

Query: 4   NSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFEN 63
           ++   + + +F+WA +VT+ G + G  +GW+ T T+SGT +  +IC +LAV+EISLSF+N
Sbjct: 2   SAAQKTTLSYFKWAFIVTIVGLILGGYLGWEMTGTVSGTATIFFICAVLAVLEISLSFDN 61

Query: 64  AILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQ 123
           AI+NA  L++M+ +WQ RFLTWGILIAVFGMRI+FP++IV + + + P  A+ +A   P+
Sbjct: 62  AIVNANKLKEMTPVWQHRFLTWGILIAVFGMRIVFPLLIVVVAANVGPWTALVMAATQPE 121

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV 183
            Y +I+  AH+PI+ FGGTFLMMV L FFF+ +  +HW+ ++E   +  S +KGI+I  V
Sbjct: 122 RYAEIMRDAHLPIAAFGGTFLMMVGLNFFFDHEKDVHWVRWIEEKAAVYSSVKGIEIAFV 181

Query: 184 LSIIFGISNILPTNEMY--------SFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
           L ++   S I+  ++          +F  ++   ++ F  +  +  +L           K
Sbjct: 182 LVVMLAFSRIIGASDNPELGPVAANTFFHAAIWGLLTFLLVEVVGGILDRSQEVLEGAAK 241

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
            G   FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L +
Sbjct: 242 GGFGAFLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLAE 301

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           Y+YLEHG++Y+I +LSVIM++QT+  IPE+ TG     LI +S++SSI++
Sbjct: 302 YRYLEHGAFYAILILSVIMYVQTMFHIPEVITGLGGATLIGISLWSSIRH 351


>gi|239832345|ref|ZP_04680674.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824612|gb|EEQ96180.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 385

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 147/338 (43%), Positives = 227/338 (67%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            + + +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 31  MATLRYFIWPMVFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVN 90

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ M+  WQ RFLTWGI+IAVFGMRIIFP+ IV +    +PI A+ LAI+ P +Y +
Sbjct: 91  ARILRDMTPEWQHRFLTWGIIIAVFGMRIIFPLAIVAVAMWTDPISALKLAIWQPDEYAR 150

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +IS++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 151 VISESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIKAIESRMSKFASVQGVEIGVAIALI 210

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L     ++F+ ++   ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 211 IFFSYQLDAEHSHTFLIAALFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 270

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N FII IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 271 DASFSFDGVIGAFALTTNLFIIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 330

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL+VIM++QT+V IPE+ TG     LI LS  SS++ 
Sbjct: 331 LVLAVIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRY 368


>gi|153009036|ref|YP_001370251.1| hypothetical protein Oant_1706 [Ochrobactrum anthropi ATCC 49188]
 gi|151560924|gb|ABS14422.1| protein of unknown function DUF475 [Ochrobactrum anthropi ATCC
           49188]
          Length = 355

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 147/338 (43%), Positives = 227/338 (67%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            + + +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 1   MATLRYFIWPMVFTVLGLAGAVWLGFEMTGTFGGMVSVFIICAVLSVLEISLSFDNAIVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ M+  WQ RFLTWGI+IAVFGMRIIFP+ IV +    +PI A+ LAI+ P +Y +
Sbjct: 61  ARILRDMTPEWQHRFLTWGIIIAVFGMRIIFPLAIVAVAMWTDPISALKLAIWQPDEYAR 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +IS++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 121 VISESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIKAIESRMSKFASVQGVEIGVAIALI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L     ++F+ ++   ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 181 IFFSYQLDAEHSHTFLIAALFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N FII IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVIGAFALTTNLFIIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL+VIM++QT+V IPE+ TG     LI LS  SS++ 
Sbjct: 301 LVLAVIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRY 338


>gi|254710506|ref|ZP_05172317.1| hypothetical protein BpinB_09617 [Brucella pinnipedialis B2/94]
 gi|256031999|ref|ZP_05445613.1| hypothetical protein BpinM2_15384 [Brucella pinnipedialis
           M292/94/1]
 gi|261318075|ref|ZP_05957272.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|265989108|ref|ZP_06101665.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|261297298|gb|EEY00795.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|264661305|gb|EEZ31566.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 353

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 146/338 (43%), Positives = 226/338 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +   +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 1   MAAYRYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y +
Sbjct: 61  ARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYAR 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +I+++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 121 VIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRTIESRMSKFASVQGVEIGVAIALI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 181 IFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL++IM++QT+V IPE+ TG     LI LS  SS++ 
Sbjct: 301 LVLAIIMYVQTLVHIPEVITGLIGVALIGLSFMSSLRY 338


>gi|254708137|ref|ZP_05169965.1| hypothetical protein BpinM_14582 [Brucella pinnipedialis
           M163/99/10]
 gi|254714499|ref|ZP_05176310.1| hypothetical protein BcetM6_14398 [Brucella ceti M644/93/1]
 gi|254717397|ref|ZP_05179208.1| hypothetical protein BcetM_13527 [Brucella ceti M13/05/1]
 gi|256160197|ref|ZP_05457891.1| hypothetical protein BcetM4_14404 [Brucella ceti M490/95/1]
 gi|256255403|ref|ZP_05460939.1| hypothetical protein BcetB_14176 [Brucella ceti B1/94]
 gi|261219226|ref|ZP_05933507.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261222606|ref|ZP_05936887.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261315639|ref|ZP_05954836.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261322287|ref|ZP_05961484.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|265998571|ref|ZP_06111128.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260921190|gb|EEX87843.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260924315|gb|EEX90883.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294977|gb|EEX98473.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261304665|gb|EEY08162.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|262553195|gb|EEZ09029.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 353

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 146/338 (43%), Positives = 226/338 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +   +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 1   MAAYRYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y +
Sbjct: 61  ARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYAR 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +I+++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 121 VIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRTIESRMSKFASVQGVEIGVAIALI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 181 IFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL++IM++QT+V IPE+ TG     LI LS  SS++ 
Sbjct: 301 LVLAIIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRY 338


>gi|289641606|ref|ZP_06473767.1| protein of unknown function DUF475 [Frankia symbiont of Datisca
           glomerata]
 gi|289508587|gb|EFD29525.1| protein of unknown function DUF475 [Frankia symbiont of Datisca
           glomerata]
          Length = 426

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 120/376 (31%), Positives = 198/376 (52%), Gaps = 49/376 (13%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F W++ +TVAG      +             T  I  ILAV+EISLSF+NA++NA  
Sbjct: 32  LRIFGWSLAITVAGVALAGVL---------DGPKTAAIVAILAVLEISLSFDNAVINATI 82

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++M+  WQK FLT G+LIAVFGMR++FPI+IV + + + PIE  +LA+ +P +Y   + 
Sbjct: 83  LRRMNEFWQKIFLTVGVLIAVFGMRLLFPIVIVALTAHLGPIEVFDLALNNPDEYATRLH 142

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FL M+ L F F+ +  + W+ ++E  +    ++  +   + L  +  +
Sbjct: 143 DAHPAIAAFGGIFLFMIFLDFMFDPERDVQWLRWIEEPLRRAGQLDVLSAVVALVALLIV 202

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-------------------- 230
           +     +     +++  A I  + G+  L     +                         
Sbjct: 203 AEAFSGDATQQVLTAGVAGIATYLGVRGLGEFFEARGVGADDDDAQEAEKDTGDATAVVP 262

Query: 231 --------------------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIV 270
                               +  GK    LF+YLE++DAS S DGV+ +FAIT+  F+I 
Sbjct: 263 AGAASTAEATGGKGGPNALVLASGKAAFFLFMYLEVLDASFSFDGVVGAFAITQEIFVIA 322

Query: 271 IGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTS 330
            GL IGA+Y+RS+T+ ++++G L +Y YLEHG++Y+I  L+VI+ +    ++PEI TG  
Sbjct: 323 AGLGIGAMYIRSITVYLVRKGTLQEYVYLEHGAHYAIGALAVILAVSIETEVPEIITGLV 382

Query: 331 STILIFLSIYSSIKNK 346
               I +++ SS++ +
Sbjct: 383 GVGFIGVALVSSLRRR 398


>gi|161619411|ref|YP_001593298.1| hypothetical protein BCAN_A1500 [Brucella canis ATCC 23365]
 gi|254704721|ref|ZP_05166549.1| hypothetical protein Bsuib36_12542 [Brucella suis bv. 3 str. 686]
 gi|260566032|ref|ZP_05836502.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261755414|ref|ZP_05999123.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|161336222|gb|ABX62527.1| protein of unknown function DUF475 [Brucella canis ATCC 23365]
 gi|260155550|gb|EEW90630.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261745167|gb|EEY33093.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 353

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 146/338 (43%), Positives = 226/338 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +   +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 1   MAAYRYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICTVLSVLEISLSFDNAIVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y +
Sbjct: 61  ARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYAR 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +I+++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 121 VIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 181 IFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL++IM++QT+V IPE+ TG     LI LS  SS++ 
Sbjct: 301 LVLAIIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRY 338


>gi|84499490|ref|ZP_00997778.1| hypothetical protein OB2597_06165 [Oceanicola batsensis HTCC2597]
 gi|84392634|gb|EAQ04845.1| hypothetical protein OB2597_06165 [Oceanicola batsensis HTCC2597]
          Length = 357

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 160/335 (47%), Positives = 243/335 (72%), Gaps = 1/335 (0%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           I +F WA  VT AG + G  +GW  + T+ GT++  +IC +LAV+EISLSF+NAI+NA  
Sbjct: 18  ISYFFWAFAVTAAGLILGGWLGWAGSRTVEGTLTIFFICAVLAVLEISLSFDNAIVNANK 77

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ MS +WQ+RFLTWGILIAVFGMRI+FP++IV + + I P+EA+ LA   P+ Y +I+ 
Sbjct: 78  LKDMSPVWQRRFLTWGILIAVFGMRIVFPLLIVVVAADIGPVEAIRLAASEPEAYARIMH 137

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +AH+ I+ FGGTFLMMV L FFF+ +  +HW+ +LE  ++  + +KGI+I +VL ++  I
Sbjct: 138 EAHLSIAAFGGTFLMMVGLGFFFDHEKDIHWVRWLEERIARYASVKGIEIALVLGVVMAI 197

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           S +   ++ +SF+ S+   +I F  +  L  +L   +    T  + GL  FLYLE++DAS
Sbjct: 198 SQLHGGDKGHSFLVSAIWGLITFLAVEVLGGILD-RNEAMKTGAQGGLGAFLYLEVLDAS 256

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L++Y+YLEHG++Y+I +L
Sbjct: 257 FSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLSQYRYLEHGAFYAITIL 316

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +VIMFLQ+ V+IPE+ TG    +LI ++++SSI+ 
Sbjct: 317 AVIMFLQSFVEIPEVITGLGGALLIGVALWSSIRW 351


>gi|23502334|ref|NP_698461.1| hypothetical protein BR1465 [Brucella suis 1330]
 gi|163843717|ref|YP_001628121.1| hypothetical protein BSUIS_A1518 [Brucella suis ATCC 23445]
 gi|254702184|ref|ZP_05164012.1| hypothetical protein Bsuib55_15179 [Brucella suis bv. 5 str. 513]
 gi|254719495|ref|ZP_05181306.1| hypothetical protein Bru83_08128 [Brucella sp. 83/13]
 gi|261752754|ref|ZP_05996463.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|265984504|ref|ZP_06097239.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294852787|ref|ZP_06793460.1| hypothetical protein BAZG_01721 [Brucella sp. NVSL 07-0026]
 gi|306839274|ref|ZP_07472091.1| integral membrane protein [Brucella sp. NF 2653]
 gi|306843180|ref|ZP_07475796.1| integral membrane protein [Brucella sp. BO2]
 gi|23348314|gb|AAN30376.1| membrane protein, putative [Brucella suis 1330]
 gi|163674440|gb|ABY38551.1| protein of unknown function DUF475 [Brucella suis ATCC 23445]
 gi|261742507|gb|EEY30433.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|264663096|gb|EEZ33357.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294821376|gb|EFG38375.1| hypothetical protein BAZG_01721 [Brucella sp. NVSL 07-0026]
 gi|306286631|gb|EFM58198.1| integral membrane protein [Brucella sp. BO2]
 gi|306405821|gb|EFM62083.1| integral membrane protein [Brucella sp. NF 2653]
          Length = 353

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 146/338 (43%), Positives = 226/338 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +   +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 1   MAAYRYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y +
Sbjct: 61  ARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYAR 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +I+++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 121 VIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 181 IFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL++IM++QT+V IPE+ TG     LI LS  SS++ 
Sbjct: 301 LVLAIIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRY 338


>gi|306844362|ref|ZP_07476953.1| integral membrane protein [Brucella sp. BO1]
 gi|306275298|gb|EFM57045.1| integral membrane protein [Brucella sp. BO1]
          Length = 353

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 146/338 (43%), Positives = 226/338 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +   +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 1   MAAYRYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y +
Sbjct: 61  ARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYAR 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +I+++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 121 VIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 181 IFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL++IM++QT+V IPE+ TG     LI LS  SS++ 
Sbjct: 301 LVLAIIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRY 338


>gi|62290356|ref|YP_222149.1| hypothetical protein BruAb1_1460 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700279|ref|YP_414853.1| hypothetical protein BAB1_1485 [Brucella melitensis biovar Abortus
           2308]
 gi|189024587|ref|YP_001935355.1| Protein of unknown function DUF475 [Brucella abortus S19]
 gi|225852945|ref|YP_002733178.1| hypothetical protein BMEA_A1515 [Brucella melitensis ATCC 23457]
 gi|237815860|ref|ZP_04594857.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254694148|ref|ZP_05155976.1| hypothetical protein Babob3T_05679 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697800|ref|ZP_05159628.1| hypothetical protein Babob28_08853 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730689|ref|ZP_05189267.1| hypothetical protein Babob42_05709 [Brucella abortus bv. 4 str.
           292]
 gi|256045092|ref|ZP_05447993.1| hypothetical protein Bmelb1R_11429 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256114022|ref|ZP_05454799.1| hypothetical protein Bmelb3E_14625 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256263573|ref|ZP_05466105.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260546896|ref|ZP_05822635.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565309|ref|ZP_05835793.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260758404|ref|ZP_05870752.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260762230|ref|ZP_05874573.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|261214447|ref|ZP_05928728.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|265991521|ref|ZP_06104078.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995359|ref|ZP_06107916.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|62196488|gb|AAX74788.1| hypothetical protein BruAb1_1460 [Brucella abortus bv. 1 str.
           9-941]
 gi|82616380|emb|CAJ11441.1| Protein of unknown function DUF475 [Brucella melitensis biovar
           Abortus 2308]
 gi|189020159|gb|ACD72881.1| Protein of unknown function DUF475 [Brucella abortus S19]
 gi|225641310|gb|ACO01224.1| protein of unknown function DUF475 [Brucella melitensis ATCC 23457]
 gi|237789158|gb|EEP63369.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260095946|gb|EEW79823.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151377|gb|EEW86471.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668722|gb|EEX55662.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672662|gb|EEX59483.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260916054|gb|EEX82915.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|262766472|gb|EEZ12261.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002305|gb|EEZ14880.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093624|gb|EEZ17629.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326409488|gb|ADZ66553.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326539194|gb|ADZ87409.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 353

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 146/338 (43%), Positives = 226/338 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +   +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 1   MAAYRYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y +
Sbjct: 61  ARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLGIVAIAMWTDPISALKLAIWQPNEYAR 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +I+++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 121 VIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 181 IFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL++IM++QT+V IPE+ TG     LI LS  SS++ 
Sbjct: 301 LVLAIIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRY 338


>gi|254689657|ref|ZP_05152911.1| hypothetical protein Babob68_05689 [Brucella abortus bv. 6 str.
           870]
 gi|256257908|ref|ZP_05463444.1| hypothetical protein Babob9C_11296 [Brucella abortus bv. 9 str.
           C68]
 gi|260755185|ref|ZP_05867533.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260884200|ref|ZP_05895814.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297248742|ref|ZP_06932460.1| hypothetical protein BAYG_01708 [Brucella abortus bv. 5 str. B3196]
 gi|260675293|gb|EEX62114.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873728|gb|EEX80797.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297175911|gb|EFH35258.1| hypothetical protein BAYG_01708 [Brucella abortus bv. 5 str. B3196]
          Length = 353

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 146/338 (43%), Positives = 226/338 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +   +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 1   MAAYRYFIWPMIFTVLGLAGTVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y +
Sbjct: 61  ARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLGIVAIAMWTDPISALKLAIWQPNEYAR 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +I+++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 121 VIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 181 IFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL++IM++QT+V IPE+ TG     LI LS  SS++ 
Sbjct: 301 LVLAIIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRY 338


>gi|17986828|ref|NP_539462.1| hypothetical protein BMEI0545 [Brucella melitensis bv. 1 str. 16M]
 gi|17982462|gb|AAL51726.1| integral membrane protein [Brucella melitensis bv. 1 str. 16M]
          Length = 353

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 146/338 (43%), Positives = 226/338 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +   +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 1   MAAYRYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y +
Sbjct: 61  ARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLGIVAIAMWTDPISALKLAIWQPNEYAR 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +I+++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 121 VIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 181 IFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL++IM++QT+V IPE+ TG     LI LS  SS++ 
Sbjct: 301 LVLAIIMYVQTLVHIPEVITGLIGAALIGLSFMSSMRY 338


>gi|146278415|ref|YP_001168574.1| hypothetical protein Rsph17025_2380 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556656|gb|ABP71269.1| protein of unknown function DUF475 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 361

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 157/337 (46%), Positives = 232/337 (68%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +F WA L T  G   G  +GW  T T+ GT +  +IC +LAV+EISLSF+NAI+NA
Sbjct: 8   STVSYFTWAFLFTALGLALGGYLGWATTGTIEGTATIFFICCVLAVLEISLSFDNAIVNA 67

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M+  WQ+RFLTWGILIAVFGMRI+FP++IV I +++ P EA+ LA   P +Y +I
Sbjct: 68  NKLKTMTPKWQRRFLTWGILIAVFGMRIVFPLLIVVIAASLGPWEAVKLAATQPAEYSRI 127

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           + +AH PI+ FGGTFLMMV LT+FF+ +  +HW+ ++E   S  S I+G+++ +VL  + 
Sbjct: 128 MHEAHTPIAAFGGTFLMMVGLTYFFDQEKDIHWVRWIEEQASRYSSIRGVEVAVVLCAVL 187

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
           G S +L   E   F++S+   ++ F  +  L   L           K G+  FLYLE++D
Sbjct: 188 GFSRLLEGAEQQVFLNSAIYGLLTFLLVEVLGGFLDHRQQALDAAAKGGVGAFLYLEVLD 247

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+++N F+I IGL IGA+YVRSMT++++++G L +Y+YLEHG++Y+I 
Sbjct: 248 ASFSFDGVIGAFALSQNLFVIAIGLGIGAMYVRSMTIMLVERGTLAQYRYLEHGAFYAIL 307

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +LS+IM++QT+  IPE+ TG     LI +S++SSI+ 
Sbjct: 308 ILSLIMYVQTLTHIPEVITGLGGAGLIGISLWSSIRW 344


>gi|225627910|ref|ZP_03785946.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260169136|ref|ZP_05755947.1| hypothetical protein BruF5_12406 [Brucella sp. F5/99]
 gi|261758643|ref|ZP_06002352.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|225617073|gb|EEH14119.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|261738627|gb|EEY26623.1| conserved hypothetical protein [Brucella sp. F5/99]
          Length = 353

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 146/338 (43%), Positives = 225/338 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +   +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 1   MAAYRYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y +
Sbjct: 61  ARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYAR 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +I+++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 121 VIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRTIESRMSKFASVQGVEIGVAIALI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L  +  ++FV      ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 181 IFFSYQLDADHSHTFVIVGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL++IM++QT+V IPE+ TG     LI LS  SS++ 
Sbjct: 301 LVLAIIMYVQTLVHIPEVITGLIGAALIGLSFMSSLRY 338


>gi|256061520|ref|ZP_05451664.1| hypothetical protein Bneo5_14300 [Brucella neotomae 5K33]
 gi|261325528|ref|ZP_05964725.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301508|gb|EEY05005.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 353

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 145/338 (42%), Positives = 225/338 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +   +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 1   MAAYRYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y +
Sbjct: 61  ARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYAR 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +I+++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 121 VIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 181 IFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL++IM++Q +V IPE+ TG     LI LS  SS++ 
Sbjct: 301 LVLAIIMYVQMLVHIPEVITGLIGAALIGLSFMSSLRY 338


>gi|256369881|ref|YP_003107392.1| hypothetical protein BMI_I1477 [Brucella microti CCM 4915]
 gi|256000044|gb|ACU48443.1| hypothetical protein BMI_I1477 [Brucella microti CCM 4915]
          Length = 353

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 146/338 (43%), Positives = 226/338 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +   +F W ++ TV G    + +G++ T T  G +S   IC +L+V+EISLSF+NAI+N
Sbjct: 1   MAAYRYFIWPMIFTVLGLAGAVWLGYELTGTFGGMVSVFIICAVLSVLEISLSFDNAIVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ IV I    +PI A+ LAI+ P +Y +
Sbjct: 61  ARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLAIVAIAMWTDPISALKLAIWQPNEYAR 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +I+++H  I+ FGGTFL+MV + +FF+ +  +HWI  +E  MS  + ++G++I + +++I
Sbjct: 121 VIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHWIRMIESRMSKFASVQGVEIGVAIALI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  L  +  ++FV +    ++ F  +  L  VL +         + GL  F+YLE++
Sbjct: 181 IFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGEVLDATQEQMDMVHRGGLGAFIYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FA+T N F+I IGL IGA YVRS+T++++++  L +Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVRSLTIMLVERKTLGQYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            VL++IM++QT+V IPE+ TG     LI LS  SS++ 
Sbjct: 301 LVLAIIMYVQTLVPIPEVITGLIGAALIGLSFMSSLRY 338


>gi|307321370|ref|ZP_07600769.1| protein of unknown function DUF475 [Sinorhizobium meliloti AK83]
 gi|306893015|gb|EFN23802.1| protein of unknown function DUF475 [Sinorhizobium meliloti AK83]
          Length = 365

 Score =  241 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 167/345 (48%), Positives = 246/345 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +S   + + +F+WA +VT AG L G  +GWQ T T+ G ++  +IC +LAV+EISLS
Sbjct: 1   MTGSSAQTTALGYFKWAFIVTAAGLLLGGWLGWQSTGTIGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I + I PI+A+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAAGIGPIDAVILAAA 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 RPEEYSRIMHEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L   E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSRLLEAEEAVIFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSV+M+ QT++ IPE+ TG     LI LS++SSI++
Sbjct: 301 HGAFYAILILSVVMYFQTLIHIPEVITGLGGAGLIGLSLWSSIRH 345


>gi|307309387|ref|ZP_07589046.1| protein of unknown function DUF475 [Sinorhizobium meliloti BL225C]
 gi|306900117|gb|EFN30736.1| protein of unknown function DUF475 [Sinorhizobium meliloti BL225C]
          Length = 365

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 167/345 (48%), Positives = 246/345 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +S   + + +F+WA +VT AG L G  +GWQ T T+ G ++  +IC +LAV+EISLS
Sbjct: 1   MTGSSAQTTALGYFKWAFIVTAAGLLLGGWLGWQSTGTIGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I + I PI+A+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAAGIGPIDAVILAAS 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 RPEEYSRIMHEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L   E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSRLLEAEEAVVFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSV+M+ QT++ IPE+ TG     LI LS++SSI++
Sbjct: 301 HGAFYAILILSVVMYFQTLIHIPEVITGLGGAGLIGLSLWSSIRH 345


>gi|16265042|ref|NP_437834.1| hypothetical protein SM_b21468 [Sinorhizobium meliloti 1021]
 gi|15141181|emb|CAC49694.1| conserved hypothetical membrane protein [Sinorhizobium meliloti
           1021]
          Length = 365

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 167/345 (48%), Positives = 247/345 (71%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           M  +S   + + +F+WA +VT AG L G  +GWQ T T+ G ++  +IC +LAV+EISLS
Sbjct: 1   MTGSSAQTTALGYFKWAFIVTAAGLLLGGWLGWQSTGTIGGMMTVFFICTVLAVLEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           F+NAI+NA  L+ M+ +WQ+RFLTWGILIAVFGMRI+FP++IV I + I+PI+A+ LA  
Sbjct: 61  FDNAIVNANKLKDMTPVWQQRFLTWGILIAVFGMRIVFPLLIVVIAAGISPIDAVILAAS 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P++Y +I+ +AH+PI+ FGGTFLMMV LT+FF+ +  +HWI +LE  M+  + IKG++I
Sbjct: 121 RPEEYSRIMLEAHLPIAAFGGTFLMMVGLTYFFDHEKDVHWIAWLESRMARFATIKGVEI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             VL++I G S +L   E   FV +    ++ F  +  +  +L +         K G   
Sbjct: 181 AFVLALILGFSRLLEAEEAVVFVHACVYGLLTFLAVEVVGGLLDASQQTMSAAAKGGFGA 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLE++DAS S DGVI +FA+T+N FII IGL IGA+YVRSMT++++++G L++Y+YLE
Sbjct: 241 FLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLSEYRYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           HG++Y+I +LSV+M+ QT++ IPE+ TG     LI LS++SSI++
Sbjct: 301 HGAFYAILILSVVMYFQTLIHIPEVITGLGGAGLIGLSLWSSIRH 345


>gi|332185742|ref|ZP_08387489.1| integral membrane TerC family protein [Sphingomonas sp. S17]
 gi|332014100|gb|EGI56158.1| integral membrane TerC family protein [Sphingomonas sp. S17]
          Length = 362

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 142/336 (42%), Positives = 216/336 (64%), Gaps = 1/336 (0%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+ +++ + L T         +G+Q T TL GT+S ++I  +L V+E+SLSF+NA++NA 
Sbjct: 2   LLKYYKGSFLFTGICLAIAAWLGFQSTGTLPGTLSVLWIVAVLGVLEVSLSFDNAVVNAT 61

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M   W++RFLTWGILIAVFGMRI+FP+ IV I + + PIEA+ LA   P  Y +II
Sbjct: 62  VLRDMDDKWRRRFLTWGILIAVFGMRIVFPLAIVAIAAHMGPIEAIKLAAGDPVRYEQII 121

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AHV ISGFGG+FL MV L FF   +   HW+  +E  ++ L +I G+   IVL  ++ 
Sbjct: 122 TSAHVGISGFGGSFLAMVGLNFFLGDEKDEHWLGVIERPLAALREISGLATGIVLLALYT 181

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-SDSSNNVTHGKHGLNLFLYLEIID 248
           IS  +P  E  +F+++    ++ +  ++ +  +L     +      + G   FLYLE++D
Sbjct: 182 ISQFIPVEEAMTFLTAGIFGLLTYIAVHAVGVLLEGDGDAATGAAARSGFAAFLYLEVLD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA++ N FII +GL IGA++VRSMT++++ +G L +Y+YLEHG++Y+I 
Sbjct: 242 ASFSFDGVIGAFALSNNLFIIALGLGIGAMFVRSMTIMLVDKGTLTQYRYLEHGAFYAIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
            L+ IM L    +IPE  TG     LI LS ++S++
Sbjct: 302 ALAAIMLLSVRFEIPETVTGLIGATLIGLSFWASVR 337


>gi|149184855|ref|ZP_01863173.1| hypothetical protein ED21_29093 [Erythrobacter sp. SD-21]
 gi|148832175|gb|EDL50608.1| hypothetical protein ED21_29093 [Erythrobacter sp. SD-21]
          Length = 356

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 138/340 (40%), Positives = 230/340 (67%), Gaps = 3/340 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           ++  ++ +++L T   F   +  GW  T +++ T+  ++I ++L+++E+SLSF+NA++NA
Sbjct: 3   TIRKYYTFSLLFTAVCFALAVWYGWSSTGSITATLGILWIVVVLSILEVSLSFDNAVVNA 62

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M  +WQ+RFLT GILIAVFGMRI+FPI IV + + + P EA++L++  PQ Y +I
Sbjct: 63  TVLRDMDPVWQQRFLTIGILIAVFGMRIVFPIAIVSLAAGVGPGEAVSLSLNDPQRYEQI 122

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +S AHV I+GFGG FL MV LTFFF     +HWI  LE  ++  S +  ++I +VLS+++
Sbjct: 123 VSDAHVSIAGFGGAFLAMVGLTFFFEEDKDVHWIAVLERTINKFSNVPAVEIGLVLSLVY 182

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLE 245
           G+S +L  ++  +F++++   ++ F  ++ + +++ +  +     G   K GL  FLYLE
Sbjct: 183 GVSTLLSPDDAITFLTAAILGLVTFIAVHAIAAIIEAQEARKKAAGEIVKSGLGGFLYLE 242

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           ++DAS S DGVI +FA++ N  II +GL++GA++VRSMT+ +++ G L +Y+YLEHG+++
Sbjct: 243 VLDASFSFDGVIGAFALSNNMIIIALGLSVGAMFVRSMTIHLVRTGTLAQYRYLEHGAFW 302

Query: 306 SIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +I VL +IM L     IPE  TG    +LI LS + S+++
Sbjct: 303 AIIVLGIIMLLSARWHIPETVTGLLGAVLIGLSFWWSVRH 342


>gi|85709685|ref|ZP_01040750.1| hypothetical protein NAP1_12408 [Erythrobacter sp. NAP1]
 gi|85688395|gb|EAQ28399.1| hypothetical protein NAP1_12408 [Erythrobacter sp. NAP1]
          Length = 350

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 140/336 (41%), Positives = 224/336 (66%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ HF  ++L T      G   GW    T+ G +S ++IC +LAV+E+SLSF+NA +NA 
Sbjct: 1   MLKHFWGSLLFTAVCLALGGWYGWALHGTIGGMLSILWICAVLAVLEVSLSFDNAAVNAS 60

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M  +WQ+RFLTWGI IAVFGMRI+FPI+IV + +++ PI+A+ LA+  P +Y +I+
Sbjct: 61  ILKDMDPVWQQRFLTWGIAIAVFGMRIVFPIVIVMVAASLGPIDAVRLALSDPAEYQRIV 120

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           S AH+ + GFGG FL MV L FFF++  +L+WI  +E  ++ ++ I+ I I +VL+  + 
Sbjct: 121 SDAHIGLMGFGGAFLGMVGLKFFFDADKELNWIASIERPLAKVADIEAISIGLVLAATWA 180

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S +L   +  +F+ ++   ++ +  +  +  VL   + ++    K G   FLYLE++DA
Sbjct: 181 TSTMLADADALTFIIAAIGGLLTYLAVEIVNHVLEPPTPSSGDVAKAGFGAFLYLEVLDA 240

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA+T N  II IGL IGA++VRSMT+ ++++G +++Y+YLEHG++Y+I  
Sbjct: 241 SFSFDGVIGAFALTNNLIIIAIGLGIGAMFVRSMTIFLVRKGTMSEYRYLEHGAFYAILA 300

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ IM++ T   IPE+ TG    +LI L+ +SS++ 
Sbjct: 301 LATIMYINTFSHIPEVITGLIGAVLIGLAFWSSVRA 336


>gi|85373895|ref|YP_457957.1| hypothetical protein ELI_05340 [Erythrobacter litoralis HTCC2594]
 gi|84786978|gb|ABC63160.1| conserved hypothetical membrane protein [Erythrobacter litoralis
           HTCC2594]
          Length = 352

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 146/339 (43%), Positives = 237/339 (69%), Gaps = 3/339 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ ++ +++  T   F      GW  T T+ GT+S ++I  +L+++E+SLSF+NA++NA
Sbjct: 3   TLLRYYTFSLAFTAVCFGLAAWYGWASTGTIWGTLSLLWIVFVLSILEVSLSFDNAVVNA 62

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M  +WQ+RFLT GILIAVFGMRI+FPI IV I + + P+EA+ L++  PQ+Y +I
Sbjct: 63  TVLREMDPVWQQRFLTIGILIAVFGMRIVFPIAIVAIAADLGPVEAITLSLNEPQEYERI 122

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +S+AH+ I+GFGG FL MV LTFFF+S+  +HWI  +E A++ +S +  ++I +VL++++
Sbjct: 123 VSEAHLGIAGFGGAFLAMVGLTFFFDSEKNVHWIGKIERAINRVSTVPAVEIGLVLALVY 182

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLE 245
           G+S +L  +E  +F++++   ++ + G+N + S++    +     G   + GL  FLYLE
Sbjct: 183 GVSTLLTADEAMTFLTAAILGLLTYIGVNAVGSLIEQRETRKKAAGEIVRSGLGGFLYLE 242

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           ++DAS S DGVI +FA++ N  +I +GL++GA++VRSMT+ +++QG L +Y+YLEHG+++
Sbjct: 243 VLDASFSFDGVIGAFALSNNMIVIALGLSVGAMFVRSMTIHLVRQGTLAQYRYLEHGAFW 302

Query: 306 SIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           +I VL VIM L     IPE  TG    ILI LS+  SI+
Sbjct: 303 AIIVLGVIMLLSAKFHIPETITGLIGAILIGLSLLWSIR 341


>gi|87200060|ref|YP_497317.1| hypothetical protein Saro_2044 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135741|gb|ABD26483.1| protein of unknown function DUF475 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 355

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 151/340 (44%), Positives = 230/340 (67%), Gaps = 3/340 (0%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  ++ +IL T+      +  GW  T T SGT+S V+I  +L+++EISLSF+NA++NA 
Sbjct: 1   MLRFYKGSILFTLVCLALAVAYGWMQTGTASGTMSLVWIVFVLSILEISLSFDNAVVNAA 60

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M  +WQKRFLTWG++IAVFGMRI+FP+ IV I + + PIEA+NL++  P+ Y +I+
Sbjct: 61  VLEDMDEVWQKRFLTWGMVIAVFGMRIVFPLAIVAIAAGLGPIEALNLSLKDPKRYEEIV 120

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           S AHV I+GFGG FL MV L+FFF+ + ++HWI ++E  ++ +S IK  +I ++L  I+G
Sbjct: 121 SSAHVGIAGFGGAFLAMVGLSFFFDGEKEVHWIKWVEEKLAVVSNIKAAEIALLLLSIYG 180

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
           IS ILP  E  +FV +    ++ F  +  L ++L          G   + GL  FLYL +
Sbjct: 181 ISLILPPEEALTFVVAGVLGLVTFIAVEALGTILEMREEAQKAAGVVVRSGLGGFLYLNV 240

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FA++ N  II +GL+IGA++VRSMT++++++G L++Y+YLEHG++++
Sbjct: 241 LDASFSFDGVIGAFALSNNMVIIALGLSIGAMFVRSMTIMLVQKGTLSEYRYLEHGAFWA 300

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I  L  IM L     IPE  TG     LI LS++ SI++K
Sbjct: 301 IIALGAIMLLSARYHIPETVTGLIGAALIGLSLWWSIRHK 340


>gi|260576197|ref|ZP_05844190.1| protein of unknown function DUF475 [Rhodobacter sp. SW2]
 gi|259021677|gb|EEW24980.1| protein of unknown function DUF475 [Rhodobacter sp. SW2]
          Length = 346

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 153/336 (45%), Positives = 234/336 (69%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +FRWA + T  G +    +GW F+ TL+G +S + I  +LAV+EISLSF+NAI+NA  
Sbjct: 1   MQYFRWAFVFTAIGLVGAFWLGWLFSGTLAGGLSFLLIGSVLAVLEISLSFDNAIVNANK 60

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++M+ +WQ RFLTWGI+IAVFGMRIIFP++IV + + I P +A+ LA  +P +Y  II 
Sbjct: 61  LKEMTPVWQHRFLTWGIIIAVFGMRIIFPLLIVVVAAHIGPWQALKLAALNPAEYASIIG 120

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +AH+ I+ FGG FLMMV L +FF+    +HWI  LE  MS  S ++GI++ IVL+++   
Sbjct: 121 EAHLSIAAFGGAFLMMVGLKYFFDEGKDVHWIATLERTMSKFSSVQGIELAIVLAVVMVF 180

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           ++++P  E+ +F+ ++ A ++ F  +  L  +L +      +  + GL  FLYLE++DAS
Sbjct: 181 ASVMPEAEVATFLYAAVAGLLTFLLVEVLGHLLDASQQVIGSAARGGLGAFLYLEVLDAS 240

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++  L +++YLEHG+++SI +L
Sbjct: 241 FSFDGVIGAFALTQNLFLIAIGLGIGAMYVRSMTIMLVERNTLAEFRYLEHGAFWSILIL 300

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           S IMF QT+  IPE+ TG      I L++ SSI+ +
Sbjct: 301 SGIMFCQTLWHIPEVVTGLLGAGFIGLALLSSIRYR 336


>gi|119384926|ref|YP_915982.1| hypothetical protein Pden_2194 [Paracoccus denitrificans PD1222]
 gi|119374693|gb|ABL70286.1| protein of unknown function DUF475 [Paracoccus denitrificans
           PD1222]
          Length = 348

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 149/340 (43%), Positives = 228/340 (67%), Gaps = 2/340 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +  W  +VT AG      +GW++  T SG ++   I  ILAV+EISLSF+NAI+NA
Sbjct: 3   STLSYMTWPFIVTGAGLALAAFLGWEYHGTGSGALAFFLIAGILAVLEISLSFDNAIVNA 62

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M+  WQ+RFLTWGILIAVFGMR+IFP+++V I + + P EA+ LA   PQ+Y +I
Sbjct: 63  NKLKQMTPKWQRRFLTWGILIAVFGMRVIFPLLVVVIAAHLAPWEAIRLAATQPQEYSRI 122

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           I +AH+PI+ FGG+FLM+V+L +FF+    + WI  +E A+  L +I+G+++  VL  + 
Sbjct: 123 IHEAHLPIAAFGGSFLMLVALNYFFDEAKDVDWIKGVEAALRKLGEIRGMEVGFVLVCML 182

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVT--HGKHGLNLFLYLEI 246
            I   LP  + ++F+ ++   +I +  ++ L  VL             + G   FLYLE+
Sbjct: 183 VIVGQLPAEKEHAFIIAAIWGVITYLLVDMLGHVLDRWGGAPQPADMARGGFGAFLYLEV 242

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++G L  ++YLEHG+++S
Sbjct: 243 LDASFSFDGVIGAFALTQNLFLIAIGLGIGAMYVRSMTVMLVERGTLAAFRYLEHGAFWS 302

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           IFVLS++MF+QT+  IPE+ TG      I ++  SS+  +
Sbjct: 303 IFVLSILMFVQTLRPIPEVVTGLLGACFIGMAFLSSLAWR 342


>gi|332187491|ref|ZP_08389228.1| integral membrane TerC family protein [Sphingomonas sp. S17]
 gi|332012420|gb|EGI54488.1| integral membrane TerC family protein [Sphingomonas sp. S17]
          Length = 370

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 143/344 (41%), Positives = 223/344 (64%), Gaps = 8/344 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +  +F+ + +        G  IGW  TH ++GT+  ++I ++L V+E+SLSF+NA++NA 
Sbjct: 1   MFKYFKGSFVFAAICLAIGAWIGWTLTHDIAGTLGILWIVLVLGVLEVSLSFDNAVVNAT 60

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M+ +WQ+RFLTWGI+IAVFGMRI+FP++IV I + + PI+A+ LA   P  Y +II
Sbjct: 61  VLRDMTPVWQRRFLTWGIIIAVFGMRILFPLVIVAIAARLGPIDAVVLAATDPVAYERII 120

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AHV ISGFGG FL MV LTFF + +   HWI  +E   + LS+I G+ I IVL  ++ 
Sbjct: 121 TGAHVGISGFGGAFLAMVGLTFFLDEEKDSHWIGLIERPFAGLSRISGLAIGIVLLALYS 180

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN--------VTHGKHGLNLF 241
           IS  +P  E  +F+++    ++ +  +  + ++L  D            V   K GL  F
Sbjct: 181 ISRAIPAEEAMTFLTAGIFGLLAYIAVQAVGAILEKDDEEPTSGNAAATVAVAKSGLAAF 240

Query: 242 LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEH 301
           LYLE++DAS S DGVI +FA++ N FII +GL IGA++VRSMT++++ +G L +Y+YLEH
Sbjct: 241 LYLEVLDASFSFDGVIGAFALSNNLFIIALGLGIGAMFVRSMTVMLVDKGTLTEYRYLEH 300

Query: 302 GSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           G++Y+I  L+ IM +   V++PE  TG      I +++++S++ 
Sbjct: 301 GAFYAIIALAAIMLISIRVEVPETVTGLIGAAFIGMALFASVRA 344


>gi|50086415|ref|YP_047925.1| hypothetical protein ACIAD3451 [Acinetobacter sp. ADP1]
 gi|49532391|emb|CAG70103.1| putative integral membrane protein [Acinetobacter sp. ADP1]
          Length = 360

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 125/352 (35%), Positives = 199/352 (56%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  TV         G+              + I  ILAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTVICLALSAYWGYTHGPEAGLSTMFKALTITAILAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR+IFP+ IV + + +  IE   +A+  P++Y + 
Sbjct: 61  SVLRGWDHFWKMLFLTVGILIAVFGMRLIFPVAIVAVTADMGMIEVAKMALNDPKNYSER 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           + Q H  I+ FGGTFL+MV L FFF+     HW  ++E  +++L+ I  + +F+ L  + 
Sbjct: 121 LMQHHAEIAAFGGTFLLMVFLNFFFDDGKDTHWFKWIEAKLANLANIPAMSVFVALVAML 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +  ++      +    ++++ G+  L  +L  +              S  +    
Sbjct: 181 IMAAYVSDDKRLVVTMAGIWGLVVYIGVQVLSHLLGGEPEIDENGNAIGHDGSGASTGVI 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K G   FLYLE++DAS S DGVI +FAIT +  II++GL IGA++VRSMT+ ++++G L+
Sbjct: 241 KAGFGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAMFVRSMTVYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y YLEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 301 AYIYLEHGAHYAIGALAFIMLASGTGVHVPEVVTGLIGVAFIVWAVLASIQY 352


>gi|254780228|ref|YP_003064641.1| hypothetical protein CLIBASIA_00565 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039905|gb|ACT56701.1| hypothetical protein CLIBASIA_00565 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 346

 Score =  231 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 346/346 (100%), Positives = 346/346 (100%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS
Sbjct: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY
Sbjct: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
           SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI
Sbjct: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
           FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL
Sbjct: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE
Sbjct: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK
Sbjct: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346


>gi|296283953|ref|ZP_06861951.1| hypothetical protein CbatJ_10031 [Citromicrobium bathyomarinum
           JL354]
          Length = 352

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 135/339 (39%), Positives = 220/339 (64%), Gaps = 2/339 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           +L+ H+  ++L T+  F+      W    ++      ++I ++L+++EISLSF+NA++NA
Sbjct: 3   TLLRHYWGSLLFTLVCFIAAGFYAWNAGGSVGSVAHVLWIVLVLSILEISLSFDNAVVNA 62

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++M   WQ+RFLTWGILIAVFGMRI+FP+ IV + + ++P+ A++L++  P+ Y  I
Sbjct: 63  TVLREMDEKWQRRFLTWGILIAVFGMRIVFPLAIVAVAANLDPLSAIDLSLNDPERYEAI 122

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +S AHV I+GFGG FL MV L FFF+    + WI  LE+A+   S+I+  +I I+L +++
Sbjct: 123 VSSAHVGIAGFGGAFLTMVGLNFFFDGDKDVDWIRGLELALRRFSEIRAAEIGILLLMLY 182

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVT--HGKHGLNLFLYLEI 246
           GIS +LP  E   F+++    ++ +  ++ + +VL       +     + GL  FLYLE+
Sbjct: 183 GISTMLPEGEAMVFLTAGILGLVTYIAVDAIGTVLDKVERRKMAEGAVRSGLGGFLYLEV 242

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FA++ N  II +GL+IGA++VRSMT+ +++ G L KY++LEHG++++
Sbjct: 243 LDASFSFDGVIGAFALSNNMLIIALGLSIGALFVRSMTVHLVRAGTLTKYRFLEHGAFWA 302

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           I  L +IM L     I E  TG    +LI +S+  S++ 
Sbjct: 303 IIALGLIMLLSAKFHISESITGLIGAVLIGISLLWSMRY 341


>gi|182677243|ref|YP_001831389.1| hypothetical protein Bind_0244 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633126|gb|ACB93900.1| protein of unknown function DUF475 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 348

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 146/335 (43%), Positives = 220/335 (65%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +FR ++L T+        +GW  T T+SG +ST++I ++L V+EISLSF+NAI+NA  
Sbjct: 1   MRYFRGSLLFTILCLFLAGWLGWSLTGTISGVLSTLWIALVLGVLEISLSFDNAIVNATV 60

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ +  +W++RFL WGILIAV GMRI+FP+MIV I + I P++A+ LAI  P+ Y +II+
Sbjct: 61  LRGLDPVWRRRFLIWGILIAVVGMRILFPLMIVAIAAHIGPLDALFLAILEPRHYEQIIT 120

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H+ ISGFGG FL MVSL FFF+S  ++HWI   E  ++ L  +  I   IVL  ++ +
Sbjct: 121 DVHITISGFGGAFLAMVSLKFFFDSSKRVHWIGLFEKRLARLGDLDAITHTIVLLALYAV 180

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           S +L   +    + +    ++ F G+  + +VL           + GL+ FLYLE++DAS
Sbjct: 181 SRLLAPEDAAELIVAGIFGLVTFVGVEVIGNVLGGPGGRTGEVARVGLSGFLYLEVLDAS 240

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGV+ +FA+T N F+I +GL IGA++VRSMT++++ +G L++Y+YLEHG++Y+I  L
Sbjct: 241 FSFDGVVGAFALTNNLFVIALGLGIGAMFVRSMTVMLVDRGTLSEYRYLEHGAFYAILAL 300

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +M L    DIPE+ TG  S  LI LS+  SI  
Sbjct: 301 AGVMLLSARYDIPEVVTGLISACLIGLSLLGSILY 335


>gi|329849078|ref|ZP_08264106.1| integral membrane protein TerC family protein [Asticcacaulis
           biprosthecum C19]
 gi|328844141|gb|EGF93710.1| integral membrane protein TerC family protein [Asticcacaulis
           biprosthecum C19]
          Length = 378

 Score =  229 bits (584), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 128/339 (37%), Positives = 210/339 (61%), Gaps = 2/339 (0%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV-YICIILAVVEISLSFENAILNA 68
           ++ +F  +I  TV   +    +G+  +  ++  +  + ++  +L V+E SLS +NA++NA
Sbjct: 1   MLKNFYGSIAFTVVSLILAGVLGYYQSGGMASAVLQMVFLACVLGVMETSLSLDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ M  +WQ+RFLTWGILIAVFGMRIIFPI+IV I + + P EA  +AI   + Y  I
Sbjct: 61  SILKDMDPVWQRRFLTWGILIAVFGMRIIFPILIVSISAMVTPWEATRIAIMDHERYETI 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH+ ISGFGG FLM+V L FFF+   + HW+ F+E  ++ L+KI      +   +I 
Sbjct: 121 VTGAHIGISGFGGAFLMLVGLNFFFDDDREHHWLGFIERPLAALAKIPFSPYIVTALLIG 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN-NVTHGKHGLNLFLYLEII 247
           G+S ++   E  +F+ +  + ++ F+ +      +     +      + G   F+YLE +
Sbjct: 181 GLSFMVHGEEQKTFLIAGLSGVVTFFAVQKFGDWVGGGEKDHTGAVVRTGAGGFIYLEFL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT +  +I +GL IGA++VRSMT+ +++ G L ++++LE G++Y+I
Sbjct: 241 DASFSFDGVIGAFAITNDIILIALGLGIGAMFVRSMTIALVRGGHLAEFRFLEAGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L+ IM L   + IPE+ TG    I+I +S++ SI++K
Sbjct: 301 IALASIMLLSIKLHIPEVVTGLIGAIIIGVSLWVSIEHK 339


>gi|226953622|ref|ZP_03824086.1| integral membrane protein [Acinetobacter sp. ATCC 27244]
 gi|294651866|ref|ZP_06729157.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|226835625|gb|EEH68008.1| integral membrane protein [Acinetobacter sp. ATCC 27244]
 gi|292822255|gb|EFF81167.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 360

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 122/352 (34%), Positives = 203/352 (57%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  T+         G+           +  + I +ILA++E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTIVCLALSAYWGYTHGPEAGISTMLKALTITVILAIMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GIL+AVFGMR+IFPI+IV + + +  +E + LA+  P+ Y + 
Sbjct: 61  SVLRNWDHFWKMLFLTVGILVAVFGMRLIFPILIVAVTADMGMMEVVKLALNDPKSYSER 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           + + H  I+ FGGTFL+MV L FFF+ + + HW  ++E  ++HL+ +  + +FI L  + 
Sbjct: 121 LMEHHPEIAAFGGTFLLMVFLNFFFDDEKETHWFRWIESKLAHLASVPAMSVFIALVAML 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +   +      +    I+++ G+  L  +L  +                 +    
Sbjct: 181 IMAAHVDEAKRLVVTMAGIWGIVVYIGVKVLSHLLGGEPEVDDNGNAVTQGADGASKGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K G+  FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ ++++G L+
Sbjct: 241 KAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y +LEHG++Y+I  L+ IM    T + +PE+ TG      I  ++ +SI+ 
Sbjct: 301 AYIFLEHGAHYAIGALAFIMIASGTGLHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|262377227|ref|ZP_06070452.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262307965|gb|EEY89103.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 361

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 122/353 (34%), Positives = 200/353 (56%), Gaps = 17/353 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HF ++I  ++         G+           ++ + I  ILA++E+SLSF+NA++NA
Sbjct: 1   MKHFGFSIAFSIVCLGLSAYWGYTHGPDAGLQTMLTALTITAILAIMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR+IFP++IV + + +  +E + LA+  P++Y   
Sbjct: 61  SVLRGWDHFWKMLFLTVGILIAVFGMRLIFPVVIVAVTADLGFMEVVRLALNDPKEYSAR 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +   H  I+ FGG FL+MV L FF + +   HW   +E  +S+L+ +  + +FI L  + 
Sbjct: 121 LMAHHPEIAAFGGAFLLMVFLNFFLDEEKDTHWFRRVERRLSNLANVPAMSVFIALVALL 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS--------------SDSSNNVTHG 234
            ++  +   +  +   +    I+I+ G+  L  +L                ++       
Sbjct: 181 IMAANVDEAKRLAVTMAGIWGIVIYIGVQVLSHMLGGEPEVDEEGNAIRHDENGVPTGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K G+  FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ +++QG L+
Sbjct: 241 KAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEQGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            Y YLEHG++Y+I  L+ IM    T + +PE+ TG      I  ++++SI+ K
Sbjct: 301 AYIYLEHGAHYAIGALAFIMIASGTGLHVPEVVTGLIGVAFIVWAVFASIQYK 353


>gi|255320296|ref|ZP_05361481.1| integral membrane protein [Acinetobacter radioresistens SK82]
 gi|262380493|ref|ZP_06073647.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|255302735|gb|EET81967.1| integral membrane protein [Acinetobacter radioresistens SK82]
 gi|262297939|gb|EEY85854.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 360

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 125/353 (35%), Positives = 195/353 (55%), Gaps = 17/353 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGT--ISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  TV         G+              + I  ILAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTVVCLALSAYWGYTHGPQAGIETMFKALTITAILAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR+IFP++IV + + +  +E + LA+  P  Y + 
Sbjct: 61  SVLRNWDHFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGLMEVVRLALNDPTAYSQR 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +   H  I+ FGG FL++V L FF +     HW  +LE  ++ L+ +  + +FI L  + 
Sbjct: 121 LMDHHAEIAAFGGAFLLLVFLNFFLDEGKDTHWFRWLERRLTSLASVPAMSVFIALIALL 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +   +      +    I+I+ G+  L  +L  +              +       
Sbjct: 181 VVAANVDETKRLVVTMAGIWGIVIYIGVQVLSHLLGGEPEIDEEGNAVTHDSTGAATGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K G   FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ ++++G L+
Sbjct: 241 KAGFGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            Y YLEHG++Y+I  L++IM    T V IPE+ TG      I  ++ +SI+ +
Sbjct: 301 AYIYLEHGAHYAIGALAIIMLASGTGVHIPEVVTGLIGVAFIVWAVLASIQYR 353


>gi|42523881|ref|NP_969261.1| hypothetical protein Bd2441 [Bdellovibrio bacteriovorus HD100]
 gi|39576088|emb|CAE80254.1| conserved hypothetical membrane protein [Bdellovibrio bacteriovorus
           HD100]
          Length = 355

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 134/335 (40%), Positives = 218/335 (65%), Gaps = 1/335 (0%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + + T  G +    +G  +  T+   +  ++I  ILA++EISLSF+NAI+NA  
Sbjct: 13  MKYFTGSFVFTFFGLIASYFVGHYYGGTVGAGLQALFIATILAILEISLSFDNAIVNAVV 72

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++M+ +W+ RFLTWG+LIAVFGMR++FP++IV  ++ +NP EA+ +A   P DY K++ 
Sbjct: 73  LKEMTPVWRHRFLTWGMLIAVFGMRLVFPLLIVTFMADVNPWEALVIAATKPDDYAKMML 132

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLS-KIKGIKIFIVLSIIFG 189
            AH+ ++ FGG+FL+MV+L +F++    LHWI F+E    ++  K++ I++ + L I+  
Sbjct: 133 DAHLQVAAFGGSFLLMVALKYFYDGSKDLHWIPFIEKPTRYIGSKVEAIEVCLSLIILIL 192

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
           I+N L   E   F+ +  A +I +  ++ + S L +         K    +FLYLE++DA
Sbjct: 193 ITNFLKQEEALPFLMAGMAGLITYVIVDGIGSWLEASDDQIKDVHKASAGMFLYLEVLDA 252

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGV+ +FAIT N FII+IGL+IGA +VRS+T++ +++  L K+ +LEHG++Y+I +
Sbjct: 253 SFSFDGVVGAFAITHNLFIIMIGLSIGAFFVRSLTIMFVEKEALTKFAFLEHGAFYAIGL 312

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           L++IM     + IPE FTG S  I+I  S   S+K
Sbjct: 313 LAMIMLADPFLHIPEWFTGLSGGIIILTSFIWSLK 347


>gi|148558899|ref|YP_001259351.1| hypothetical protein BOV_1419 [Brucella ovis ATCC 25840]
 gi|148370156|gb|ABQ60135.1| putative membrane protein [Brucella ovis ATCC 25840]
          Length = 319

 Score =  226 bits (575), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 136/304 (44%), Positives = 208/304 (68%)

Query: 42  TISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIM 101
            +S   IC +L+V+EISLSF+NAI+NA+ L+ MS  WQ RFLTWGI+IAVFGMRI+FP+ 
Sbjct: 1   MVSVFIICAVLSVLEISLSFDNAIVNARILRDMSPKWQHRFLTWGIVIAVFGMRIVFPLA 60

Query: 102 IVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHW 161
           IV I    +PI A+ LAI+ P +Y ++I+++H  I+ FGGTFL+MV + +FF+ +  +HW
Sbjct: 61  IVAIAMWTDPISALKLAIWQPNEYARVIAESHTGIAAFGGTFLLMVGMKYFFDVEKDVHW 120

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
           I  +E  M   + ++G++I + +++I   S  L  +  ++FV +    ++ F  +  L  
Sbjct: 121 IRMIESRMPKFASVQGVEIGVAIALIIFFSYQLDADHSHTFVIAGLFGLLTFLAVEGLGE 180

Query: 222 VLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
           VL +         + GL  F+YLE++DAS S DGVI +FA+T N F+I IGL IGA YVR
Sbjct: 181 VLDATQEQMDMVHRGGLGAFIYLEVLDASFSFDGVIGAFALTTNLFVIAIGLGIGAFYVR 240

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYS 341
           S+T++++++  L +Y+YLEHG++Y+I VL++IM++QT+V IPE+ TG     LI LS  S
Sbjct: 241 SLTIMLVERKTLGQYRYLEHGAFYAILVLAIIMYVQTLVHIPEVITGLIGAALIGLSFMS 300

Query: 342 SIKN 345
           S++ 
Sbjct: 301 SLRY 304


>gi|300114608|ref|YP_003761183.1| hypothetical protein Nwat_2028 [Nitrosococcus watsonii C-113]
 gi|299540545|gb|ADJ28862.1| protein of unknown function DUF475 [Nitrosococcus watsonii C-113]
          Length = 340

 Score =  226 bits (575), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 136/339 (40%), Positives = 210/339 (61%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HFR++ LVTV G +              G  + ++I  IL V+EISLSF+NA++NA  
Sbjct: 1   MRHFRYSFLVTVVGLIAAFLW---------GGPAGLFIAAILGVLEISLSFDNAVVNASV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M   WQ RFLTWGILIAVFGMR++FP+ IV IV+ I  +E   +A+  P  Y   + 
Sbjct: 52  LKDMDPKWQARFLTWGILIAVFGMRLVFPVAIVAIVADIGMLEVTQMALNDPDTYSAHLH 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            +HV IS FGG FL+MV L+F  +   +LHW+   E  +S + K++ I+I I L +++ +
Sbjct: 112 ASHVDISAFGGMFLLMVFLSFLLDETKELHWLGRAEEKLSRIGKLESIEIVIALGVLWAL 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGIN---FLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
            + LP  E    + +  + +++F  +     L  V  +  +      + G+  FLYLE++
Sbjct: 172 QSFLPPEEKLGAMLAGISGVMLFVIVGSASGLFEVEETGEAVAHAAKRSGVMGFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAI+K+  II++GL IGA++VRS+T+ ++++G L++Y +LEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAISKDVIIIMLGLAIGAMFVRSITVYLVRKGTLSEYVFLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L++IM   T V IPE+ TG      I LS+ SSI+ +
Sbjct: 292 GALALIMLASTKVHIPEVITGMIGAAFIGLSLLSSIRYR 330


>gi|58424690|gb|AAW73727.1| integral membrane protein [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 381

 Score =  225 bits (574), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 124/347 (35%), Positives = 208/347 (59%), Gaps = 6/347 (1%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           S  L   +   FR ++LV           G     T  G    +++C++L+V+E+SLSF+
Sbjct: 28  SARLGVPMFREFRMSLLVAAVCLGVAAWWGH---TTALGLWQALWLCLVLSVLEVSLSFD 84

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NA++NA  L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +     M +A+  P
Sbjct: 85  NAVVNAGVLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLAPVMQMALKEP 144

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
           + Y ++++  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + +
Sbjct: 145 ERYSQVLTDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIV 204

Query: 183 VLSIIFGISNILPTNEMYSFVSS---STAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
            +S++ G    LP     S + +        ++   ++ L     S+        + G+ 
Sbjct: 205 AVSVLLGTKLFLPEGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIA 264

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
            FLYLE++DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +L
Sbjct: 265 AFLYLEVLDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFL 324

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           EHG++Y+I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 325 EHGAHYAIGVLAIIMLVGTVHHVPEVLTGLIGVAFIAASVWSSIRYR 371


>gi|262370905|ref|ZP_06064229.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262314267|gb|EEY95310.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 359

 Score =  225 bits (574), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 118/354 (33%), Positives = 199/354 (56%), Gaps = 17/354 (4%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILN 67
           ++ HF ++I+ T+         G+            + + I  ILAV+E+SLSF+NA++N
Sbjct: 1   MMKHFGFSIIFTIVCLALSAYWGFTHGPEAGLKTMFTALTITAILAVMEVSLSFDNAVVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+     W+  FLT GIL+AVFGMR+IFP+ IV + + +  +E + LA+  P+ Y +
Sbjct: 61  ASVLRGWDHFWKTLFLTVGILVAVFGMRLIFPVAIVAVTADMGFVEVVQLALNDPKTYSQ 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
            +   H  I+ FGG FL++V L FF + +   HW  +LE  +++L+ +  + +F+ L  +
Sbjct: 121 RLMDHHPEIAAFGGAFLLLVFLNFFLDEEKDTHWFRWLERRLANLANVPAMSVFLALIAL 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTH 233
             ++  +   +      +    I+++ G+  L  +L  +              +      
Sbjct: 181 LVMAANVDEAKRLVVTMAGIWGIVVYIGVQVLSHLLGGEPEVDEDGNAVTHDANGATTGV 240

Query: 234 GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
            K G+  FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ ++++G L
Sbjct: 241 VKAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEKGTL 300

Query: 294 NKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           + Y +LEHG++Y+I  L+ IM    T + +PE+ TG      I  ++ +SI+ K
Sbjct: 301 DAYVFLEHGAHYAIGALAFIMLASGTGLHVPEVVTGLIGVAFIVWAVIASIQYK 354


>gi|328882227|emb|CCA55466.1| Integral membrane protein [Streptomyces venezuelae ATCC 10712]
          Length = 381

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 125/367 (34%), Positives = 203/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  +T  G +  +           G      I  IL V+EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAITALGLVAAVLY---------GGWEAFGIVAILCVLEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            LQKM++ WQK FLT G+LIAVFGMR++FP++IV I + I PIEA++LA+     Y +++
Sbjct: 53  ILQKMNAFWQKIFLTIGVLIAVFGMRLVFPVVIVAISAKIGPIEAVDLALNDADRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ ++E  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIFE-DRDIQWLRWIERPLAKLGKVDMLSVCIALIVLLV 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 172 SAMTFATHAHQHGGTHVDKAQTVLISGIAGLITYLVVGGLSGYFENKLEEEEEREHEAEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    +     GK    +FLYLE++DAS S DGVI +FA+T +  ++ +GL +GA+
Sbjct: 232 AAKRSGKKVTAVQLAGKAAFFMFLYLEVLDASFSFDGVIGAFAVTNDIVLMALGLGVGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+V++ +    +IPE+ TG+   ILI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVLLLVTIQYEIPEVITGSIGVILIAWS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|262373717|ref|ZP_06066995.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262311470|gb|EEY92556.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 360

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 124/352 (35%), Positives = 201/352 (57%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  TV         G+           +  + I  ILAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTVVCLALSAYWGYTHGPEAGIATMLKALTITAILAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR++FP++IV + + +  +E + LA+  P+ Y   
Sbjct: 61  SVLRNWDHFWKMIFLTVGILIAVFGMRLVFPVVIVAVTADMGMMEVVKLALNDPKSYSAR 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           + + H  I+ FGGTFL+MV L FFF+ + + HW  ++E  +SHL+ +  + +FI L  + 
Sbjct: 121 LMEHHAEIAAFGGTFLLMVFLNFFFDDEKETHWFRWIESKLSHLASVPAMSVFIALVAML 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +  ++      +    I+++ G+  L  +L  +              +       
Sbjct: 181 IMAANVEESKRLVVTMAGIWGIVVYIGVQVLSHLLGGEPEIDEHGNAVMHDGNGAASGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K G   FLYLE++DAS S DGVI +FAIT +  II++GL IGAI+VRSMT+ ++++G L+
Sbjct: 241 KAGFGGFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAIFVRSMTIYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y +LEHG++Y+I  L+ IM    T + +PE+ TG      I  ++ +SI+ 
Sbjct: 301 AYIFLEHGAHYAIGALAFIMIASGTGLHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|292493000|ref|YP_003528439.1| hypothetical protein Nhal_2992 [Nitrosococcus halophilus Nc4]
 gi|291581595|gb|ADE16052.1| protein of unknown function DUF475 [Nitrosococcus halophilus Nc4]
          Length = 340

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 133/339 (39%), Positives = 211/339 (62%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF+++ LVT  G +              G  + ++I  IL+++E+SLSF+NA++NA  
Sbjct: 1   MRHFKYSFLVTAVGLIAAFLW---------GGPTGLFIAAILSILEVSLSFDNAVVNASV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M   WQ RFLTWGILIAVFGMR++FPI IV +V+ I  +E   +A+  P+ Y   + 
Sbjct: 52  LKDMDPKWQARFLTWGILIAVFGMRLVFPIAIVAVVADIEMLEVTQMALNDPETYSTHLL 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            +HV IS FGG FL+MV L+F  +   +LHW+  +E  ++ + K++ I+I I L++++G+
Sbjct: 112 ASHVEISAFGGMFLLMVFLSFLLDETKELHWLGIVEEKLAGIGKLESIEIVIALAVLWGL 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK---HGLNLFLYLEII 247
             +LP  E  S + S  + I++F  +     +   +             GL  FLYLE++
Sbjct: 172 QGVLPPEEKLSALLSGISGIMLFVLVGSASGLFEEEEKGEAVVHAARHSGLMGFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAITK+  II++GL +GA++VRS+T+ ++++G L++Y +LEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAITKDVIIIMLGLAVGAMFVRSITVYLVRKGTLDEYVFLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L+ IM   T V IPE+ TG      I LS+ SS++ +
Sbjct: 292 GALAFIMLASTKVHIPEVITGLIGAAFIGLSLVSSVRYR 330


>gi|240850907|ref|YP_002972307.1| hypothetical integral membrane protein [Bartonella grahamii as4aup]
 gi|240268030|gb|ACS51618.1| hypothetical integral membrane protein [Bartonella grahamii as4aup]
          Length = 350

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 150/339 (44%), Positives = 230/339 (67%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            SL+ +F +A   T+ G   G  IGW  T +++G +   +IC +L V+EISLSF+N+I+N
Sbjct: 1   MSLLRYFGFAFFFTIIGVFLGGVIGWFETESITGFLKYFFICFVLGVLEISLSFDNSIIN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L +M  +W++RFL WGILIAVFGMRI+FP+++V +   INPI A+ LAI+ P  Y +
Sbjct: 61  ARVLSRMDPLWRRRFLIWGILIAVFGMRIVFPLLVVVVAVGINPIAAVKLAIWEPHRYAE 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +++ AH+ I+ FGGTFLMMV L +FF+S+ ++HW++ +E        + GI I IVL +I
Sbjct: 121 VLTDAHMGIAAFGGTFLMMVGLKYFFDSEKEVHWLNVIERPAQKFGALVGIDIAIVLILI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
             +S  + T +  +F+ ++   ++ F G+  +  +L +      T    G+  FLYLE++
Sbjct: 181 LFVSAQIDTEDKITFLLAALYGLLTFIGVEVVGHLLDTPQKTLTTVTHGGVGAFLYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGV+ +FA + N FII IGL IGA YVRSMT+++++ G L  Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRSMTIMLVESGTLLHYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL+VIM+LQTI+ +PE+ TG     +I +++YSSI+ K
Sbjct: 301 LVLAVIMYLQTIISVPEVLTGLVGVCIIGMALYSSIRFK 339


>gi|86742357|ref|YP_482757.1| hypothetical protein Francci3_3676 [Frankia sp. CcI3]
 gi|86569219|gb|ABD13028.1| protein of unknown function DUF475 [Frankia sp. CcI3]
          Length = 390

 Score =  223 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 126/365 (34%), Positives = 194/365 (53%), Gaps = 38/365 (10%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F W++ +TV G      I         G      +  ILAV+EISLSF+NA++NA  
Sbjct: 4   LRIFGWSLAITVIGVAAAGVI---------GGPRNAALVAILAVLEISLSFDNAVINATI 54

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L +MS  WQ+ FLT GILIAVFGMR+IFPI IV + + + P+E  +LA+     Y + + 
Sbjct: 55  LGRMSQFWQRIFLTLGILIAVFGMRLIFPIAIVALTAHLGPLEVFDLALNDGARYAEKLG 114

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FL M+ L F F+ + ++ WI  LE  +    ++  + I + L  +  +
Sbjct: 115 DAHPAIAAFGGIFLFMLFLDFLFDPEREIQWIKKLEEPLRRAGQLDVVPIVLGLIALLVV 174

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-------------------- 230
                 +     + S  A +  + G+  L     +                         
Sbjct: 175 GQAFAGDHQQQVLLSGVAGLATYLGVRGLGEFFEARGVGAEDDDDDSVAESAGLAPVRSN 234

Query: 231 ---------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
                    +  GK    LFLYLE+IDAS S DGV+ +FAI++N F+I  GL IGA+Y+R
Sbjct: 235 GTGGPPKLVLATGKAAAFLFLYLEVIDASFSFDGVVGAFAISQNIFVIAAGLGIGAMYIR 294

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYS 341
           S+T+ ++++G L +Y YLEHG++Y+I  L++I+ +    ++PEI TG      I LS+ S
Sbjct: 295 SLTVYLVRRGTLGEYIYLEHGAHYAIGALAIILAISIETEVPEIVTGLIGVAFIGLSLLS 354

Query: 342 SIKNK 346
           SI+++
Sbjct: 355 SIRHR 359


>gi|294677262|ref|YP_003577877.1| hypothetical protein RCAP_rcc01725 [Rhodobacter capsulatus SB 1003]
 gi|294476082|gb|ADE85470.1| protein of unknown function DUF475, transmembrane [Rhodobacter
           capsulatus SB 1003]
          Length = 344

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 150/338 (44%), Positives = 227/338 (67%), Gaps = 1/338 (0%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +F WA   T  G    + +G+ + HT  G +S  ++  +LAV+EISLSF+NAI+NA
Sbjct: 3   STLQYFSWAFGFTAVGLALAMWLGFTYEHTTHGALSFFFVACVLAVLEISLSFDNAIINA 62

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L +M+  WQ+RFLTWGILIAVFGMRI+FP++IV I + I PIEA+ +A   P +Y +I
Sbjct: 63  NKLGQMTPEWQRRFLTWGILIAVFGMRILFPLLIVVIAAGIGPIEALRIAATQPAEYSRI 122

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           I +AH+ I+ FGG FLMMV+L++F +   ++HW   LE  +S  + I+GI++  +L+I+ 
Sbjct: 123 IGEAHLSIAAFGGAFLMMVALSYFVDESKEVHWFVALEKRLSSWASIRGIEVGFLLAIVL 182

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
             +  LP     +F+ ++   ++ F  +  L  VL   S +     K GL  FLYLE++D
Sbjct: 183 AFAWWLPVKTEGTFLVAACTGLLTFLAVEGLGQVLDKASLSG-DVAKGGLGAFLYLEVLD 241

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T+N F+I IGL IGA YVRSMT++++++  L++++YLEHG+++SI 
Sbjct: 242 ASFSFDGVIGAFALTQNLFLIAIGLGIGAFYVRSMTVMLVERQALSEFRYLEHGAFWSIL 301

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           VLSV MF QT++ +PE  TG    + I LS+ SS++ +
Sbjct: 302 VLSVAMFAQTLMHVPEWATGLLGVVFIGLSLMSSLRWR 339


>gi|310817114|ref|YP_003965078.1| hypothetical protein EIO_2703 [Ketogulonicigenium vulgare Y25]
 gi|308755849|gb|ADO43778.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 348

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 147/337 (43%), Positives = 226/337 (67%), Gaps = 2/337 (0%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFT-HTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           + +F+W  +VT  G +    +GW      +S  +S +++ I+LA++EISLSF+NAI+NA 
Sbjct: 5   LKYFKWPFIVTATGLILSFWLGWNSGPGGMSPALSFLFVGIVLAILEISLSFDNAIVNAN 64

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M+ +WQ+RFLTWGILIAVFGMR++FP++IV + + I PIEA+ LA      Y  II
Sbjct: 65  KLKDMTPVWQRRFLTWGILIAVFGMRVVFPVLIVVVAARIGPIEAIWLAATDEAQYAAII 124

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           ++AH  I+ FG TFLMMV L FF NS+  +HWI   E  ++H S ++G ++ +VL I+  
Sbjct: 125 NEAHPSIAAFGSTFLMMVGLKFFMNSEKDVHWIGGFERWLNHFSSVRGFEVALVLVIVMI 184

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            SN +P  E  +F++S+   ++ F  +  +  +L    +   T  K G   FLYLE++DA
Sbjct: 185 FSNFVPEGEELTFLTSAIYGLLTFLIVEVIGHLLDEQQAALSTAAKGGFGAFLYLEVLDA 244

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA+T+N F+I IGL IGA+YVRSMT++++++  L +++YLEHG++YSI +
Sbjct: 245 SFSFDGVIGAFALTQNLFLIAIGLGIGAMYVRSMTIMLVERQTLAQFRYLEHGAFYSILI 304

Query: 310 LSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSIKN 345
           LSVIM +QT+   +PE+ TG      I  ++++SI+ 
Sbjct: 305 LSVIMLIQTLHIHVPEVITGLLGAGFIATALWASIRY 341


>gi|152967254|ref|YP_001363038.1| hypothetical protein Krad_3310 [Kineococcus radiotolerans SRS30216]
 gi|151361771|gb|ABS04774.1| protein of unknown function DUF475 [Kineococcus radiotolerans
           SRS30216]
          Length = 380

 Score =  223 bits (567), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 124/364 (34%), Positives = 207/364 (56%), Gaps = 32/364 (8%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  +RW+ +VT  G +     G      +      + + +IL+++EISLSF+NA++NA 
Sbjct: 2   ILKTYRWSFVVTALGLVLAAWYGLSAHLGIG---QAIALVLILSILEISLSFDNAVVNAT 58

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY-----SPQD 124
            L++MS  W+K FL+ GI+IAVFGMR++FPI++V + + + PIE + LA+      +P  
Sbjct: 59  ILERMSDFWRKIFLSVGIIIAVFGMRLVFPIVLVSVTAGLGPIEVIRLALEGGDPETPGT 118

Query: 125 YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL 184
           Y   + +AH  I+ FGG FL+M+ L F F  + + HW+  +E A+  + K+  +++ +  
Sbjct: 119 YGYELHEAHPTIASFGGMFLLMLFLNFIF-GEKEHHWLGPIERALEKVGKLDYVQVIVAG 177

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS-------------------- 224
           +++  ++    T    + ++S  A I+ +  +N L  + +                    
Sbjct: 178 AVLLVVAETFATEHGRTVLASGLAGIVTYLLVNGLGELFNVEDHVEHEDPATTSAGTTAS 237

Query: 225 ---SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR 281
                S      GK    LFLYLE++DAS S DGVI +FAIT +  II IGL +GA+Y+R
Sbjct: 238 GVNGPSGAARATGKAAFFLFLYLEVLDASFSFDGVIGAFAITSDPVIIAIGLGVGAMYIR 297

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYS 341
           SMT+ ++++G L +Y YLE+G+ ++I  L+VI+ L   V+IPE+ TG      I  S+ S
Sbjct: 298 SMTVHLVEEGTLAQYPYLENGALWAIGALAVILLLSIEVEIPEVVTGLIGLAFIVASLIS 357

Query: 342 SIKN 345
           SI+ 
Sbjct: 358 SIRY 361


>gi|163868728|ref|YP_001609940.1| hypothetical protein Btr_1608 [Bartonella tribocorum CIP 105476]
 gi|161018387|emb|CAK01945.1| conserved hypothetical membrane protein [Bartonella tribocorum CIP
           105476]
          Length = 349

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 150/339 (44%), Positives = 230/339 (67%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +L+ +F +A   T+ G   G  IGW  T +++G +   +IC +L V+EISLSF+N+I+N
Sbjct: 1   MALLRYFGFAFFFTIIGVFLGGAIGWFETGSITGFLKYFFICCVLGVLEISLSFDNSIIN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L +M  +W++RFL WGILIAVFGMRI+FP+++V +   INPI A+ LAI  P  Y +
Sbjct: 61  ARVLGRMDPLWRRRFLIWGILIAVFGMRIVFPLLVVVVAVGINPIAAVKLAIGEPHRYAE 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           +++ AH+ I+ FGGTFLMMV L +FF+S+ ++HW+  +E +   L  + GI I IVL +I
Sbjct: 121 VLTDAHMGIAAFGGTFLMMVGLKYFFDSEKEVHWLSVIERSAQKLGALVGIDIAIVLILI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
             +S  +   +  +F+ ++   ++ F G+  +  +L +      T  + GL  FLYLE++
Sbjct: 181 LFVSGQIVAEDRVTFLLAALYGLLTFIGVEAVGHLLDAPKKTLTTVAQGGLGAFLYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGV+ +FA + N FII IGL IGA YVRSMT+++++ G L  Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRSMTIMLVESGTLLHYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL+VIM+LQTI+ +PE+ TG     +I +++YSSI+ K
Sbjct: 301 LVLAVIMYLQTIIPVPEVLTGLVGICIIGIALYSSIRFK 339


>gi|29832348|ref|NP_826982.1| hypothetical protein SAV_5805 [Streptomyces avermitilis MA-4680]
 gi|29609467|dbj|BAC73517.1| putative integral membrane protein [Streptomyces avermitilis
           MA-4680]
          Length = 381

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 127/367 (34%), Positives = 203/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVIY---------GGWTAFGIVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KMS+ WQK FLT G+LIAVFGMR++FP++IV + +  +PIEA+NLA+     Y +++
Sbjct: 53  ILKKMSAFWQKIFLTVGVLIAVFGMRLVFPVVIVAVTAKKSPIEAVNLALTDKDQYQQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F  +  + W+ ++E  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIFE-ERDIQWLRWIERPLAKLGKVDMLSVCIALVVLLV 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            S               ++  + + S  A +I +  +  L                    
Sbjct: 172 SSMTFAVHAHQHGGAHVDKAQTVLISGIAGLITYMVVGGLSGYFEDKLEEEEEREHEEEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                       V  G+    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAARTGKKKPAVVLAGQAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    ILI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIQYEIHEVITGLVGVILIAWS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|297197254|ref|ZP_06914651.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|297146654|gb|EFH28266.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 376

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 130/363 (35%), Positives = 201/363 (55%), Gaps = 37/363 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FRWA  VT  G   G+              +   I  ILAV+EISLSF+NA++NA 
Sbjct: 5   ILKTFRWAFAVTALGLAAGVLY---------DGWAAFGIVAILAVLEISLSFDNAVVNAG 55

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + +NP +A+ LA+     Y +++
Sbjct: 56  ILKKMNTFWQKIFLTVGVLIAVFGMRLVFPVVIVAITAKLNPYDAVQLALTDKDRYQQLV 115

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L ++  
Sbjct: 116 TDAHPAIAAFGGMFLLMIFLDFIFE-DRDIKWLAWLERPLAKLGKVDMLSVCIALVVLLI 174

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 175 TAFTFATHAHQHGGAHADKAQTVLISGVAGLITYLVVGGLSGYFENRLEDEEEREEEAQQ 234

Query: 224 -SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRS 282
                S     G+    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS
Sbjct: 235 SGGTGSPVKLAGQAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRS 294

Query: 283 MTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           +T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +     I EI TG    ILI  S +SS
Sbjct: 295 LTVYLVRQGTLDDYVYLEHGAHYAIGALAVILMVTIQYQINEIITGLVGVILIGWSFWSS 354

Query: 343 IKN 345
           ++ 
Sbjct: 355 VRR 357


>gi|299768440|ref|YP_003730466.1| hypothetical protein AOLE_00950 [Acinetobacter sp. DR1]
 gi|298698528|gb|ADI89093.1| hypothetical protein AOLE_00950 [Acinetobacter sp. DR1]
          Length = 360

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 128/352 (36%), Positives = 201/352 (57%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  TV         G+           +  + I  ILAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTVVCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   LA+  P+ Y + 
Sbjct: 61  SVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKLALNDPKTYSER 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +   H  IS FGGTFL++V L FFF+ + + HW  +LE  +S L+ +  + +FI L  + 
Sbjct: 121 LMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLSSLASVPAMSVFIALIALI 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +  ++  +   +    I+++ G+  L  +L  +              S       
Sbjct: 181 VMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+
Sbjct: 241 KAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 301 AYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|21220834|ref|NP_626613.1| hypothetical protein SCO2366 [Streptomyces coelicolor A3(2)]
 gi|8246807|emb|CAB92842.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 380

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 127/367 (34%), Positives = 202/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVFY---------GGWTAFGIVAILSIMEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I +++ PIEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTVGILIAVFGMRLVFPVVIVAISASLGPIEAVDLALTDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIFE-DRDIKWLAWLERPLAKLGKVDMLSVCIALVVLLV 171

Query: 190 ISNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +               ++  + + +  A +I +  +  L                    
Sbjct: 172 SAITFGAHAHQHGGAHADKAETVLLAGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAARTGKPKSAVRLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I EI TG     LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIQYEIHEIITGLVGVALIGWS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FFSSVRR 358


>gi|297199370|ref|ZP_06916767.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|297147381|gb|EDY59331.2| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 382

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 124/367 (33%), Positives = 203/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +  G               +  IL+++EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAVLYGGWEG---------FGVVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQ+ FLT G+LIAVFGMR++FP++IV I + + PIEA++LA+ +   Y +++
Sbjct: 53  ILKKMNAFWQRIFLTVGVLIAVFGMRLVFPVVIVAISAKMGPIEAVDLALNNKDHYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ ++E  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIFE-DRDIQWLRWIERPLAKLGKVDMLSVCIALVVLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 172 TAFTFATHAHQHGGAHVDKAQTVLISGIAGLITYMVVGGLSGYFEDKLEEDEEREHEEEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S  +  GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 RAEREGKSKSAVLMAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I EI TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILMVTIQYEIHEIITGLVGVLLIGWS 351

Query: 339 IYSSIKN 345
             SS++ 
Sbjct: 352 FLSSVRR 358


>gi|256788010|ref|ZP_05526441.1| hypothetical protein SlivT_26287 [Streptomyces lividans TK24]
 gi|289771898|ref|ZP_06531276.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289702097|gb|EFD69526.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 380

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 127/367 (34%), Positives = 202/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVFY---------GGWTAFGIVAILSIMEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I +++ PIEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAISASLGPIEAVDLALTDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIFE-DRDIKWLAWLERPLAKLGKVDMLSVCIALVVLLV 171

Query: 190 ISNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +               ++  + + +  A +I +  +  L                    
Sbjct: 172 SAITFGAHAHQHGGAHADKAETVLLAGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAARTGKPKSAVRLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I EI TG     LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIQYEIHEIITGLVGVALIGWS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FFSSVRR 358


>gi|193078634|gb|ABO13678.2| putative integral membrane protein [Acinetobacter baumannii ATCC
           17978]
          Length = 360

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 124/352 (35%), Positives = 201/352 (57%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  TV         G+           +  + I  ILAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTVVCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y + 
Sbjct: 61  SVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKMALNDPKTYSER 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  + 
Sbjct: 121 LMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIALI 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +  ++  +   +    I+++ G+  L  +L  +              +       
Sbjct: 181 VMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGTGAASGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+
Sbjct: 241 KAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 301 AYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|169794396|ref|YP_001712189.1| hypothetical protein ABAYE0201 [Acinetobacter baumannii AYE]
 gi|215481951|ref|YP_002324133.1| hypothetical protein ABBFA_000192 [Acinetobacter baumannii
           AB307-0294]
 gi|294838231|ref|ZP_06782914.1| hypothetical protein A60131_09868 [Acinetobacter sp. 6013113]
 gi|294860311|ref|ZP_06798080.1| hypothetical protein A6013_17096 [Acinetobacter sp. 6013150]
 gi|301345191|ref|ZP_07225932.1| hypothetical protein AbauAB0_03084 [Acinetobacter baumannii AB056]
 gi|301510682|ref|ZP_07235919.1| hypothetical protein AbauAB05_03864 [Acinetobacter baumannii AB058]
 gi|301595810|ref|ZP_07240818.1| hypothetical protein AbauAB059_08357 [Acinetobacter baumannii
           AB059]
 gi|169147323|emb|CAM85184.1| putative integral membrane protein [Acinetobacter baumannii AYE]
 gi|213987743|gb|ACJ58042.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
 gi|322509715|gb|ADX05169.1| Putative integral membrane protein [Acinetobacter baumannii 1656-2]
          Length = 360

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 124/352 (35%), Positives = 201/352 (57%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  TV         G+           +  + I  ILAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTVVCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR+IFP++IV + + +  +E   +A+  P+ Y + 
Sbjct: 61  SVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVVEVAKMALNDPKTYSER 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  + 
Sbjct: 121 LMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIALI 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +  ++  +   +    I+++ G+  L  +L  +              S       
Sbjct: 181 VMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+
Sbjct: 241 KAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 301 AYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|331697380|ref|YP_004333619.1| hypothetical protein Psed_3595 [Pseudonocardia dioxanivorans
           CB1190]
 gi|326952069|gb|AEA25766.1| protein of unknown function DUF475 [Pseudonocardia dioxanivorans
           CB1190]
          Length = 571

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 118/375 (31%), Positives = 200/375 (53%), Gaps = 50/375 (13%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F W+           +         + G +  + +C IL V+EISLSF+NA++NA  
Sbjct: 3   LRIFGWS---------YAVTAAALVVAFVYGGVEALVLCAILGVLEISLSFDNAVVNATV 53

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQDY 125
           L++MS+ WQ+ FLT GI+IAVFGMR++FP++IV I + +NP+EA  LA+       P  Y
Sbjct: 54  LERMSAFWQRIFLTVGIVIAVFGMRLVFPLLIVGITANLNPVEAFRLALEQRPESDPTSY 113

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
             ++++A+  I+ FGG FL+M+ L + F ++  + W+ +LE  ++ + ++  + I + + 
Sbjct: 114 AHLLNEAYPSIAAFGGMFLLMLFLDWLF-AERDVRWLSWLERPLARIGQLNRLSIILAVV 172

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVL---------------------- 223
            +  ++  L  +     + + T  ++ +  +N L  +                       
Sbjct: 173 ALVVLAGTLAADPA-KVLVAGTLGLVTYLLVNGLGDLFEQAGGADAIASSGEEAGDGAEE 231

Query: 224 ----------SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
                        S      GK G  LFLYLE++DA+ S DGVI +FAIT +  II +GL
Sbjct: 232 GGNGAAAARPGGPSGLAKAAGKAGFFLFLYLEVLDAAFSFDGVIGAFAITTDPIIIALGL 291

Query: 274 T-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSST 332
             IGA++VRS+T+ ++++G L  Y YLEHG++++I  LSVI+ +     + E+ TG    
Sbjct: 292 GLIGAMFVRSLTVFLVRKGTLADYVYLEHGAHWAIGALSVILLVGIGYHVDEVVTGLIGV 351

Query: 333 ILIFLSIYSS-IKNK 346
             I  +  SS I+N+
Sbjct: 352 AFIGAAFVSSVIRNR 366


>gi|325920185|ref|ZP_08182144.1| hypothetical protein XGA_1089 [Xanthomonas gardneri ATCC 19865]
 gi|325549325|gb|EGD20220.1| hypothetical protein XGA_1089 [Xanthomonas gardneri ATCC 19865]
          Length = 346

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 122/339 (35%), Positives = 210/339 (61%), Gaps = 5/339 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR + LVT          G     T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSFLVTAVCLGVAAWWGH---TTSMGLWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + ++++  
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVTVLLC 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN--NVTHGKHGLNLFLYLEII 247
               LP     S + +    I+++  +  ++++  S+ S        + G+  FLYLE++
Sbjct: 178 TKLFLPDAVFQSVLFAGLGGILLYLLVGSVDALFESEESEDGMGPAKRSGIAAFLYLEVL 237

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I
Sbjct: 238 DASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAI 297

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 GVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 336


>gi|239503872|ref|ZP_04663182.1| hypothetical protein AbauAB_16296 [Acinetobacter baumannii AB900]
 gi|260557949|ref|ZP_05830162.1| major facilitator family transporter [Acinetobacter baumannii ATCC
           19606]
 gi|260408740|gb|EEX02045.1| major facilitator family transporter [Acinetobacter baumannii ATCC
           19606]
          Length = 360

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 125/352 (35%), Positives = 201/352 (57%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  TV         G+           +  + I  ILAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTVVCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y + 
Sbjct: 61  SVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKMALNDPKTYSER 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  + 
Sbjct: 121 LMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIALI 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +  ++  +   +    I+++ G+  L  +L  +              S       
Sbjct: 181 VMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+
Sbjct: 241 KAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 301 AYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|158312910|ref|YP_001505418.1| hypothetical protein Franean1_1056 [Frankia sp. EAN1pec]
 gi|158108315|gb|ABW10512.1| protein of unknown function DUF475 [Frankia sp. EAN1pec]
          Length = 422

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 116/364 (31%), Positives = 195/364 (53%), Gaps = 37/364 (10%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F W++ +TV                + G      I  ILAV+EISLSF+NA++NA  
Sbjct: 32  LRIFGWSLAITVI---------GVAGAGVIGGGDAAAIVAILAVLEISLSFDNAVINATI 82

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++MS  WQ+ FL+ G++IAVFGMR++FPI+IV + + ++P++  +LA+   ++Y   + 
Sbjct: 83  LRRMSEFWQRIFLSVGVIIAVFGMRLLFPIVIVALTAHLSPVDVFDLALNHEEEYGARLH 142

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FL M+ L F F+ + ++ WI  +E       ++  + + + L  +  +
Sbjct: 143 DAHPSIAAFGGIFLFMIFLDFMFDPEREIQWIKRIEEPFRRAGQLDVVSVVLGLVALLVV 202

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-------------------- 230
                 +     +++  A +  + G+  L     +                         
Sbjct: 203 GEAFSGDHTQQVLTAGVAGLATYLGVRGLGEFFEARGIGADDDEDDEDEKAGANGSAPGR 262

Query: 231 --------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRS 282
                   +  G+    LFLYLE+IDAS S DGV+ +FAI++N FII  GL IGA+Y+RS
Sbjct: 263 TTGTSDVVLATGRAAFFLFLYLEVIDASFSFDGVVGAFAISQNIFIIAAGLGIGAMYIRS 322

Query: 283 MTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
            T+ ++++G L +Y YLEHG++Y+I  L+VI+ +    ++ EI TG      I L++ SS
Sbjct: 323 TTVYLVRRGTLGEYIYLEHGAHYAIGALAVILAVSIETEVHEIVTGLIGVAFIGLALLSS 382

Query: 343 IKNK 346
           I+++
Sbjct: 383 IRHR 386


>gi|282861709|ref|ZP_06270773.1| protein of unknown function DUF475 [Streptomyces sp. ACTE]
 gi|282563525|gb|EFB69063.1| protein of unknown function DUF475 [Streptomyces sp. ACTE]
          Length = 383

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 128/367 (34%), Positives = 206/367 (56%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G      I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVFY---------GGWQAFGIVAILSILEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + + PIEA++L+  +P  Y +++
Sbjct: 53  ILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVVIVAISAKLGPIEAVDLSFNNPDRYKELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FLMM+ L F F     + W+ ++E  ++ L K+  + + + L ++  
Sbjct: 113 TDAHPSIAAFGGMFLMMIFLDFIFE-DRDIQWLRWIERPLAKLGKVDMLSVCVALIVLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            S  + T          ++  + + S  A +I +  +  L                    
Sbjct: 172 ASMTVATHAHQHGGGHADKASTVLLSGIAGLITYLVVGGLSGFFENKLEEEEEREQEAEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                   +S  +  GK    +FLYLE++DAS S DGVI +FAIT    ++ +GL IGA+
Sbjct: 232 EAKKSGKPASAVLLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNEIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  LSVI+ +    +I EI TG    +LI  +
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSVILLITIQYEINEIITGLVGVVLIAWA 351

Query: 339 IYSSIKN 345
            +SS+++
Sbjct: 352 FWSSVRH 358


>gi|50085094|ref|YP_046604.1| hypothetical protein ACIAD1956 [Acinetobacter sp. ADP1]
 gi|49531070|emb|CAG68782.1| conserved hypothetical protein; putative membrane protein
           [Acinetobacter sp. ADP1]
          Length = 356

 Score =  220 bits (559), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 125/349 (35%), Positives = 199/349 (57%), Gaps = 14/349 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I+ T+         G            +  + I  +LAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIIFTIICLALSAWWGLTHGPNAGLSMMLKVLLITTVLAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+K FLT GIL+AVFGMR+IFP++IV + + +  IE   LA+  P+ Y + 
Sbjct: 61  SVLRNWDEFWKKLFLTVGILVAVFGMRLIFPLLIVGVTADMGMIEVAKLALNDPKTYSEK 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +   H  I+ FGG FLM+V L F F+     HW H+LE  +S+L+ I  + +F+ L  + 
Sbjct: 121 LLAHHAEIAAFGGMFLMLVFLNFLFDDGKDTHWFHWLETHLSNLANIPAMSVFVSLIALL 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVT-----------HGKHG 237
            ++  +P  +    + +    I+++ G+  L  +L   S ++ T             K G
Sbjct: 181 IMAAFVPEQQKLIVIMAGIWGIVVYIGVQVLGHLLEGSSEDDETDEKQVSGTSTNIVKAG 240

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           +  FLYLE++DAS S DGVI +FAIT +  +I++GL IGA++VRSMT+ ++++G L  + 
Sbjct: 241 IGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAMFVRSMTIYLVEKGTLEAFI 300

Query: 298 YLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           YLEHG++Y+I  L+ IM    T   +PE+ TG      I  ++ SSI  
Sbjct: 301 YLEHGAHYAIGALAAIMLYTGTGGHVPEVVTGLIGVAFIIWAVLSSIAY 349


>gi|254382840|ref|ZP_04998196.1| integral membrane protein [Streptomyces sp. Mg1]
 gi|194341741|gb|EDX22707.1| integral membrane protein [Streptomyces sp. Mg1]
          Length = 373

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 129/367 (35%), Positives = 199/367 (54%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G  +   I  IL V+EISLSF+NA++NA 
Sbjct: 4   VLKTFGWSFAVTALGLVAAVFY---------GGWTAFGIVAILTVLEISLSFDNAVVNAG 54

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + I PIEA++LA+     Y +++
Sbjct: 55  ILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVVIVAISAKIGPIEAVDLALNDKNMYEQLV 114

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L KI  +   I L ++  
Sbjct: 115 TDAHPSIAAFGGMFLLMIFLDFIFE-DRDIKWLAWLERPLAKLGKIDMLSACIALIVLVI 173

Query: 190 ISNILPTN----------EMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            S     N          +  + + S    +I +  +  L                    
Sbjct: 174 TSMTFAANAHQHGGVHVDKAQTVLVSGILGLITYMVVGGLSGYFENKLEEEEEAEHEAEE 233

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 234 EAKKTGKPVSAVAMAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 293

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S
Sbjct: 294 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIQYEINEVITGLVGVVLIGWS 353

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 354 FWSSVRR 360


>gi|302534235|ref|ZP_07286577.1| integral membrane protein [Streptomyces sp. C]
 gi|302443130|gb|EFL14946.1| integral membrane protein [Streptomyces sp. C]
          Length = 379

 Score =  219 bits (558), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 128/367 (34%), Positives = 201/367 (54%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 4   VLKTFGWSFAVTALGLVAAVFY---------GGWTAFGIVAILSILEISLSFDNAVVNAG 54

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + I PIEA++LA+   + Y +++
Sbjct: 55  ILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVVIVAISAKIGPIEAVDLAMTDKEMYKQLV 114

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L KI  +   I L ++  
Sbjct: 115 TDAHPSIAAFGGMFLLMIFLDFIFE-DRDIKWLAWLERPLAKLGKIDMLSACIALIVLVI 173

Query: 190 ISNILPTN----------EMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            S     N          +  + + S    +I +  +  L                    
Sbjct: 174 TSMTFAANAHQHGGTHVDKAQTVLVSGVLGLITYMIVGGLSGYFENKLEEEEEAEHEAEE 233

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 234 AAKKSGKPVSAVAMAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 293

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S
Sbjct: 294 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIQYEINEVITGLVGVVLIAWS 353

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 354 FWSSVRR 360


>gi|78049718|ref|YP_365893.1| hypothetical protein XCV4162 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325927514|ref|ZP_08188752.1| hypothetical protein XPE_2776 [Xanthomonas perforans 91-118]
 gi|78038148|emb|CAJ25893.1| putative membrane protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|325542107|gb|EGD13611.1| hypothetical protein XPE_2776 [Xanthomonas perforans 91-118]
          Length = 347

 Score =  219 bits (558), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 121/340 (35%), Positives = 207/340 (60%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR + +VT          G     +  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSFVVTAICLGLAAWWGH---TSSMGIWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSS---STAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
               LP     S + +        ++   ++ L     S+  +     + G+  FLYLE+
Sbjct: 178 TKLFLPEAIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|260550235|ref|ZP_05824448.1| major facilitator family transporter [Acinetobacter sp. RUH2624]
 gi|260406763|gb|EEX00243.1| major facilitator family transporter [Acinetobacter sp. RUH2624]
          Length = 360

 Score =  219 bits (558), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 127/352 (36%), Positives = 201/352 (57%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  TV         G+              + I  ILAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTVVCLALAAYWGFTHGPEAGVSTMFKALTITAILAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y + 
Sbjct: 61  SVLRGWDHFWKMIFLTVGILIAVFGMRLIFPVLIVSMTADMGFIEVAKMALNDPKTYSER 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +   H  IS FGGTFL++V L FFF+ + + HW  +LE+ +S L+ +  + +FI L  + 
Sbjct: 121 LMAHHAEISAFGGTFLLLVFLNFFFDEEKETHWFRWLEVKLSDLANVPAMSVFIALIALI 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +  +E  +   +    I+++ G+  L  +L  +              S       
Sbjct: 181 VMAGYVEDHERLAVTMAGVWGIVVYIGVQVLSHLLGGEPEIDEDGNAVMQDGSGAASGVI 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGA++VRSMT+ ++++G L+
Sbjct: 241 KAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAMFVRSMTVYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y +LEHG++Y+I  L+ IM    T + IPE+ TG      I  ++ +SI+ 
Sbjct: 301 AYVFLEHGAHYAIGALAFIMIASGTGLHIPEVVTGLIGVAFIAWAVIASIQY 352


>gi|21233409|ref|NP_639326.1| hypothetical protein XCC3987 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66770374|ref|YP_245136.1| hypothetical protein XC_4077 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188993574|ref|YP_001905584.1| hypothetical protein xccb100_4179 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21115249|gb|AAM43208.1| integral membrane protein [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66575706|gb|AAY51116.1| integral membrane protein [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167735334|emb|CAP53548.1| integral membrane protein [Xanthomonas campestris pv. campestris]
          Length = 347

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 121/340 (35%), Positives = 205/340 (60%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR + LVT          G     +  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSFLVTAICLGLAAWWGH---TSSMGIWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M+  W+K FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNEFWRKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+   KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDQDRKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSS---STAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
               LP     S + +        ++   ++ L     S+  +     + G+  FLYLE+
Sbjct: 178 TKLFLPDAVFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|290960799|ref|YP_003491981.1| integral membrane protein [Streptomyces scabiei 87.22]
 gi|260650325|emb|CBG73441.1| putative integral membrane protein [Streptomyces scabiei 87.22]
          Length = 381

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 127/367 (34%), Positives = 200/367 (54%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +              +   +  IL+V+EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAVLY---------DGWTAFGVVAILSVLEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + ++PIEA++LA+     Y + +
Sbjct: 53  ILKKMNAFWQKIFLTVGILIAVFGMRLVFPVVIVAISAKVSPIEAVDLALTDKDQYQQYV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  +   I + ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIFE-DRDIKWLSWLERPLAKLGKVDMLSACIAMIVLLV 171

Query: 190 ISNILPTN----------EMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            S    TN          +  + + S  A +I +  +  L                    
Sbjct: 172 TSMTFATNAHQHGGAHVDKAQTVLISGLAGLITYLIVGGLSGFFENKLEEEEEREHEEEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 AAERAGKPRSAVALAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+ I+ +    +I E  TG+   ILI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAAILLVTIQYEINEFITGSIGVILIAWS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|302551108|ref|ZP_07303450.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302468726|gb|EFL31819.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 381

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 127/367 (34%), Positives = 203/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G  + + +  IL+V+EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAVLF---------GGWTALGVVAILSVLEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + P+EA+NLA+   + Y +++
Sbjct: 53  ILKKMNAFWQKIFLTVGILIAVFGMRLVFPVVIVAISAQLGPLEAVNLALNDKEQYQQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIFE-DRDIKWLAWLERPLAKLGKVDMLSVCIALIVLLI 171

Query: 190 ISNILPTN----------EMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +     N          +  + + S  A +I +  +  L                    
Sbjct: 172 SALTFAANAHQHGGAHVDKAETVLLSGIAGLITYMIVGGLSGYFEDKLEEEEEREQEAEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAERTGKPRSAVALAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+V++ +     I EI TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVLLLVTIQYQINEIITGLIGVVLIAAS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|262280447|ref|ZP_06058231.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258225|gb|EEY76959.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 360

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 127/352 (36%), Positives = 200/352 (56%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  TV         G+           +  + I  ILAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTVVCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR+IFP+ IV + + +  IE   LA+  P+ Y + 
Sbjct: 61  SVLRNWDPFWKMLFLTVGILIAVFGMRLIFPVAIVAVTADMGMIEVAKLALNDPKTYSER 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +   H  IS FGGTFL++V L FFF+ + + HW  +LE  +S L+ +  + +FI L  + 
Sbjct: 121 LMAHHAEISAFGGTFLLLVFLNFFFDEEKETHWFRWLEAKLSSLASVPAMSVFIALIAML 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +  ++      +    I+++ G+  L  +L  +              S       
Sbjct: 181 IMAANVDESQRLVVTMAGIWGIVVYIGVEVLSHMLGGEPEIDEDGNAIMKDGSGAASGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K G+  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+
Sbjct: 241 KAGIGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++++SI+ 
Sbjct: 301 AYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVFASIQY 352


>gi|261403113|ref|YP_003247337.1| protein of unknown function DUF475 [Methanocaldococcus vulcanius
           M7]
 gi|261370106|gb|ACX72855.1| protein of unknown function DUF475 [Methanocaldococcus vulcanius
           M7]
          Length = 341

 Score =  218 bits (556), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 140/337 (41%), Positives = 215/337 (63%), Gaps = 10/337 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           LI++F+++I  T+   +            L G    +Y+ IIL ++E+SLSF+NA++NA 
Sbjct: 6   LINNFKFSIFFTIICLILAF---------LWGNFIGLYVAIILGILEVSLSFDNAVVNAT 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L++M   WQK FLT GILIAVFGMR+ FP++IV I S INPI+ +N+A+ +P +Y   +
Sbjct: 57  VLKRMDEYWQKMFLTVGILIAVFGMRLTFPLVIVSIASHINPIDVVNMALNNPSEYAMHL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
            +AH  IS FGG FL+MV L +F N +   HWI  +E  ++ L K++ I+I I L I+  
Sbjct: 117 KEAHPLISAFGGAFLLMVFLKYFLNEEKDTHWIGLIEKPLAKLGKLESIEIVIALFILLL 176

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG-KHGLNLFLYLEIID 248
              I+P++E  + + S    II++  ++ +   +       V    K GL LFLYLE++D
Sbjct: 177 ALKIVPSSEQLTVLISGILGIIVYVLVDSIGEYMQEKEQEMVNSAIKGGLILFLYLELLD 236

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FAIT++  +I +GL IGA++VRS+T+ ++K+G L++Y YLEHG+ Y+I 
Sbjct: 237 ASFSFDGVIGAFAITRDIILIALGLGIGAMFVRSLTVYLVKKGTLDEYIYLEHGAMYAIG 296

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            L+++MF+     IPE  TG+   +LI L++ SSI  
Sbjct: 297 TLAMLMFIGIRYHIPEYITGSIGALLIGLALVSSIIY 333


>gi|182439985|ref|YP_001827704.1| hypothetical protein SGR_6192 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178468501|dbj|BAG23021.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
          Length = 382

 Score =  218 bits (555), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 121/367 (32%), Positives = 204/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G  +   +  IL+++EIS+SF+NA++NA 
Sbjct: 2   ILKTFGWSFAVTALGLVVAVLY---------GGWAAFGVVAILSILEISVSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQ+ FLT G+LIAVFGMR++FP++IV I + + P+EA++LAI   + Y +++
Sbjct: 53  ILKKMNAFWQRIFLTIGVLIAVFGMRLVFPVVIVAISAKVGPVEAVDLAINDAERYEQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++   KI    + + L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFVFE-DRDIKWLGWLERPLAKFGKIDMASVCVALIVLAI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN--------- 230
            +    T          ++  + + S    +I +  +  L     +              
Sbjct: 172 SAMTFATQAHQHGGTHVDKASTVLLSGVFGLITYLVVGGLSGFFENKLEEEEEREHEAEE 231

Query: 231 ------------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                       +  GK    +FLYLE++DAS S DGVI++FAIT +  ++ +GL IGA+
Sbjct: 232 EARRSGRNAPVVLMAGKAAFFMFLYLEVLDASFSFDGVIAAFAITNDIVLMSLGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +     IPE+ TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYIYLEHGAHYAIGALAVILMISIRYQIPEVVTGLIGVLLIAGS 351

Query: 339 IYSSIKN 345
            +SS+++
Sbjct: 352 FWSSVRH 358


>gi|239933245|ref|ZP_04690198.1| hypothetical protein SghaA1_33788 [Streptomyces ghanaensis ATCC
           14672]
 gi|291441593|ref|ZP_06580983.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291344488|gb|EFE71444.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 363

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 124/366 (33%), Positives = 200/366 (54%), Gaps = 40/366 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  FRW  +VT  G   G               + + +  ILAV+E+SLSF+NA++NA 
Sbjct: 2   LLKTFRWTFVVTALGLAAGALY---------DGWTALGLVAILAVLEVSLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L++++  WQK FLT GILIAVFGMR++FPI+IV + + + P +A++LA+     Y +++
Sbjct: 53  ILKRLNVFWQKIFLTVGILIAVFGMRLLFPIVIVAVSARLTPSQAVHLALTDKARYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F   ++  W+  +E  ++ L +I  + + I L+++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFVFE-DHETKWLGPVERLLAKLGRIDMLSVCIALAVLLV 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSSD------------- 226
            S               ++  + + S  A +I +  +  L                    
Sbjct: 172 TSMTFAAHAHQHGGVHADKAQTVLVSGIAGLITYLVVGGLSGFFEDRLAARENESRAEQR 231

Query: 227 -------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIY 279
                   S     GK     FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+Y
Sbjct: 232 PEGVGGGRSAVALAGKAAFFTFLYLEVLDASFSFDGVIGAFAITNDIILMALGLGIGAMY 291

Query: 280 VRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSI 339
           VRS+T+ +++QG L+ Y YLEHG++Y+I  L++I+ +    +I +I TG     LI  S 
Sbjct: 292 VRSLTVYLVRQGTLDDYVYLEHGAHYAIGALALILLVSIQYEINDIVTGLIGVTLICASF 351

Query: 340 YSSIKN 345
           YSS+++
Sbjct: 352 YSSVRH 357


>gi|239979237|ref|ZP_04701761.1| hypothetical protein SalbJ_07364 [Streptomyces albus J1074]
 gi|291451115|ref|ZP_06590505.1| integral membrane protein [Streptomyces albus J1074]
 gi|291354064|gb|EFE80966.1| integral membrane protein [Streptomyces albus J1074]
          Length = 380

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 122/367 (33%), Positives = 203/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G  +   +  IL+++EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAVLY---------GGWAGFGVVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + I PIEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAISAKIGPIEAVDLAMTDKDHYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F    ++ W+ ++E  ++ L ++  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLNFLFE-DREIKWLTWIERPLAKLGRVDMLSVCIALIVLLI 171

Query: 190 ISNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +               ++  + + +  A +I +  +  L S                  
Sbjct: 172 SAMTFGSQAHQHGGTHADKAETVLLAGIAGLITYLIVGGLSSFFEDKLEEGEEREHEAEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAKRQGKPVSAVKLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ ++++G L+ Y YLEHG++Y+I  L+ I+ +     I E+ TG    +LI +S
Sbjct: 292 YVRSLTVYLVREGTLDDYVYLEHGAHYAIGALAAILLVTIRFQISEMITGLIGVVLIGVS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|169634711|ref|YP_001708447.1| hypothetical protein ABSDF3394 [Acinetobacter baumannii SDF]
 gi|169153503|emb|CAP02662.1| putative integral membrane protein [Acinetobacter baumannii]
          Length = 360

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 127/352 (36%), Positives = 200/352 (56%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  TV         G+           +  + I  ILAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTVVCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR++FP++IV + + +  IE   LA+  P+ Y + 
Sbjct: 61  SVLRNWDPFWKMIFLTVGILIAVFGMRLVFPVVIVAVTADMGVIEVAKLALNDPKTYSER 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +FI L  + 
Sbjct: 121 LMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFIALIALI 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +      + V +    I+++ G+  L  +L  +              S       
Sbjct: 181 VMAAYVDEVHRLAVVMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+
Sbjct: 241 KAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 301 AYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|256789886|ref|ZP_05528317.1| hypothetical protein SlivT_35853 [Streptomyces lividans TK24]
          Length = 368

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 124/370 (33%), Positives = 202/370 (54%), Gaps = 45/370 (12%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FRWA  VT  G   G+              + + I  IL+V+EISLSF+NA++NA  
Sbjct: 1   MKTFRWAFAVTALGLAAGVLY---------DGWTALGIVAILSVLEISLSFDNAVINAGI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+KM++ WQ+ FLT GI+IAVFGMR++FP++IV + + ++P  A++LA+     Y ++++
Sbjct: 52  LKKMNAFWQRIFLTVGIVIAVFGMRLVFPVVIVAVSARLSPWSAVHLALTDKDRYQELVT 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FLMM+ L F F  +  + W+ +LE  ++ L ++  + + I L ++   
Sbjct: 112 DAHPSIAAFGGMFLMMIFLDFVFE-ERDIKWLGWLERPLAKLGRVDMLSVCIALVVLLVS 170

Query: 191 SNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVL----------------- 223
           +               ++  + + +  A +I +  +  L                     
Sbjct: 171 ATTFGAHAHQHGGTHADKAETVLLAGVAGLITYMVVGGLSGFFEQRLEDEEEREQEAEKR 230

Query: 224 --------SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
                       S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL I
Sbjct: 231 AEKDAERAGRPGSPVKLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGI 290

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA+YVRS+T+ +++QG L+ Y YLEHG++Y+I  LS+I+ +    +I EI TG    +LI
Sbjct: 291 GAMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSLILLVTIQYEINEIVTGLVGVVLI 350

Query: 336 FLSIYSSIKN 345
             S +SS++ 
Sbjct: 351 GASFWSSVRR 360


>gi|326780652|ref|ZP_08239917.1| protein of unknown function DUF475 [Streptomyces cf. griseus
           XylebKG-1]
 gi|326660985|gb|EGE45831.1| protein of unknown function DUF475 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 387

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 121/367 (32%), Positives = 204/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G  +   +  IL+++EIS+SF+NA++NA 
Sbjct: 7   ILKTFGWSFAVTALGLVVAVLY---------GGWAAFGVVAILSILEISVSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQ+ FLT G+LIAVFGMR++FP++IV I + + P+EA++LAI   + Y +++
Sbjct: 58  ILKKMNAFWQRIFLTIGVLIAVFGMRLVFPVVIVAISAKVGPVEAVDLAINDAERYEQLV 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++   KI    + + L ++  
Sbjct: 118 TDAHPSIAAFGGMFLLMIFLDFVFE-DRDIKWLGWLERPLAKFGKIDMASVCVALIVLAI 176

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN--------- 230
            +    T          ++  + + S    +I +  +  L     +              
Sbjct: 177 SAMTFATQAHQHGGTHVDKASTVLLSGVFGLITYLVVGGLSGFFENKLEEEEEREHEAEE 236

Query: 231 ------------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                       +  GK    +FLYLE++DAS S DGVI++FAIT +  ++ +GL IGA+
Sbjct: 237 EARRSGRNAPVVLMAGKAAFFMFLYLEVLDASFSFDGVIAAFAITNDIVLMSLGLGIGAM 296

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +     IPE+ TG    +LI  S
Sbjct: 297 YVRSLTVYLVRQGTLDDYIYLEHGAHYAIGALAVILMISIRYQIPEVVTGLIGVLLIAGS 356

Query: 339 IYSSIKN 345
            +SS+++
Sbjct: 357 FWSSVRH 363


>gi|294812440|ref|ZP_06771083.1| Putative integral membrane protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294325039|gb|EFG06682.1| Putative integral membrane protein [Streptomyces clavuligerus ATCC
           27064]
          Length = 383

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 127/367 (34%), Positives = 202/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G  +   +  IL+V+EISLSF+NA++NA 
Sbjct: 4   VLKTFGWSFAVTALGLVAAVLY---------GGWTAFGVVAILSVLEISLSFDNAVVNAG 54

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV + + +  IEA++LA+     Y +++
Sbjct: 55  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAVSANLGLIEAVDLALNDKDKYQQLV 114

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F    ++ W+ +LE  ++ L K+  + + I L I+  
Sbjct: 115 TDAHPSIAAFGGMFLLMIFLDFVFE-DREIKWLGWLERPLAKLGKVDMLSVCIALVILLI 173

Query: 190 ISNILPTN----------EMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            S     N          +  + + S  A +I +  +  L                    
Sbjct: 174 SSMTFAKNAHQHGGGHADKAETVLLSGVAGLITYLIVGGLSGFFEGRLEAEEEREHEAEE 233

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 234 NARRSGKKVSAVAIGGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 293

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L++Y YLEHG++Y+I  LS+I+ +    +I E+ TG     LI  S
Sbjct: 294 YVRSLTVYLVRQGTLDEYVYLEHGAHYAIGALSIILLITIQYEIHELITGFIGVALIGWS 353

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 354 FWSSVRR 360


>gi|307323185|ref|ZP_07602395.1| protein of unknown function DUF475 [Streptomyces violaceusniger Tu
           4113]
 gi|306890674|gb|EFN21650.1| protein of unknown function DUF475 [Streptomyces violaceusniger Tu
           4113]
          Length = 382

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 128/367 (34%), Positives = 204/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVFY---------GGWTGFGIVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + I PIEA+ LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGVLIAVFGMRLVFPVVIVAISAKIGPIEAVRLALDDKDKYQQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F  + ++ W+ +LE  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIFE-EREIKWLGWLERPLAKLGKVDMLSVCIALIVLLV 171

Query: 190 ISNILPTN----------EMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    TN          +  + + +  A +I +  +  L                    
Sbjct: 172 SAMTFATNAHQHGGIHTDKTETVLIAGVAGVITYLIVAGLSGYFENKLEEEEEREHEAEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                       V  GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAKKSGKKVPAVVMAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYIYLEHGAHYAIGALAVILLVTIQYEIHEVITGLVGVVLIAWS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FFSSVQR 358


>gi|49474470|ref|YP_032512.1| hypothetical protein BQ09030 [Bartonella quintana str. Toulouse]
 gi|49239974|emb|CAF26381.1| hypothetical protein BQ09030 [Bartonella quintana str. Toulouse]
          Length = 350

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 151/339 (44%), Positives = 230/339 (67%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +L+ +F WA   T+ G   G  IGW  T ++ G +   +IC +L ++EISLSF+N+I+N
Sbjct: 1   MALLGYFGWAFFFTIIGVFLGGAIGWFETGSVIGFLKYFFICCVLGILEISLSFDNSIIN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L KM  +W++RFL WGILIAVFGMRI+FP+++V +   I+P+ A+ LAI+ P  Y  
Sbjct: 61  ARVLAKMDPLWRRRFLVWGILIAVFGMRIVFPLLVVAVAVGISPVAAVKLAIWEPHQYAT 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           I+  +HV I+ FGGTFLMMV L +FF+S+ ++HW+ F+E     L  + GI I I+L++I
Sbjct: 121 ILMDSHVAIAAFGGTFLMMVGLKYFFDSEKEVHWLAFIERPAQKLGAVGGIDIAIILTLI 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  + T +  +F+ ++   ++ F G+  + S+L S  +      K G+  FLYLEI+
Sbjct: 181 LFFSGQVVTEDKIAFLLAALYGLLTFIGVEAISSLLDSPKTTLSAVFKGGVGAFLYLEIL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGV+ +FA + N FII IGL+IGA YVRSMT+++++ GIL  Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVVGAFAFSHNLFIIAIGLSIGAFYVRSMTIMLVESGILLHYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            +L+VIM+LQT+V +PE+ TG     +I ++  SS++ K
Sbjct: 301 LILAVIMYLQTLVSVPEVLTGLVGVGIIGMAFCSSLRFK 339


>gi|294625677|ref|ZP_06704299.1| integral membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292600046|gb|EFF44161.1| integral membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 347

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 122/340 (35%), Positives = 209/340 (61%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV           G     +  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSLLVAAICLGLAAWWGH---TSSMGIWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLIGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYG---INFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
               LP     S + +    I+++     ++ L     S+  +     + G+  FLYLE+
Sbjct: 178 TKLFLPDGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVYHVPEVLTGLIGVGFIAASVWSSIRYR 337


>gi|121583381|ref|YP_973812.1| hypothetical protein Pnap_4653 [Polaromonas naphthalenivorans CJ2]
 gi|120596635|gb|ABM40070.1| protein of unknown function DUF475 [Polaromonas naphthalenivorans
           CJ2]
          Length = 359

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 122/347 (35%), Positives = 213/347 (61%), Gaps = 5/347 (1%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           +N+    ++ HF+ +  +T+     G   G+    T    +  +++  ILAV+E+SLSF+
Sbjct: 5   TNACQYLIMKHFKISFFITLILLGLGAFWGYGLGGTTGA-LQALFVVSILAVMEVSLSFD 63

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NA++NA  L+  +  WQK FLT GI+IAVFGMR++FPI+IV I + +  ++ M +A+ +P
Sbjct: 64  NAVVNASVLRTWNPFWQKLFLTVGIIIAVFGMRLVFPILIVSIATGLGLLDVMTMALNTP 123

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
           ++Y + ++  H  ++ FGG+FL++V L F F+ +  LHW+ ++E  +      +G+   +
Sbjct: 124 EEYSRHLTANHAQVAAFGGSFLLLVFLNFLFDQEKDLHWLGWIEEKLGKHGN-EGLSTLV 182

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN---NVTHGKHGLN 239
            +  +FG   ++P  +  S + +  + I ++  ++FL  +L ++  +        +  + 
Sbjct: 183 AMLAVFGCMTLVPEVQKLSVLMAGISGIAVYLAVSFLSGLLEAEEHDPVIGTAIKRGSIG 242

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
            FLYLE++DAS S DGVI +FAIT +  II++GL IGA++VRSMT+ ++ +G L ++ YL
Sbjct: 243 GFLYLEVLDASFSFDGVIGAFAITSDVVIIMLGLAIGAMFVRSMTVFLVHKGTLEEFVYL 302

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           EHG++Y+I +L++IM       I E FTG S    I LS++SS+  K
Sbjct: 303 EHGAHYAIGILALIMLASVKFHISEWFTGLSGVAFICLSLWSSVHYK 349


>gi|294841470|ref|ZP_06786153.1| hypothetical protein A6014_06386 [Acinetobacter sp. 6014059]
          Length = 360

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 126/352 (35%), Positives = 200/352 (56%), Gaps = 17/352 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNA 68
           + HFR++I  TV         G+           +  + I  ILAV+E+SLSF+NA++NA
Sbjct: 1   MKHFRFSIFFTVVCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+     W+  FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y + 
Sbjct: 61  SVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKMALNDPKTYSER 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           +   H  IS FGGTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  + 
Sbjct: 121 LMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIALI 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHG 234
            ++  +      + V +    I+++ G+  L  +L  +              S       
Sbjct: 181 VMAAYVDEVHRLAVVMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASGVV 240

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
           K GL  FLYLE++DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+
Sbjct: 241 KAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLD 300

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            Y +LEHG++Y+I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 301 AYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 352


>gi|294664798|ref|ZP_06730122.1| integral membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292605429|gb|EFF48756.1| integral membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 347

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 121/340 (35%), Positives = 207/340 (60%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV           G     +  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSLLVAAICLGLAAWWGH---TSSMGIWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSS---STAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
               LP     S + +        ++   ++ L     S+  +     + G+  FLYLE+
Sbjct: 178 TKLFLPDGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|239940900|ref|ZP_04692837.1| hypothetical protein SrosN15_07875 [Streptomyces roseosporus NRRL
           15998]
 gi|239987378|ref|ZP_04708042.1| hypothetical protein SrosN1_08742 [Streptomyces roseosporus NRRL
           11379]
 gi|291444335|ref|ZP_06583725.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
 gi|291347282|gb|EFE74186.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
          Length = 383

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 129/367 (35%), Positives = 205/367 (55%), Gaps = 40/367 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G      I  IL+V+EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAIFY---------GGWQAFGIVAILSVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV + + + PIEA++L+   P  Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAVSAKLGPIEAIDLSFNDPDKYKELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F+    +HW+ ++E  ++ L K+  + + + L I+  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIFDEDRDIHWLRWIERPLAKLGKVDMLSVCVALIILLI 172

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 173 TAMTFATQAHQHGGGHVDKSATVMLSGIAGLITYLIVGGLSGFFEGKLEEEEEREHEAEE 232

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    +     GK    LFLYLE++DAS S DGVI +FAIT    ++ +GL IGA+
Sbjct: 233 EAKKKGKPVTGVALAGKAAFFLFLYLEVLDASFSFDGVIGAFAITNEIVLMALGLGIGAM 292

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ ++++G L+ Y YLEHG++Y+I  LS+I+ +    +I E+ TG+   ILI LS
Sbjct: 293 YVRSLTVYLVREGTLDDYVYLEHGAHYAIGALSIILLITIQHEINELITGSVGVILIALS 352

Query: 339 IYSSIKN 345
            +SS+K 
Sbjct: 353 FWSSVKR 359


>gi|84622095|ref|YP_449467.1| integral membrane protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|84366035|dbj|BAE67193.1| integral membrane protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 347

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 123/340 (36%), Positives = 209/340 (61%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV           G     T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFREFRMSLLVAAVCLGVAAWWGH---TTALGLWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P+ Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPERYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYG---INFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
               LP     S + +    I+++     ++ L     S+        + G+  FLYLE+
Sbjct: 178 TKLFLPEGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVHHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|182438928|ref|YP_001826647.1| hypothetical protein SGR_5135 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326779584|ref|ZP_08238849.1| protein of unknown function DUF475 [Streptomyces cf. griseus
           XylebKG-1]
 gi|178467444|dbj|BAG21964.1| putative integral membrane protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326659917|gb|EGE44763.1| protein of unknown function DUF475 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 383

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 128/367 (34%), Positives = 204/367 (55%), Gaps = 40/367 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G      I +IL+V+EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVFY---------GGWQAFGIVLILSVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV + + + PIEA++L+   P  Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAVSAQLGPIEAIDLSFNDPDRYKELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F+    +HW+ ++E  ++ L K+  + + + L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIFDEDRDIHWLRWIERPLAKLGKVDMLSVCVALIVLLI 172

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 173 TATTFATQAHQHGGGHADKASTVMLSGIAGLITYLVVGGLSGFFEGKLEEEEEREHEAEE 232

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    +     GK    LFLYLE++DAS S DGVI +FAIT    ++ +GL IGA+
Sbjct: 233 EAKEKGKPVTGVALAGKAAFFLFLYLEVLDASFSFDGVIGAFAITNEIVLMALGLGIGAM 292

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ ++++G L+ Y YLEHG++Y+I  LS+I+ +     I E  TG+   ILI LS
Sbjct: 293 YVRSLTVYLVREGTLDDYVYLEHGAHYAIGALSIILLITIQFQINEFITGSVGVILIALS 352

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 353 FWSSVRR 359


>gi|289773769|ref|ZP_06533147.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289703968|gb|EFD71397.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 370

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 125/371 (33%), Positives = 203/371 (54%), Gaps = 45/371 (12%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  FRWA  VT  G   G+              + + I  IL+V+EISLSF+NA++NA 
Sbjct: 2   LLKTFRWAFAVTALGLAAGVLY---------DGWTALGIVAILSVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQ+ FLT GI+IAVFGMR++FP++IV + + ++P  A++LA+     Y +++
Sbjct: 53  ILKKMNAFWQRIFLTVGIVIAVFGMRLVFPVVIVAVSARLSPWSAVHLALTDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FLMM+ L F F  +  + W+ +LE  ++ L ++  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLMMIFLDFVFE-ERDIKWLGWLERPLAKLGRVDMLSVCIALVVLLV 171

Query: 190 ISNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +               ++  + + +  A +I +  +  L                    
Sbjct: 172 SATTFGAHAHQHGGTHADKAETVLLAGVAGLITYMVVGGLSGFFEQRLEDEEEREQEAEK 231

Query: 224 ---------SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT 274
                        S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL 
Sbjct: 232 RAEKDAERAGRPGSPVKLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLG 291

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA+YVRS+T+ +++QG L+ Y YLEHG++Y+I  LS+I+ +    +I EI TG    +L
Sbjct: 292 IGAMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSLILLVTIQYEINEIVTGLVGVVL 351

Query: 335 IFLSIYSSIKN 345
           I  S +SS++ 
Sbjct: 352 IGASFWSSVRR 362


>gi|254389103|ref|ZP_05004333.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|326440736|ref|ZP_08215470.1| hypothetical protein SclaA2_06698 [Streptomyces clavuligerus ATCC
           27064]
 gi|197702820|gb|EDY48632.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
          Length = 381

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 127/367 (34%), Positives = 202/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G  +   +  IL+V+EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAVLY---------GGWTAFGVVAILSVLEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV + + +  IEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAVSANLGLIEAVDLALNDKDKYQQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F    ++ W+ +LE  ++ L K+  + + I L I+  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFVFE-DREIKWLGWLERPLAKLGKVDMLSVCIALVILLI 171

Query: 190 ISNILPTN----------EMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            S     N          +  + + S  A +I +  +  L                    
Sbjct: 172 SSMTFAKNAHQHGGGHADKAETVLLSGVAGLITYLIVGGLSGFFEGRLEAEEEREHEAEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 NARRSGKKVSAVAIGGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L++Y YLEHG++Y+I  LS+I+ +    +I E+ TG     LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDEYVYLEHGAHYAIGALSIILLITIQYEIHELITGFIGVALIGWS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|122879022|ref|YP_199112.6| hypothetical protein XOO0473 [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 347

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 123/340 (36%), Positives = 208/340 (61%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV           G     T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFREFRMSLLVAAVCLGVAAWWGH---TTALGLWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +     M +A+  P+ Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLAPVMQMALKEPERYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYG---INFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
               LP     S + +    I+++     ++ L     S+        + G+  FLYLE+
Sbjct: 178 TKLFLPEGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVHHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|21219096|ref|NP_624875.1| hypothetical protein SCO0562 [Streptomyces coelicolor A3(2)]
 gi|6013085|emb|CAB57414.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 370

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 125/371 (33%), Positives = 202/371 (54%), Gaps = 45/371 (12%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  FRWA  VT  G   G+              + + I  IL+V+EISLSF+NA++NA 
Sbjct: 2   LLKTFRWAFAVTALGLAAGVLY---------DGWTALGIVAILSVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQ+ FLT GI+IAVFGMR++FP++IV + + ++P  A++LA+     Y +++
Sbjct: 53  ILKKMNAFWQRIFLTVGIVIAVFGMRLVFPVVIVAVSARLSPWSAVHLALTDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FLMM+ L F F     + W+ +LE  ++ L ++  + + I L ++  
Sbjct: 113 TDAHPSIAAFGGMFLMMIFLDFVFE-DRDIKWLGWLERPLAKLGRVDMLSVCIALVVLLV 171

Query: 190 ISNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +               ++  + + +  A +I +  +  L                    
Sbjct: 172 SATTFGAHAHQHGGAHADKAETVLLAGVAGLITYMVVGGLSGFFEQRLEDEEEREQEAEK 231

Query: 224 ---------SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT 274
                        S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL 
Sbjct: 232 RAEKDAERAGRPGSPVKLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLG 291

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA+YVRS+T+ +++QG L+ Y YLEHG++Y+I  LS+I+ +    +I EI TG    +L
Sbjct: 292 IGAMYVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSLILLVTIQYEINEIVTGLVGVVL 351

Query: 335 IFLSIYSSIKN 345
           I  S +SS++ 
Sbjct: 352 IGASFWSSVRR 362


>gi|21244793|ref|NP_644375.1| hypothetical protein XAC4076 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21110492|gb|AAM38911.1| integral membrane protein [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 347

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 122/340 (35%), Positives = 208/340 (61%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +   FR ++LV V         G     +  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MFRDFRMSLLVAVICLGLAAWWGH---TSSMGIWQALWLCLVLSVLEVSLSFDNAVVNAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ M++ WQK FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P  Y +++
Sbjct: 58  VLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPDRYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G
Sbjct: 118 TDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLG 177

Query: 190 ISNILPTNEMYSFVSS---STAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
               LP     S + +        ++   ++ L     S+  +     + G+  FLYLE+
Sbjct: 178 TKLFLPDGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGSMGPAKRSGIAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL++IM + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 298 IGVLAIIMLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 337


>gi|297194579|ref|ZP_06911977.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197722494|gb|EDY66402.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 381

 Score =  216 bits (549), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 130/366 (35%), Positives = 200/366 (54%), Gaps = 40/366 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G                       I +IL+++EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLAFAAWQW---------GWEAFGIVLILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + PIEA+ LA+  P  Y  ++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAISAKVGPIEAVQLAMDQPDRYEDLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F  + +  W+ +LE  ++ L K+  + + I L ++  
Sbjct: 113 TDAHAAIAAFGGMFLLMIFLDFIFE-EREHKWLAWLERPLAKLGKVDMLSVCIALIVLLL 171

Query: 190 ISNILPTN---------EMYSFVSSSTAAIIIFYGINFLESVLSS--------------- 225
            +    TN         +  + + S  A +I +  +  L                     
Sbjct: 172 TAITFATNAHTSTGHADKSATVLLSGVAGLITYLVVGGLSGYFEDKLEEEEEREHEEEEK 231

Query: 226 ------DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIY 279
                   S     GK    LFLYLE++DAS S DGVI +FAIT + F + +GL IGA+Y
Sbjct: 232 AKREGKPVSAVGLAGKAAFFLFLYLEVLDASFSFDGVIGAFAITNHIFWMALGLGIGAMY 291

Query: 280 VRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSI 339
           VRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S 
Sbjct: 292 VRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLITIQHEISELITGFIGVVLIAASF 351

Query: 340 YSSIKN 345
           +SS++ 
Sbjct: 352 WSSLRR 357


>gi|77164520|ref|YP_343045.1| hypothetical protein Noc_1007 [Nitrosococcus oceani ATCC 19707]
 gi|254434206|ref|ZP_05047714.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
 gi|76882834|gb|ABA57515.1| Protein of unknown function DUF475 [Nitrosococcus oceani ATCC
           19707]
 gi|207090539|gb|EDZ67810.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
          Length = 333

 Score =  215 bits (548), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 136/339 (40%), Positives = 212/339 (62%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF+++ LVTVAG +            L G  + ++I  IL V+EISLSF+NA++NA  
Sbjct: 1   MRHFKYSFLVTVAGLVAAF---------LWGGPAGLFIAAILGVLEISLSFDNAVVNASV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M   WQ RFLTWGILIAVFGMR++FP+ IV IV+ I  +E   +A+  P  Y   + 
Sbjct: 52  LKDMDPKWQARFLTWGILIAVFGMRLVFPVAIVAIVADIGILEVTQMALNDPDAYSAHLL 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            +HV IS FGG FL+MV L+F  +   +LHW   +E  ++ + K++ I+I I L +++ +
Sbjct: 112 ASHVDISAFGGMFLLMVFLSFLLDETKELHWWGLVEEKLAGIGKLESIEIVIALGVLWAL 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGIN---FLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
            + LP  E    + +  + +++F  +     L  V  +  +      + G+  FLYLE++
Sbjct: 172 QSFLPPEEKLDAMLAGISGVMLFVIVGSASGLFEVEETGEAVTHAAKRSGVMGFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAI+K+  II++GL IGA++VRS+T+ ++++G L++Y +LEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAISKDVIIIMLGLAIGAMFVRSITVYLVRKGTLSEYVFLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L++IM   T V IPE+ TG      I LS+ SSI+ +
Sbjct: 292 GALALIMLASTKVHIPEVVTGLIGAAFIGLSLLSSIRYR 330


>gi|121602667|ref|YP_989241.1| hypothetical protein BARBAKC583_0961 [Bartonella bacilliformis
           KC583]
 gi|120614844|gb|ABM45445.1| putative membrane protein [Bartonella bacilliformis KC583]
          Length = 350

 Score =  215 bits (548), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 150/337 (44%), Positives = 224/337 (66%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L  +F+WA   T+ G   G  IGW  T+++ G +   +IC  L ++EISLSF+N+I+NA+
Sbjct: 3   LFRYFKWAFSFTIIGVCLGGVIGWFETNSIIGILKYFFICCTLGILEISLSFDNSIVNAR 62

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +M+ +W +RFLTWGI+IAVFGMRIIFP+++V   + I+PI A+ LAI+ P  Y  I+
Sbjct: 63  ILGRMNQLWSRRFLTWGIIIAVFGMRIIFPLLVVAFAAWISPIAAVKLAIWEPDQYATIL 122

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + +H  I+ FGGTFLMMV L +FF+ + K+HW+ F+E     L  + GI I IVL +I  
Sbjct: 123 TDSHAGIAAFGGTFLMMVGLKYFFDPEKKVHWLPFIEKPAQKLGFLVGIDIAIVLILILF 182

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  + T +  + + +    ++ F  +  + + L S      T  K GL  FLYLEI+DA
Sbjct: 183 FSGQVVTADKLTVLLAMLYGLLTFLVVGAVGAFLDSKEMTLTTTAKGGLGSFLYLEILDA 242

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGV+ +FA + N FII IGL+IGA YVRSMT+++++ G L +Y+YLEHG++Y+I +
Sbjct: 243 SFSFDGVVGAFAFSHNLFIIAIGLSIGAFYVRSMTVMLVETGTLLRYRYLEHGAFYAILI 302

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+VIM++Q I+ +PEI TG     +I ++ YSS++ K
Sbjct: 303 LAVIMYMQIIMPVPEILTGFIGIFVIGMAFYSSLRFK 339


>gi|329934789|ref|ZP_08284830.1| Integral membrane protein [Streptomyces griseoaurantiacus M045]
 gi|329305611|gb|EGG49467.1| Integral membrane protein [Streptomyces griseoaurantiacus M045]
          Length = 379

 Score =  215 bits (548), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 125/367 (34%), Positives = 202/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +T  G +  +              +   I  ILAV+EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAITALGLVAAVFY---------DGWTGFGIVAILAVLEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + +NP +A++LA    + Y +++
Sbjct: 53  VLKKMNAFWQKIFLTIGVLIAVFGMRLVFPVVIVAITAKLNPWDAVDLAFSDKERYQQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L  +  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIFE-DRDIKWLAWLERPLAKLGKVDMLSVCIALIALLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            S  +            ++  + + S  A +I +  +  L                    
Sbjct: 172 SSMTVAAHAHQHGGVHVDKGQTVLLSGIAGLITYMIVGGLSGYFEDRLEEQEEREHEEEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S  +  G+    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 AAERSGRKKSPVLLAGQAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVMMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIQYEINEVITGLVGVVLIAWS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|312194852|ref|YP_004014913.1| hypothetical protein FraEuI1c_0970 [Frankia sp. EuI1c]
 gi|311226188|gb|ADP79043.1| protein of unknown function DUF475 [Frankia sp. EuI1c]
          Length = 373

 Score =  215 bits (547), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 119/357 (33%), Positives = 193/357 (54%), Gaps = 29/357 (8%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+           +         + G      +  ILAV+EISLSF+NA++NA 
Sbjct: 3   ILRIFGWS---------FAVTAVVVAGAGVIGGGQAAALVAILAVLEISLSFDNAVINAT 53

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS+ WQ+ FLT G+LIAVFGMR+IFPI++V + + ++P +  +LA+     Y   +
Sbjct: 54  ILGRMSAAWQRIFLTVGVLIAVFGMRLIFPIVVVALTAHLSPYDVFDLAVNHSDQYADKL 113

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
             AH  I+ FGG FL M+ L F F+++  + W+ +LE  +     +  I + + L  +  
Sbjct: 114 HAAHPAIAAFGGIFLFMIFLDFMFDNERDVQWLRWLEEPLRKAGALDVIPVVLGLVALLV 173

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD--------------------SSN 229
           +              +  A +  +  ++ L     S                     SS 
Sbjct: 174 VGEWFSGGHTEQVFVAGVAGLATYLAVSGLGEFFESRGLGAEEDDGDEPATAGTGGASST 233

Query: 230 NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLK 289
            +  GK    LFLYLE++DAS S DGV+ +FAI++N FII  GL IGA+Y+RS+T+ +++
Sbjct: 234 ALATGKAAFFLFLYLEVLDASFSFDGVVGAFAISQNIFIIAAGLGIGAMYIRSLTVFLVR 293

Query: 290 QGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           QG L++Y +LEHG++Y+I  L+VI+ +    D+PEI TG      I L++ +SI+++
Sbjct: 294 QGTLSEYVFLEHGAHYAIGALAVILAVSIENDVPEIVTGLIGVAFIGLALLTSIRHR 350


>gi|111225246|ref|YP_716040.1| hypothetical protein FRAAL5896 [Frankia alni ACN14a]
 gi|111152778|emb|CAJ64521.1| putative integral membrane protein [Frankia alni ACN14a]
          Length = 371

 Score =  215 bits (547), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 117/338 (34%), Positives = 185/338 (54%), Gaps = 32/338 (9%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           GT     I  ILAV+EISLSF+NA++NA  L++MS  WQK FLT G++IAVFGMR++FPI
Sbjct: 3   GTPRDAAIVAILAVLEISLSFDNAVINATILRRMSPFWQKLFLTLGVVIAVFGMRLLFPI 62

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV + + + P++  +LA+     Y + +  AH  I+ FGG FL M+ L F F+ +  + 
Sbjct: 63  IIVALTAHLGPVKVFDLALNDSAQYAEKLGDAHPAIAAFGGIFLFMLFLDFLFDPERDVQ 122

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLE 220
           WI  LE  +    ++  I   + L  +  +      +     +++  A +  + G+  L 
Sbjct: 123 WIKKLEEPLRRAGQLDVIPTVVGLVALLVVGEAFSGDHTQQVLTAGVAGLATYLGVRGLG 182

Query: 221 SVLSSDS-----------------SNNVTHGKH---------------GLNLFLYLEIID 248
               S                       T                      LFLYLE+ID
Sbjct: 183 EFFESRGVGAEDDDAADSDGVAVDGAGKTTAAPRSSGQPKLVLATGRAAAFLFLYLEVID 242

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGV+ +FAI++N F+I  GL IGA+Y+RS+T+ ++++G L++Y YLEHG++Y+I 
Sbjct: 243 ASFSFDGVVGAFAISQNIFVIATGLGIGAMYIRSLTVYLVRRGTLSEYIYLEHGAHYAIG 302

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L++I+ +    ++PEI TG      I L++ SSI+++
Sbjct: 303 ALAIILAISIETEVPEIVTGLVGVAFIGLALVSSIRHR 340


>gi|302560847|ref|ZP_07313189.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302478465|gb|EFL41558.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 379

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 127/367 (34%), Positives = 202/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAVLF---------GGWTAFGIVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + PIEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAISAQLGPIEAVDLALSDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L I+  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIFE-DRDIKWLAWLERPLAKLGKVDMLSVCIALVILLI 171

Query: 190 ISNILPTN----------EMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    TN          +  + + S  A +I +  +  L                    
Sbjct: 172 SAMTFATNAHQHGGGHADKAETVLLSGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    +     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 KAERAGKPRTGVALAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L++I+ +     I E+ TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALALILLVTIQYQIHELITGLIGVVLIGAS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|295839202|ref|ZP_06826135.1| integral membrane protein [Streptomyces sp. SPB74]
 gi|197695653|gb|EDY42586.1| integral membrane protein [Streptomyces sp. SPB74]
          Length = 375

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 129/367 (35%), Positives = 207/367 (56%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +TV G +              G  +   +  ILAV+EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFGITVLGLVAAAFY---------GGWTAFGVVAILAVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV + + INP++A++LAI +   Y +++
Sbjct: 53  ILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVLIVAVTAKINPVDAVDLAINNKDHYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + + L ++  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIFE-DRDIKWLGWLERPLAKLGKVDMLSVCVALILLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            S  + T          ++  + + S  A +I +  +  L                    
Sbjct: 172 ASMTVATHAHVHGGGHVDKAETVLLSGIAGLITYLIVGGLSGFFENKLEDEEEAEEEREE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE+IDAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAAKSGKPRSAVALAGKGAFFMFLYLEVIDASFSFDGVIGAFAITNDIILMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           Y+RS+T+ +++QG L+ Y YLEHG++Y+I  LSV++ +    +IPE+ TG    +LI  S
Sbjct: 292 YIRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSVLLLVTIRYEIPEVVTGLIGVVLIAAS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVQR 358


>gi|49475870|ref|YP_033911.1| hypothetical protein BH11410 [Bartonella henselae str. Houston-1]
 gi|49238678|emb|CAF27925.1| hypothetical protein BH11410 [Bartonella henselae str. Houston-1]
          Length = 352

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 151/337 (44%), Positives = 225/337 (66%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+ +  W    T+ G   G  IGW  T ++ G +   +IC +L V+EISLSF+N+I+NA+
Sbjct: 3   LVGYLGWPFFFTIIGVFLGGAIGWFETGSVIGFLKYFFICCVLGVLEISLSFDNSIINAR 62

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L++M  +W++RFL WGILIAVFGMR++FP+++V I   INPI A+ LAI+ P  Y  ++
Sbjct: 63  VLERMDPLWRRRFLVWGILIAVFGMRLVFPLLVVAIAVGINPIAAVKLAIWEPHHYAAVL 122

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  H+ I+ FGGTFLMMV L +FF+ + ++HW+ F+E     L  + GI I IVL +I  
Sbjct: 123 TDVHLAIAAFGGTFLMMVGLKYFFDPEKEVHWLVFIERPAQKLGALVGIDIAIVLVLILF 182

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  + T +   F+ +S   ++IF  +  + S+L +  +   T  K G   F YLEI+DA
Sbjct: 183 FSGQVVTEDKMVFLLASLYGLLIFIAVEAVSSLLDAPKTALTTVAKGGAGAFFYLEILDA 242

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGV+ +FA + N FII IGL+IGA YVRSMT+++++ GIL  Y+YLEHG++Y+I V
Sbjct: 243 SFSFDGVVGAFAFSHNLFIIAIGLSIGAFYVRSMTIMLVESGILLHYRYLEHGAFYAILV 302

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+VIM+LQT++ IPE+ TG     +I ++ YSS++ K
Sbjct: 303 LAVIMYLQTLLSIPEVLTGLVGVCIIGMAFYSSLRFK 339


>gi|320011014|gb|ADW05864.1| protein of unknown function DUF475 [Streptomyces flavogriseus ATCC
           33331]
          Length = 383

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 127/367 (34%), Positives = 203/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G +  +           G      +  IL+V+EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTALGLVAAVFY---------GGWQAFGVVAILSVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + + PIEA++L+   P  Y +++
Sbjct: 53  ILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVVIVAISAQLGPIEAIDLSFNDPDRYKELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ ++E  ++ L K+  + + + L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFIFE-DRDIQWLRWIERPLAKLGKVDMLSVCVALIVLLV 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 172 SAMTFATHAHQHGGGHADKASTVMLSGIAGLITYLVVGGLSGFFENKLEEEEEREQEAEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S  +  GK    +FLYLE++DAS S DGVI +FAIT    ++ +GL IGA+
Sbjct: 232 EAKKAGKPVSGVLLAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNEIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  LSVI+ +    +I E+ TG+   ILI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSVILLVTIQYEINELITGSVGVILIGWS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|166710315|ref|ZP_02241522.1| integral membrane protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 341

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 119/328 (36%), Positives = 204/328 (62%), Gaps = 3/328 (0%)

Query: 22  VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR 81
           +   +C     W    T  G    +++C++L+V+E+SLSF+NA++NA  L+ M++ WQK 
Sbjct: 4   LVAAVCLGVAAWWGHTTAMGLWQALWLCLVLSVLEVSLSFDNAVVNAGVLKHMNAFWQKL 63

Query: 82  FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGG 141
           FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P+ Y ++++  +  I+ FGG
Sbjct: 64  FLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPERYSQVLTDNYPSIAAFGG 123

Query: 142 TFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYS 201
            FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++      LP     S
Sbjct: 124 MFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLCTKLFLPEGIFQS 183

Query: 202 FVSSSTAAIIIFYG---INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVIS 258
            + +    I+++     ++ L     S+        + G+  FLYLE++DAS S DGVI 
Sbjct: 184 VLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEVLDASFSFDGVIG 243

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
           +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I VL++IM + T
Sbjct: 244 AFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAIGVLAIIMLVGT 303

Query: 319 IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +  +PE+ TG      I  S++SSI+ +
Sbjct: 304 VYHVPEVLTGLIGVAFIAASVWSSIRYR 331


>gi|294629126|ref|ZP_06707686.1| integral membrane protein [Streptomyces sp. e14]
 gi|292832459|gb|EFF90808.1| integral membrane protein [Streptomyces sp. e14]
          Length = 379

 Score =  213 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 125/366 (34%), Positives = 201/366 (54%), Gaps = 41/366 (11%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F W+  +TV G +  +           G  +   +  ILAV+EISLSF+NA++NA  
Sbjct: 1   MKTFGWSFAITVLGLIAAVFY---------GGWTAFGVVAILAVLEISLSFDNAVVNAGI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + + PIEA++LA      Y ++++
Sbjct: 52  LKKMNAFWQKIFLTVGVLIAVFGMRLVFPVVIVAITAKMGPIEAVHLAFSDKDRYQQLVT 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FL+M+ L F F     + W+ ++E  ++ L K+  + + I L ++   
Sbjct: 112 DAHPAIAAFGGMFLLMIFLDFIFE-DRDIQWLRWIERPLAKLGKVDMLSVCIALIVLLIT 170

Query: 191 SNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVL----------------- 223
           S    T          ++  + + +  A +I +  +  L                     
Sbjct: 171 SFTFATHAHQHGGGHVDKAQTVLIAGIAGLITYMVVGGLSGFFEDRLEDEEEREHEEEEA 230

Query: 224 ----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIY 279
                      V  G+    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+Y
Sbjct: 231 AARSGKQKPAIVLAGQAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVMMALGLGIGAMY 290

Query: 280 VRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSI 339
           VRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +     I E+ TG    +LI  S 
Sbjct: 291 VRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILMVTIQYQINEVITGLVGVVLIAWSF 350

Query: 340 YSSIKN 345
           +SS++ 
Sbjct: 351 WSSVRR 356


>gi|188578924|ref|YP_001915853.1| hypothetical protein PXO_02894 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188523376|gb|ACD61321.1| integral membrane protein [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 341

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 119/328 (36%), Positives = 204/328 (62%), Gaps = 3/328 (0%)

Query: 22  VAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKR 81
           +   +C     W    T  G    +++C++L+V+E+SLSF+NA++NA  L+ M++ WQK 
Sbjct: 4   LVAAVCLGVAAWWGHTTALGLWQALWLCLVLSVLEVSLSFDNAVVNAGVLKHMNAFWQKL 63

Query: 82  FLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGG 141
           FLT GILIAVFGMR++FPI+IV + + +  +  M +A+  P+ Y ++++  +  I+ FGG
Sbjct: 64  FLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQMALKEPERYSQVLTDNYPSIAAFGG 123

Query: 142 TFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYS 201
            FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++      LP     S
Sbjct: 124 MFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLCTKLFLPEGIFQS 183

Query: 202 FVSSSTAAIIIFYG---INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVIS 258
            + +    I+++     ++ L     S+        + G+  FLYLE++DAS S DGVI 
Sbjct: 184 VLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEVLDASFSFDGVIG 243

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
           +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I VL++IM + T
Sbjct: 244 AFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAIGVLAIIMLVGT 303

Query: 319 IVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +  +PE+ TG      I  S++SSI+ +
Sbjct: 304 VYHVPEVLTGLIGVAFIAASVWSSIRYR 331


>gi|237653141|ref|YP_002889455.1| hypothetical protein Tmz1t_2476 [Thauera sp. MZ1T]
 gi|237624388|gb|ACR01078.1| protein of unknown function DUF475 [Thauera sp. MZ1T]
          Length = 339

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 125/337 (37%), Positives = 206/337 (61%), Gaps = 11/337 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F W+I  T         +       L G     +I  +LAV+E SLSF+NA++NA  
Sbjct: 4   LKYFTWSIGFT---------VFGLVGGYLLGGWPAAFIVAVLAVLETSLSFDNAVVNATV 54

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M   W++RFL WGILIAVFGMRI+FP+ IV +V+++ P+E ++LA+++P +Y ++++
Sbjct: 55  LRHMDEKWRQRFLLWGILIAVFGMRIVFPLAIVGVVASLGPVEVVDLALFNPDEYARLLT 114

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            AH  I+ FGG FLMMV L FF +     HW+  +E  ++ L +++  +I + L  I   
Sbjct: 115 SAHHEIAAFGGAFLMMVFLKFFIDENKDTHWLAPIESPLTKLGRLEAAQILLTLLAILAT 174

Query: 191 SNILPT-NEMYSFVSSSTAAIIIFYGINFLESVL-SSDSSNNVTHGKHGLNLFLYLEIID 248
           S  +   ++   F+ +    +I++   + L +++   +        K G   F+YLE++D
Sbjct: 175 SAWIDGADKRMEFIVAGVWGLIVYIAADGLGAIMGGEEGEGGKMVAKTGFAGFMYLELLD 234

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T +  II IGL +GA++VRS TL+++ +G L  Y+YLEHG++++I 
Sbjct: 235 ASFSFDGVIGAFALTTSLPIIAIGLGVGAMFVRSFTLMLVYRGTLEAYRYLEHGAFWAIG 294

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            L+ IMF+   + IPE FTG    +LI  + +SS+++
Sbjct: 295 ALAAIMFVGVHMHIPETFTGLIGAVLIGAAFWSSLRH 331


>gi|21224631|ref|NP_630410.1| hypothetical protein SCO6313 [Streptomyces coelicolor A3(2)]
 gi|13872777|emb|CAC37534.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 363

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 121/341 (35%), Positives = 190/341 (55%), Gaps = 34/341 (9%)

Query: 36  THTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMR 95
                G  +   I  IL+V+EISLSF+NA++NA  L+KM++ WQK FLT GILIAVFGMR
Sbjct: 4   GRGSRGGWTAFGIVAILSVMEISLSFDNAVVNAGILKKMNAFWQKIFLTVGILIAVFGMR 63

Query: 96  IIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNS 155
           ++FP++IV I   + PIEA++LA+     Y ++++ AH  I+ FGG FL+M+ L F F  
Sbjct: 64  LVFPVVIVAIS--LGPIEAVDLALTDKDRYQELVTDAHPSIAAFGGMFLLMIFLDFVFE- 120

Query: 156 QNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNIL----------PTNEMYSFVSS 205
              + W+ +LE  ++ L ++  + + I L ++   +               ++  + + +
Sbjct: 121 DRGIKWLAWLERPLAKLGRVDMLSVCIALVVLLVSATTFGAHAHQHGGAHADKAETVLLA 180

Query: 206 STAAIIIFYGINFLESVL---------------------SSDSSNNVTHGKHGLNLFLYL 244
             A +I +  +  L                             S     GK    +FLYL
Sbjct: 181 GIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEEEAARTGKPKSAVRLAGKAAFFMFLYL 240

Query: 245 EIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSY 304
           E++DAS S DGVI +FAIT +  ++ +GL IGA+YVRS+T+ +++QG L+ Y YLEHG++
Sbjct: 241 EVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMYVRSLTVYLVRQGTLDDYVYLEHGAH 300

Query: 305 YSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           Y+I  L+VI+ +    +I EI TG     LI  S +SS++ 
Sbjct: 301 YAIGALAVILLVTIQYEIHEIITGLVGVALIGWSFFSSVRR 341


>gi|78066974|ref|YP_369743.1| hypothetical protein Bcep18194_A5505 [Burkholderia sp. 383]
 gi|77967719|gb|ABB09099.1| protein of unknown function DUF475 [Burkholderia sp. 383]
          Length = 359

 Score =  213 bits (541), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 124/341 (36%), Positives = 206/341 (60%), Gaps = 10/341 (2%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            NS    ++  F+  + +TV   +    +         G +  + I  +L+V+EISLS +
Sbjct: 15  QNSNTPIMLKDFKIPLSLTVLALVAAYFL---------GGVKDMLIVAVLSVLEISLSLD 65

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NA++NA  L+  S  W+ RF+ +G+ +AVFGMR++FP++IV ++  I   +A+ LAI SP
Sbjct: 66  NAVVNASVLKNWSEKWRNRFMVFGLPVAVFGMRLVFPLLIVAVIGHIGMWDALKLAIESP 125

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
           + Y  I++ AH  +S FGG FL+MV   F  +++   HWI FLE  MSHL +I  +++ +
Sbjct: 126 EQYASILTSAHHQVSAFGGAFLLMVFFKFMLDTEKDEHWIGFLEGPMSHLGRITALEVAL 185

Query: 183 VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFL 242
            L+II   S  +P  E  +F+ +    +I F   + +  ++           + G+  F+
Sbjct: 186 TLAIIIIASLYVPAAEQVAFLLAGAFGVISFVIAHGIGDLIGG-EETGTRVVREGVAGFM 244

Query: 243 YLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHG 302
           YLE++D+S S DGVI +FA++ N F+I +GL +GA Y+R MTL++LK+G L +Y+YLEHG
Sbjct: 245 YLEVLDSSFSFDGVIGAFALSNNIFLIALGLGVGAAYIREMTLVLLKKGTLAQYRYLEHG 304

Query: 303 SYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           ++++I  L+ IMFL    ++PE+ TG     +I  +++SSI
Sbjct: 305 AFWAIGALATIMFLGVKFEVPEVITGLVGAAMIAAAVWSSI 345


>gi|289664732|ref|ZP_06486313.1| hypothetical protein XcampvN_17108 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289670855|ref|ZP_06491930.1| hypothetical protein XcampmN_20803 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 341

 Score =  213 bits (541), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 121/333 (36%), Positives = 205/333 (61%), Gaps = 6/333 (1%)

Query: 17  AILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSS 76
           ++LV           G     T  G    +++C++L+V+E+SLSF+NA++NA  L+ M++
Sbjct: 2   SLLVAAVCLSVAAWWGH---TTSMGLWQALWLCLVLSVLEVSLSFDNAVVNAGVLKHMNA 58

Query: 77  IWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPI 136
            WQK FLT GILIAVFGMR++FPI+IV + + +     M +A+  P+ Y ++++  +  I
Sbjct: 59  FWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLAPVMQMALKEPERYSQVLTDNYPSI 118

Query: 137 SGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPT 196
           + FGG FL++V L F F+ + KLHW+  +E  +  L K   + + + +S++ G    LP 
Sbjct: 119 AAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKADAMSVIVAVSVLLGTKLFLPD 178

Query: 197 NEMYSFVSSSTAAIIIFYG---INFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSL 253
               S + +    I+++     ++ L     S+        + G+  FLYLE++DAS S 
Sbjct: 179 GIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGGMGPAKRSGIAAFLYLEVLDASFSF 238

Query: 254 DGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVI 313
           DGVI +FAIT++  II++GL IGA++VRSMT+ ++ +G L+++ +LEHG++Y+I VL++I
Sbjct: 239 DGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHKGTLDEFVFLEHGAHYAIGVLAII 298

Query: 314 MFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           M + T+  +PE+ TG      I  S++SSI+ +
Sbjct: 299 MLVGTVYHVPEVLTGLIGVAFIAASVWSSIRYR 331


>gi|319406022|emb|CBI79653.1| conserved membrane hypothetical protein [Bartonella sp. AR 15-3]
          Length = 350

 Score =  213 bits (541), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 150/339 (44%), Positives = 224/339 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +L+ +F+WA   TV G L G  IGW  T T+ G++   +IC IL ++EISLSF+N+I+N
Sbjct: 1   MALLGYFKWAFFFTVIGMLLGAFIGWLETGTIVGSLKYFFICCILGILEISLSFDNSIIN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
            + L++M+ +W++RFLTWG+LIAVFGMRIIFP+++V I + INPI A+ LAI+ P  Y  
Sbjct: 61  VRFLKEMNQLWRRRFLTWGVLIAVFGMRIIFPLLVVAIAAWINPIAAIKLAIWDPHRYAA 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           I+  AH  I+ FG TFLMMV L +FF+S+ K+HW+ F+E     L     I I I+L ++
Sbjct: 121 ILMDAHKGIAAFGATFLMMVGLKYFFDSEKKIHWLVFIEKPAQKLGSFVQIDIIIILMLM 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
             IS  +      + + S    ++ F  +  + S+L S  +  +   K G   FLYLE++
Sbjct: 181 LFISEQIVAENKLTVLFSMLYGLVTFLLVEAICSLLDSQKNTLIAVAKGGAGSFLYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGV+ +FA + N FII IGL IGA YVR+MT+++ + G L  Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRAMTIMLFETGTLLHYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            +L++IM+++ I+ IPE+ TG     +I ++ YSSI+ K
Sbjct: 301 LILAMIMYIEIIMSIPEVLTGFIGVCIIGMAFYSSIRFK 339


>gi|325284560|ref|YP_004264023.1| hypothetical protein Deipr_2032 [Deinococcus proteolyticus MRP]
 gi|324316049|gb|ADY27163.1| protein of unknown function DUF475 [Deinococcus proteolyticus MRP]
          Length = 351

 Score =  212 bits (540), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 134/339 (39%), Positives = 204/339 (60%), Gaps = 4/339 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
               F +A LVT+         G+     L      + I ++L V+EISLSF+NA++NA 
Sbjct: 4   FKEFFGFASLVTLVCLAVAAWDGYTRGGGLDAMWQALAIAVLLGVLEISLSFDNAVVNAT 63

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  WQ+RFLTWGILIAVFGMR IFPI+IV + + +   E +  A  +P+ Y + +
Sbjct: 64  VLRTMSQKWQQRFLTWGILIAVFGMRFIFPILIVALSAGLGFGEVVREAFANPELYAEHL 123

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
            +AHV IS FGG FLMMV L +F ++   +HW+   E  ++   K+  I+  IV  ++  
Sbjct: 124 ERAHVTISAFGGAFLMMVFLKYFMDAAKDVHWLRRAERLLARAGKLDSIQGIIVGVLLLA 183

Query: 190 -ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
            +   +   E +S +S+    ++++  ++ + ++   D     +    G + FLYLEI+D
Sbjct: 184 LVHYTVAPAEQFSALSAGLVGLLVYLMMDTVSNLFEVDGLTEKSGA-AGASAFLYLEILD 242

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS SLDGVI +FA+TK+  +I  GLTIGAI+VRS+T++M+K+G L  Y++LEHG++Y I 
Sbjct: 243 ASFSLDGVIGAFALTKDVVLIAAGLTIGAIFVRSLTIMMVKKGTLEAYRFLEHGAHYGIG 302

Query: 309 VLSVIMFLQTI--VDIPEIFTGTSSTILIFLSIYSSIKN 345
            L+ IM L     V IPE+ TG      I L+I+SS++ 
Sbjct: 303 ALATIMLLSMNRDVHIPELVTGLIGAGFIGLAIWSSLQA 341


>gi|326570893|gb|EGE20917.1| hypothetical protein E9S_04142 [Moraxella catarrhalis BC7]
          Length = 358

 Score =  212 bits (539), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 129/353 (36%), Positives = 204/353 (57%), Gaps = 20/353 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF + I+ T    +     G+     +S     + I  ILA++EISLSF+NA++NA  
Sbjct: 1   MRHFLFDIIFTFVCLVIAAWWGYSHGG-ISEMFLALGITAILAIMEISLSFDNAVVNASI 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+  +  W+K FLT GILIAVFGMR+IFPI IV + + +   E ++LA+ +P  Y + ++
Sbjct: 60  LKGWNDFWKKIFLTVGILIAVFGMRLIFPIAIVAVTANLGMGEVIHLALNNPVQYAEHLN 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F F     +HW  +LE  +   SK+  + +F+ L ++   
Sbjct: 120 AHHAEISAFGGMFLLLVFLNFMF-GDKDVHWFKWLESRLVKFSKVDAMSVFVALVVLMIS 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV------------------T 232
            + +   +    + +    I+++ G++ L ++L  D  + V                  T
Sbjct: 179 MSWVEEAKQGVVMVAGIWGILVYLGVSVLSALLEGDGDDKVAVYDAKGREITNTAGVSST 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K G+  FLYLE++DAS S DGVI +FAIT +  +I+IGL IGA++VRSMT+ ++ +G 
Sbjct: 239 ILKGGIAGFLYLEVLDASFSFDGVIGAFAITNDVIVIMIGLAIGAMFVRSMTIYLVNKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ + YLEHG++Y+I  L++IM L T   +PEI TG      I LS+++SI+ 
Sbjct: 299 LSDFIYLEHGAHYAIGALAIIMLLSTRFHVPEIITGLIGVAFIVLSVFNSIQY 351


>gi|302545763|ref|ZP_07298105.1| integral membrane protein [Streptomyces hygroscopicus ATCC 53653]
 gi|302463381|gb|EFL26474.1| integral membrane protein [Streptomyces himastatinicus ATCC 53653]
          Length = 392

 Score =  212 bits (539), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 129/377 (34%), Positives = 201/377 (53%), Gaps = 53/377 (14%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT  G      +              + I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTAGGLALAGVLWGWKG---------LAIVGILSILEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + PIEA+NLAI   + Y  ++
Sbjct: 53  ILRKMNAFWQKIFLTVGILIAVFGMRLVFPVVIVAITAKLGPIEAVNLAINDKEKYEHLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F  +  + W+ +LE  +S L K+      I L+++  
Sbjct: 113 TGAHPAIAAFGGMFLLMIFLDFIFE-ERDIRWLGWLEKPLSKLGKLDTFSAVIALAVLLV 171

Query: 190 ISNILPTNEMY-------SFVSSSTAAIIIFYGINFLESVLSSDSSNNV----------- 231
            +  + T+  +       + + S  A ++ +  +N +          +            
Sbjct: 172 TATTVATDVAHGGGDKSATVLLSGVAGLMTYLIVNGISGFFEDKLEEDEDEEDGEGGADG 231

Query: 232 -------------------------THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNF 266
                                      GK    +FLYLE+IDAS S DGVI +FAIT + 
Sbjct: 232 EDEADEKKPAENGGGRGSSGATVVGLAGKAAFFMFLYLEVIDASFSFDGVIGAFAITNDI 291

Query: 267 FIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIF 326
           F + +GL IGA+Y+RS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+      +I E+ 
Sbjct: 292 FEMALGLGIGAMYIRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLATIKFEINELI 351

Query: 327 TGTSSTILIFLSIYSSI 343
           TG+    LI  S +SS+
Sbjct: 352 TGSVGIALIGASYWSSV 368


>gi|296113354|ref|YP_003627292.1| hypothetical protein MCR_1135 [Moraxella catarrhalis RH4]
 gi|295921048|gb|ADG61399.1| conserved hypothetical protein [Moraxella catarrhalis RH4]
 gi|326559695|gb|EGE10106.1| hypothetical protein E9M_08618 [Moraxella catarrhalis 46P47B1]
 gi|326560335|gb|EGE10723.1| hypothetical protein E9G_07104 [Moraxella catarrhalis 7169]
 gi|326562006|gb|EGE12336.1| hypothetical protein E9K_08302 [Moraxella catarrhalis 103P14B1]
 gi|326566345|gb|EGE16495.1| hypothetical protein E9Q_07959 [Moraxella catarrhalis BC1]
 gi|326570155|gb|EGE20200.1| hypothetical protein E9U_04630 [Moraxella catarrhalis BC8]
 gi|326574500|gb|EGE24442.1| hypothetical protein E9Y_06042 [Moraxella catarrhalis 101P30B1]
 gi|326575912|gb|EGE25835.1| hypothetical protein E9W_03090 [Moraxella catarrhalis CO72]
 gi|326576376|gb|EGE26285.1| hypothetical protein EA1_05452 [Moraxella catarrhalis O35E]
          Length = 358

 Score =  211 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 128/353 (36%), Positives = 203/353 (57%), Gaps = 20/353 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF + I+ T    +     G+     +S     + I  ILA++EISLSF+NA++NA  
Sbjct: 1   MRHFLFDIIFTFVCLVIAAWWGYSHGG-ISEMFLALGITAILAIMEISLSFDNAVVNASI 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+  +  W+K FLT GILIAVFGMR+IFPI IV + + +   E ++LA+ +P  Y + ++
Sbjct: 60  LKGWNDFWKKIFLTVGILIAVFGMRLIFPIAIVAVTANLGMGEVIHLALNNPVQYAEHLN 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F F     +HW  +LE  +   SK+  + +F+ L ++   
Sbjct: 120 AHHAEISAFGGMFLLLVFLNFMF-GDKDVHWFKWLESRLVKFSKVDAMSVFVALVVLMIS 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV------------------T 232
            + +   +    + +    I+++ G++ L ++L  D  +                    T
Sbjct: 179 MSWVEEAKQGVVMVAGIWGILVYLGVSVLSALLEGDGDDKAAVYDAKGREITNTAGVSST 238

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
             K G+  FLYLE++DAS S DGVI +FAIT +  +I+IGL IGA++VRSMT+ ++ +G 
Sbjct: 239 ILKGGIAGFLYLEVLDASFSFDGVIGAFAITNDVIVIMIGLAIGAMFVRSMTIYLVNKGT 298

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           L+ + YLEHG++Y+I  L++IM L T   +PEI TG      I LS+++SI+ 
Sbjct: 299 LSDFIYLEHGAHYAIGALAIIMLLSTRFHVPEIITGLIGVAFIVLSVFNSIQY 351


>gi|71276516|ref|ZP_00652791.1| Protein of unknown function DUF475 [Xylella fastidiosa Dixon]
 gi|170729737|ref|YP_001775170.1| hypothetical protein Xfasm12_0534 [Xylella fastidiosa M12]
 gi|71162693|gb|EAO12420.1| Protein of unknown function DUF475 [Xylella fastidiosa Dixon]
 gi|167964530|gb|ACA11540.1| integral membrane protein [Xylella fastidiosa M12]
          Length = 345

 Score =  211 bits (538), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 122/340 (35%), Positives = 213/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T          G+    T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFTAFCLSLAAWWGY---STALGVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GILIAVFGMR++FPI+IV + + +  I  M LA+  P+ Y  ++
Sbjct: 58  ILKHMSEFWRKLFLTIGILIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSLVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   + + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAMAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM + T+  +PE+ TG     LI  S++SS + +
Sbjct: 298 IGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYR 337


>gi|93004828|ref|YP_579231.1| hypothetical protein Pcryo_2516 [Psychrobacter cryohalolentis K5]
 gi|92395390|gb|ABE76293.1| protein of unknown function DUF475 [Psychrobacter cryohalolentis
           K5]
          Length = 354

 Score =  211 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 121/348 (34%), Positives = 203/348 (58%), Gaps = 14/348 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF    + T          G+     + G I+T+ I  ILAV+EISLSF+NA++NA  
Sbjct: 1   MRHFYLDFIFTAIALAIAAWWGYSHGG-MGGLIATLSITAILAVMEISLSFDNAVVNASV 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+     W+K FLT GILIAVFGMR++FPI+IV + + +  ++ ++LA+  P++Y   + 
Sbjct: 60  LKGWDEFWKKIFLTVGILIAVFGMRLVFPIVIVAVTADLGMMQVIDLALNDPKEYSARLM 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F F+   ++HW  +LE  ++ L K+  + +F+ L ++   
Sbjct: 120 AHHAEISAFGGIFLLLVFLNFIFD-DKEVHWFDWLESRLAKLGKVDAMSVFVALIVLMIA 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD------------SSNNVTHGKHGL 238
            +     +  + + +    I+++ G+  +  +L  D             +      K G+
Sbjct: 179 VSFANPEQSAAVLIAGIWGILVYLGVQVVSGMLEGDLEEELDAQGNSTGAATSAIMKGGI 238

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
             FLYLE++DAS S DGVI +FAIT +  +I++GL IGA++VRSMT+ ++ +G L+++ Y
Sbjct: 239 IGFLYLEVLDASFSFDGVIGAFAITNDVIVIMLGLAIGAMFVRSMTIFLVDKGTLDEFVY 298

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           LEHG++Y+I  L++IM L     +PE+ TG      I  ++ +S+K++
Sbjct: 299 LEHGAHYAIGALAIIMLLSVKFHVPELITGLIGIAFIGWALLASLKHR 346


>gi|15837794|ref|NP_298482.1| hypothetical protein XF1192 [Xylella fastidiosa 9a5c]
 gi|9106162|gb|AAF84002.1|AE003953_6 integral membrane protein [Xylella fastidiosa 9a5c]
          Length = 341

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 122/340 (35%), Positives = 213/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T          G+    T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFTAFCLSLAAWWGY---STALGVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GI IAVFGMR++FPI+IV + + +  I  M LA+  P+ Y +++
Sbjct: 58  ILKHMSEFWRKLFLTIGIFIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSQVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   I + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAIAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM + T+  +PE+ TG     LI  S++SS + +
Sbjct: 298 IGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYR 337


>gi|319899174|ref|YP_004159267.1| hypothetical protein BARCL_1015 [Bartonella clarridgeiae 73]
 gi|319403138|emb|CBI76696.1| conserved membrane protein of unknown function [Bartonella
           clarridgeiae 73]
          Length = 350

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 148/339 (43%), Positives = 218/339 (64%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +L+ +FRW    T+ G   G  IGW  T T+ G +   +IC +L ++EISLSF+N+I+N
Sbjct: 1   MALLGYFRWPFFFTIIGIFWGGLIGWLETGTIVGCLKYFFICCVLGILEISLSFDNSIIN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L  M+ +W++RFLTWGILIAVFGMRI+FP+++V + + INPI A+ LAI+ P  Y  
Sbjct: 61  ARFLGAMNQLWRRRFLTWGILIAVFGMRIVFPLLVVAVSAWINPIAAVKLAIWDPHQYAA 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           I++ AH  I+ FGGTFLMMV L +FF+S+ K+HW+ F+E     L     I I ++L ++
Sbjct: 121 ILTDAHNGIAAFGGTFLMMVGLKYFFDSEKKVHWLVFIEKPAQKLGSFVKIDIIVILMLM 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  +        + +    ++ F  +  + S+L S     +   K G   FLYLE++
Sbjct: 181 LFFSYQIVAENKLIVLLAMLYGLLTFLIVEAICSLLDSQKDTLIAVSKGGAGSFLYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           D+S S DGVI +FA + N FII IGL IGA YVR+MT+++ + G L  Y+YLEHG++Y+I
Sbjct: 241 DSSFSFDGVIGAFAFSHNLFIIAIGLGIGAFYVRAMTIMLFETGTLLHYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL+VIM++Q I+ IPE  TG     +I ++ YSSI+ K
Sbjct: 301 LVLAVIMYMQIIMSIPEALTGLIGVCIIGIAFYSSIRFK 339


>gi|302518790|ref|ZP_07271132.1| integral membrane protein [Streptomyces sp. SPB78]
 gi|302427685|gb|EFK99500.1| integral membrane protein [Streptomyces sp. SPB78]
          Length = 375

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 130/367 (35%), Positives = 208/367 (56%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +TV G +              G  +   +  ILAV+EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFGITVLGLVAAAFY---------GGWTAFGVVAILAVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV + + INP++A++LAI +   Y  ++
Sbjct: 53  ILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVLIVAVTAKINPVDAVDLAINNKDHYQALV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FLMM+ L F F   + + W+ +LE  ++ L K+  + + + L ++  
Sbjct: 113 TDAHPAIAAFGGMFLMMIFLDFIFE-DHDIKWLGWLERPLAKLGKVDMLSVCVALILLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSSD------------- 226
            S  + T          ++  + + S  A +I +  +  L     +              
Sbjct: 172 ASMTVATHAHVHGGGHVDKAETVLLSGIAGLITYLIVGGLSGFFENKLEDEEEREEEREE 231

Query: 227 --------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE+IDAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 EAVKGGTSRSAVALAGKGAFFMFLYLEVIDASFSFDGVIGAFAITNDIILMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           Y+RS+T+ +++QG L+ Y YLEHG++Y+I  LSV++ +    +IPE+ TG    +LI  S
Sbjct: 292 YIRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSVLLLVTIRYEIPEVVTGLIGVVLIAAS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|302562519|ref|ZP_07314861.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302480137|gb|EFL43230.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 366

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 121/366 (33%), Positives = 200/366 (54%), Gaps = 40/366 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  FRWA  VT  G + G+              + + +  ILAV+E+SLSF+NA++NA 
Sbjct: 2   LLKTFRWAFAVTALGLVAGVLY---------DGWTALGLVAILAVLEVSLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+++++ WQ+ FLT GILIAVFGMR++FPI+IV + + + P +A++LA+     Y +++
Sbjct: 53  ILKRLNAFWQRMFLTIGILIAVFGMRLLFPIVIVTVSARLAPSQAVHLALTDKDRYQQLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F    +  W+  LE  ++ L +I  + + + L ++  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIFE-DRETKWLGPLERPLARLGRIDMLSVCLALCVLLV 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN--------- 230
            S               ++  + + S  A +I +  +  L        ++          
Sbjct: 172 TSLTFAAHAHQHGGTHADKAQTVLVSGIAGLITYLVVGGLSGFFEGRLADEESRRQREER 231

Query: 231 -----------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIY 279
                         G+     FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+Y
Sbjct: 232 SGGAGGGGSTLALSGRAAFFTFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAMY 291

Query: 280 VRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSI 339
           VRS+T+ +++QG L+ Y YLEHG++Y+I  L++I+ +     I ++ TG     LI  S 
Sbjct: 292 VRSLTVYLVRQGTLDDYVYLEHGAHYAIGALALILLVSIQYQINDVVTGLIGVTLIGASF 351

Query: 340 YSSIKN 345
           YSS++ 
Sbjct: 352 YSSVRR 357


>gi|28198391|ref|NP_778705.1| integral membrane protein [Xylella fastidiosa Temecula1]
 gi|182681033|ref|YP_001829193.1| hypothetical protein XfasM23_0472 [Xylella fastidiosa M23]
 gi|28056461|gb|AAO28354.1| integral membrane protein [Xylella fastidiosa Temecula1]
 gi|182631143|gb|ACB91919.1| protein of unknown function DUF475 [Xylella fastidiosa M23]
 gi|307579501|gb|ADN63470.1| hypothetical protein XFLM_07800 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 345

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 121/340 (35%), Positives = 212/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T          G+    T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFTAFCLSLAAWWGY---STALGVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GI IAVFGMR++FPI+IV + + +  I  M LA+  P+ Y  ++
Sbjct: 58  ILKHMSEFWRKLFLTIGIFIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSLVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   + + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAMAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM + T+  +PE+ TG     LI  S++SS + +
Sbjct: 298 IGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYR 337


>gi|15807218|ref|NP_295948.1| hypothetical protein DR_2226 [Deinococcus radiodurans R1]
 gi|6460030|gb|AAF11774.1|AE002055_6 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 349

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 135/339 (39%), Positives = 207/339 (61%), Gaps = 5/339 (1%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFT-HTLSGTISTVYICIILAVVEISLSFENAILN 67
           +    F +A LVTV         G+    HTL+   + + I ++L V+EISLSF+NA++N
Sbjct: 3   TFREFFGFATLVTVICLAIAAWDGYARGGHTLAALANALVIAVLLGVLEISLSFDNAVVN 62

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+ MS  WQKRFL WGILIAVFGMR IFPI+IV + S +   E +  A  +P  Y +
Sbjct: 63  ASVLRTMSEKWQKRFLLWGILIAVFGMRFIFPIVIVALTSGLGMGEVIREAFGNPDIYAE 122

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
            + +AHV IS FGG FLMMV L +F +   + HW+  LE  +  + K+  ++  IV +++
Sbjct: 123 HLEKAHVAISAFGGAFLMMVFLKYFMDPDKEEHWLTPLERPLGRIGKLDTVQAVIVGALL 182

Query: 188 FG-ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
                  +   E +  +++    ++++  ++ + ++  +D+         GL  FLYLEI
Sbjct: 183 LILTHLFVAPAEQFQALTAGLVGLLVYLVMDAIGNLFETDNLATKAGA-AGLASFLYLEI 241

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS SLDGVI +FA+TK+  +I  GLTIGAI+VRS+T++M+K+G L  Y++LEHG++Y 
Sbjct: 242 LDASFSLDGVIGAFALTKDIVLIAAGLTIGAIFVRSLTVMMVKKGTLEAYRFLEHGAHYG 301

Query: 307 IFVLSVIMFLQTI--VDIPEIFTGTSSTILIFLSIYSSI 343
           I  L+VIM L     + IPE+ TG      I L++++S+
Sbjct: 302 IGALAVIMLLSMNRDIHIPEVVTGLIGAGFIVLAVWASL 340


>gi|71901122|ref|ZP_00683229.1| Protein of unknown function DUF475 [Xylella fastidiosa Ann-1]
 gi|71729127|gb|EAO31251.1| Protein of unknown function DUF475 [Xylella fastidiosa Ann-1]
          Length = 345

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 122/340 (35%), Positives = 212/340 (62%), Gaps = 6/340 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T          G+    T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFTAFCLSLAAWWGY---STALGVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GILIAVFGMR++FPI+IV + + +  I  M LA+  P+ Y  ++
Sbjct: 58  ILKHMSEFWRKLFLTIGILIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSLVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   + + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAMAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQGDGLMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II+ GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMFGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           I VL+VIM + T+  +PE+ TG     LI  S++SS + +
Sbjct: 298 IGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYR 337


>gi|288922172|ref|ZP_06416373.1| protein of unknown function DUF475 [Frankia sp. EUN1f]
 gi|288346493|gb|EFC80821.1| protein of unknown function DUF475 [Frankia sp. EUN1f]
          Length = 413

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 112/371 (30%), Positives = 195/371 (52%), Gaps = 43/371 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+           +         + G      I  ILAV+EISLSF+NA++NA 
Sbjct: 3   VLRIFGWS---------FAITAIGIAAAGVIGGGDAAAIVAILAVLEISLSFDNAVINAT 53

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L++MS +WQ+ FL+ G++IAVFGMR++FPI+IV + + ++P++  +LA+    +Y   +
Sbjct: 54  ILRRMSEVWQRLFLSLGVIIAVFGMRLLFPIVIVALTAHLSPLDVFDLALNDEAEYAARL 113

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
            +AH  I+ FGG FL M+ L F F+ +  + W+ +LE       +++ + +   L  +  
Sbjct: 114 HEAHPSIAAFGGIFLFMIFLDFMFDPERDIQWLRWLEEPFRKAGQLEVLSVVTGLVALLV 173

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN------------------- 230
           ++     +     +++  A +  + G+  L     +                        
Sbjct: 174 VAEAFSGDHTQQVLTAGVAGLATYLGVRGLGEFFEARGIGADDDEDEDDDAAQSTSAQAT 233

Query: 231 ---------------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI 275
                          +  G+    LFLYLE+IDAS S DGV+ +FAI++N FII  GL I
Sbjct: 234 GSAPAERRTGTPDLVLATGRAAFFLFLYLEVIDASFSFDGVVGAFAISQNIFIIATGLGI 293

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA+Y+RS T+ ++++G L++Y +LEHG++Y+I  L+VI+ +    ++ E+ TG      I
Sbjct: 294 GAMYIRSTTVYLVRRGTLSEYVFLEHGAHYAIGALAVILAVSIETEVHEVVTGLIGVAFI 353

Query: 336 FLSIYSSIKNK 346
            L++ SSI+ +
Sbjct: 354 GLALLSSIRFR 364


>gi|319407522|emb|CBI81170.1| conserved membrane hypothetical protein [Bartonella sp. 1-1C]
          Length = 344

 Score =  209 bits (532), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 153/339 (45%), Positives = 220/339 (64%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +L+ +FRWA   T+ G L G  IGW  T T+ G     +IC +L ++EISLSF+N+I+N
Sbjct: 1   MALLGYFRWAFFFTIIGILGGALIGWLETGTIVGCFKYFFICCVLGILEISLSFDNSIIN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L KM+ +W+ RFLTWGILIAVFGMRIIFP+++V + + INPI A+ LAI+ P  Y  
Sbjct: 61  ARFLGKMNQLWRDRFLTWGILIAVFGMRIIFPLLVVAVAAWINPIAAVQLAIWEPHQYAA 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           I+  AH  I+ FGGTFLMMV L +FF+ + K+HW+ F+E     LS    I I I+L ++
Sbjct: 121 ILMDAHNSIAAFGGTFLMMVGLKYFFDPEKKVHWLTFIEKPAQRLSSFVRIDIIIILILM 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  +      + + +    ++ F  +    S+L S  +  +T  K G  LFLYLE++
Sbjct: 181 LFFSGQIIAENKLTVLLAMLYGLLTFLFVEATCSLLDSQKNTLITVSKGGAGLFLYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGV+ +FA + N FII IGL IGA YVR++T+++ + G L  Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRAITIMLFETGTLLHYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL+VIM+ Q I+ IPE  TG     +I ++ YSS++ K
Sbjct: 301 LVLAVIMYTQIIISIPEALTGLIGICIIGMAFYSSLRFK 339


>gi|318058639|ref|ZP_07977362.1| hypothetical protein SSA3_11895 [Streptomyces sp. SA3_actG]
 gi|318077136|ref|ZP_07984468.1| hypothetical protein SSA3_10533 [Streptomyces sp. SA3_actF]
          Length = 379

 Score =  209 bits (531), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 130/371 (35%), Positives = 208/371 (56%), Gaps = 45/371 (12%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +TV G +              G  +   +  ILAV+EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFGITVLGLVAAAFY---------GGWTAFGVVAILAVLEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV + + INP++A++LAI +   Y  ++
Sbjct: 53  ILKKMNAFWQKIFLTVGVLIAVFGMRLVFPVLIVAVTAKINPVDAVDLAINNKDHYQALV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FLMM+ L F F   + + W+ +LE  ++ L K+  + + + L ++  
Sbjct: 113 TDAHPAIAAFGGMFLMMIFLDFIFE-DHDIKWLGWLERPLAKLGKVDMLSVCVALILLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLSSD------------- 226
            S  + T          ++  + + S  A +I +  +  L     +              
Sbjct: 172 ASMTVATHAHVHGGGHVDKAETVLLSGIAGLITYLIVGGLSGFFENKLEDEEEREEEREE 231

Query: 227 ------------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT 274
                        S     GK    +FLYLE+IDAS S DGVI +FAIT +  ++ +GL 
Sbjct: 232 EREEEAVKGGTSRSAVALAGKGAFFMFLYLEVIDASFSFDGVIGAFAITNDIILMALGLG 291

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA+Y+RS+T+ +++QG L+ Y YLEHG++Y+I  LSV++ +    +IPE+ TG    +L
Sbjct: 292 IGAMYIRSLTVYLVRQGTLDDYVYLEHGAHYAIGALSVLLLVTIRYEIPEVVTGLIGVVL 351

Query: 335 IFLSIYSSIKN 345
           I  S +SS++ 
Sbjct: 352 IAASFWSSVRR 362


>gi|148651893|ref|YP_001278986.1| hypothetical protein PsycPRwf_0076 [Psychrobacter sp. PRwf-1]
 gi|148570977|gb|ABQ93036.1| protein of unknown function DUF475 [Psychrobacter sp. PRwf-1]
          Length = 362

 Score =  209 bits (531), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 124/356 (34%), Positives = 203/356 (57%), Gaps = 22/356 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF +  + T    +     G+     + G IS + I  ILAV+EISLSF+NA++NA  
Sbjct: 1   MRHFYFDFIFTTLALIVAAWWGYSHGG-MGGLISALSITAILAVMEISLSFDNAVVNASV 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+     W+  FLT GILIAVFGMR++FPI+IV + + +  ++ +NLA+Y+P +Y   + 
Sbjct: 60  LKHWDKFWKMIFLTVGILIAVFGMRLVFPIVIVAVTADMGMMDVINLALYNPTEYSAKLM 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F F+    +HW  +LE  ++   ++  + +F+ L+I+   
Sbjct: 120 AHHAEISAFGGMFLLLVFLNFLFD-DKDVHWFDWLERRLAKFGEVDAMSVFVALAILMIS 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSS--------------------DSSNN 230
            + +   +  + + +    I+++ G+  +  +L                        +  
Sbjct: 179 LSWVHEEQTLAVLIAGVWGILVYLGVQVVSGMLEGDLEEAEEALEDGTVANSSNGSGNVG 238

Query: 231 VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQ 290
               K G+  FLYLE++DAS S DGVI +FAIT +  II++GL IGA++VRSMT+ ++++
Sbjct: 239 SAVMKGGIAGFLYLEVLDASFSFDGVIGAFAITNDVIIIMLGLAIGAMFVRSMTIFLVEK 298

Query: 291 GILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           G L+++ YLEHG++Y+I  L+VIM L     +PEI TG      I  ++ +SI+ K
Sbjct: 299 GTLDEFVYLEHGAHYAIGALAVIMLLSMKFHVPEIVTGLIGIAFIAWAVVASIRFK 354


>gi|307822897|ref|ZP_07653127.1| protein of unknown function DUF475 [Methylobacter tundripaludum
           SV96]
 gi|307735672|gb|EFO06519.1| protein of unknown function DUF475 [Methylobacter tundripaludum
           SV96]
          Length = 334

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 133/339 (39%), Positives = 205/339 (60%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HFR +  VT                   G I   +I IIL V+E+SLSF+NA++NA  
Sbjct: 1   MQHFRLSFFVTAVCLAAAFYW---------GGIMGAFIAIILGVLEVSLSFDNAVVNASI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++M   WQK FLTWGILIAVFGMR++FPI+IV   + I+ +    +A+     Y K + 
Sbjct: 52  LKRMDDRWQKYFLTWGILIAVFGMRLLFPIVIVSAATGIDFMGVTEMALKDTATYAKHLD 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
            +HV I+ FGG FL+MV  +F F+   +LHW+ ++E  MS   K++ I+I + L  +  I
Sbjct: 112 ASHVQIAAFGGMFLLMVFYSFIFDETKELHWLGYIEEKMSSFGKLEAIEIIMALGPLLII 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEII 247
            N LP       + +    +I+F  ++ L ++   +           K G+  F+YLE++
Sbjct: 172 QNYLPQEIRLDALVAGVTGVILFVIVDSLAALFEHEEEGEEVVAVLKKSGMMSFIYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT++  II++GL IGA++VRS+T+ ++++G L++Y +LEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAITQDVVIIMLGLAIGAMFVRSLTVYLVRKGTLDEYVFLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL+ IM +     IPE+ TG +  +LI LS+ SSI+ K
Sbjct: 292 GVLAGIMLVSMTHHIPEVITGLTGAVLIALSVISSIRYK 330


>gi|293610616|ref|ZP_06692916.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826960|gb|EFF85325.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 349

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 121/340 (35%), Positives = 190/340 (55%), Gaps = 17/340 (5%)

Query: 23  AGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQK 80
                    G+           +  + I  ILAV+E+SLSF+NA++NA  L+     W+ 
Sbjct: 2   VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKM 61

Query: 81  RFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFG 140
            FLT GILIAVFGMR+IFP+ IV + + +  IE   LA+  P+ Y + +   H  IS FG
Sbjct: 62  LFLTVGILIAVFGMRLIFPVAIVAVTADMGMIEVAKLALNDPKTYSERLMAHHAEISAFG 121

Query: 141 GTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY 200
           GTFL++V L FFF+ + + HW  +LE  +S L+ +  + +FI L  +  ++  +  ++  
Sbjct: 122 GTFLLLVFLNFFFDEEKETHWFRWLEAKLSSLASVPAMSVFIALIAMLIMAANVDESQRL 181

Query: 201 SFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHGKHGLNLFLYLEI 246
               +    I+++ G+  L  +L  +              S       K G+  FLYLE+
Sbjct: 182 VVTMAGIWGIVVYIGVEVLSHMLGGEPEIDEDGNAIMKDGSGAASGVVKAGIGGFLYLEV 241

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+
Sbjct: 242 LDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYA 301

Query: 307 IFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 302 IGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 341


>gi|297160887|gb|ADI10599.1| hypothetical protein SBI_07479 [Streptomyces bingchenggensis BCW-1]
          Length = 386

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 124/371 (33%), Positives = 201/371 (54%), Gaps = 47/371 (12%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  VT AG      +              + I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAVTAAGLALAGVLWGWKG---------LAIVGILSILEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + P+EA++LAI +   Y  ++
Sbjct: 53  VLRKMNAFWQKIFLTVGILIAVFGMRLVFPVIIVAITAKMGPLEAVDLAINNKDKYEHLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F  +  + W+ +LE  ++ L K++ + I + L ++  
Sbjct: 113 TAAHPAIAAFGGMFLLMIFLDFIFE-ERDIKWLGWLERPLAKLGKLETLSIVVALLVLLV 171

Query: 190 ISNILPTNEMY-------SFVSSSTAAIIIFYGINFLESVLSSDSSNNV----------- 231
            +    T+  +       + + +  A ++ +  +  +                       
Sbjct: 172 TAMTFATDVAHGGGDKTATVLLAGVAGLLTYLIVGGISGYFEDKLEEEEEEVEEAEEAER 231

Query: 232 -------------------THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG 272
                                GK    LFLYLE+IDAS S DGVI +FAIT + F + +G
Sbjct: 232 AEKAASGAQKGSQGATVVGLAGKAAFFLFLYLEVIDASFSFDGVIGAFAITNDIFEMALG 291

Query: 273 LTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSST 332
           L IGA+Y+RS+T+ ++++G L+ Y YLEHG++Y+I  L+ I+ +    +I E+ TG    
Sbjct: 292 LGIGAMYIRSLTVYLVRKGTLDDYVYLEHGAHYAIGALAAILLITIKYEIHEVITGLIGI 351

Query: 333 ILIFLSIYSSI 343
           +LI  S +SS+
Sbjct: 352 VLIGASYWSSV 362


>gi|184159802|ref|YP_001848141.1| hypothetical protein ACICU_03485 [Acinetobacter baumannii ACICU]
 gi|183211396|gb|ACC58794.1| uncharacterized protein conserved in bacteria [Acinetobacter
           baumannii ACICU]
          Length = 349

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 118/340 (34%), Positives = 192/340 (56%), Gaps = 17/340 (5%)

Query: 23  AGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQK 80
                    G+           +  + I  ILAV+E+SLSF+NA++NA  L+     W+ 
Sbjct: 2   VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKM 61

Query: 81  RFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFG 140
            FLT GILIAVFGMR+IFP++IV + + +  +E   +A+  P+ Y + +   H  IS FG
Sbjct: 62  IFLTVGILIAVFGMRLIFPVVIVAVTADMGVVEVAKMALNDPKTYSERLMAHHAEISAFG 121

Query: 141 GTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY 200
           GTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  +  ++  +  ++  
Sbjct: 122 GTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIALIVMAGYVDDHQRL 181

Query: 201 SFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHGKHGLNLFLYLEI 246
           +   +    I+++ G+  L  +L  +              S       K GL  FLYLE+
Sbjct: 182 AVTMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASGVVKAGLGGFLYLEV 241

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+
Sbjct: 242 LDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYA 301

Query: 307 IFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 302 IGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 341


>gi|93005600|ref|YP_580037.1| hypothetical protein Pcryo_0770 [Psychrobacter cryohalolentis K5]
 gi|93006611|ref|YP_581048.1| hypothetical protein Pcryo_1787 [Psychrobacter cryohalolentis K5]
 gi|92393278|gb|ABE74553.1| protein of unknown function DUF475 [Psychrobacter cryohalolentis
           K5]
 gi|92394289|gb|ABE75564.1| protein of unknown function DUF475 [Psychrobacter cryohalolentis
           K5]
          Length = 355

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 122/349 (34%), Positives = 206/349 (59%), Gaps = 15/349 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF    + T    +     G+     + G I+T+ I  ILAV+EISLSF+NA++NA  
Sbjct: 1   MRHFYLDFIFTAIALMVAAWWGYSHGG-MGGLITTLSITAILAVMEISLSFDNAVVNASV 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+     W+K FLT GILIAVFGMR++FPI+IV + + +  ++ ++LA+  P++Y   + 
Sbjct: 60  LKGWDEFWKKIFLTVGILIAVFGMRLVFPIVIVAVTADLGMMQVIDLALNDPKEYSARLM 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F F+   ++HW ++LE  ++ L K+  + +F+ L ++   
Sbjct: 120 AHHAEISAFGGIFLLLVFLNFIFD-DKEVHWFNWLESRLAKLGKVDAMSVFVALIVLMFA 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVL-------------SSDSSNNVTHGKHG 237
            +     +  + + +    I+++ G+  +  +L              S ++      K G
Sbjct: 179 VSWASAEQASAVLIAGVWGILVYLGVQVISGMLEGDLEEDLENEEKGSGAAATSAIMKGG 238

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           +  FLYLE++DAS S DGVI +FAIT +  +I++GL IGA++VRSMT+ ++ +G L+++ 
Sbjct: 239 IIGFLYLEVLDASFSFDGVIGAFAITNDVIVIMLGLAIGAMFVRSMTIFLVDKGTLDEFI 298

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           YLEHG++Y+I  L++IM L     +PEI TG      I  ++ +S+K++
Sbjct: 299 YLEHGAHYAIGALAIIMLLSVKFHVPEIITGLIGIAFIGWALLASLKHR 347


>gi|111024984|ref|YP_707404.1| integral membrane protein [Rhodococcus jostii RHA1]
 gi|110823963|gb|ABG99246.1| possible integral membrane protein [Rhodococcus jostii RHA1]
          Length = 389

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 116/371 (31%), Positives = 197/371 (53%), Gaps = 39/371 (10%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
                   ++  F  +  VTV   +              G    V + +IL+++EISLSF
Sbjct: 3   TRERPRFVVLRIFGLSFAVTVISLIIAAIY---------GGPQAVLLVVILSILEISLSF 53

Query: 62  ENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYS 121
           +NA++NA  L++MS  WQK FLT GI+IAVFGMR++FP++IV + S + P+ A++LA+  
Sbjct: 54  DNAVINATVLRRMSEFWQKIFLTVGIVIAVFGMRLVFPLVIVWLASGLGPVAALDLALNP 113

Query: 122 P-----------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMS 170
           P             Y  +++ AH  I+ FGG FL+M+ L F    + ++ W+ +LE  ++
Sbjct: 114 PADGAAYFPDGSASYETLLTDAHPQIAAFGGMFLLMLFLGFILE-EREITWLSWLEKPLA 172

Query: 171 HLSKIKGIKIFIVLSIIFGISNILPTNEMY-SFVSSSTAAIIIFYGINFLESVLSSDSSN 229
              K+  + + I  +++   +  +   +   + + +    ++ +  +N L  + ++   +
Sbjct: 173 RAGKLDQLAVIIAGALLLITAAYIAPEDTVSTVMIAGVLGMVTYIAVNGLGELFNTPEGD 232

Query: 230 ----------------NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
                               GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL
Sbjct: 233 EDGELVEGSKGGPTELAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITSDPIIIALGL 292

Query: 274 TI-GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSST 332
              GA++VRS+T+ ++++G L+ Y YLEHG++++I  L+VI+ +     + E  TG    
Sbjct: 293 GFVGAMFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALAVILLVSIGYHVNENVTGLVGV 352

Query: 333 ILIFLSIYSSI 343
            LI  +  SSI
Sbjct: 353 ALIGAAFISSI 363


>gi|311895883|dbj|BAJ28291.1| hypothetical protein KSE_24770 [Kitasatospora setae KM-6054]
          Length = 360

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 112/354 (31%), Positives = 193/354 (54%), Gaps = 30/354 (8%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
            +  F W+  +T+AG +    I                + +IL+++EISLSF+NA++NA 
Sbjct: 2   FLRTFGWSFAITIAGLIAAGLIWGAEG---------FGVVLILSILEISLSFDNAVVNAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQD 124
            L++M++ WQK FLT G+LIAVFGMR++FP+++V + + ++P   + LA+     +    
Sbjct: 53  VLKRMNAFWQKLFLTVGVLIAVFGMRLVFPLLVVGLTAHLSPGTVIELALDSSKTHDGHT 112

Query: 125 YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL 184
           Y + +  A+  I+ FGG FL+M+ L F F  +   +W+ +LE  +  + K+  +   + L
Sbjct: 113 YAEYLDLANPAIAAFGGIFLLMIFLDFIFE-EKDFNWLRWLEKPLEKIGKLDALSSVVAL 171

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH----------- 233
            ++   S     +   + + +    +  +  +N L  V  S                   
Sbjct: 172 VVLALSSRFFAGDRAETVLLAGICGLATYLAVNGLSEVFESGLEQQQEAEDAAERSGKSI 231

Query: 234 ----GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLK 289
               GK    LF+YLE++DAS S DGV+ +FAI+++ F I +GL IGA+Y+RS+T+ +++
Sbjct: 232 VQVGGKAAFFLFIYLEVLDASFSFDGVVGAFAISQDIFQITLGLGIGAMYIRSLTVFLVR 291

Query: 290 QGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +G L+ Y YLEHG++Y+I  L++I+       IPEI TG      I  ++ +SI
Sbjct: 292 KGTLDDYVYLEHGAHYAIGALALILLASIKYHIPEIVTGLIGVAFIGAALATSI 345


>gi|302557720|ref|ZP_07310062.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302475338|gb|EFL38431.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 371

 Score =  208 bits (530), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 127/367 (34%), Positives = 202/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +  +           G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAVLF---------GGWTAFGIVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV I + + PIEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAISAQLGPIEAVDLALSDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F     + W+ +LE  ++ L K+  + + I L I+  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIFE-DRDIKWLAWLERPLAKLGKVDMLSVCIALVILLI 171

Query: 190 ISNILPTN----------EMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +    TN          +  + + S  A +I +  +  L                    
Sbjct: 172 SAMTFATNAHQHGGGHADKAETVLLSGIAGLITYMIVGGLSGYFEDKLEEEEEREHEEEE 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    +     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 KAERAGKPRTGVALAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L++I+ +     I E+ TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALALILLVTIQYQIHELITGLIGVVLIGAS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|319408838|emb|CBI82495.1| conserved membrane hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 346

 Score =  208 bits (530), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 150/339 (44%), Positives = 225/339 (66%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +L+ +FRWA   T+ G   G  +GW  T +L G +   +IC +L ++EISLSF+N+I+N
Sbjct: 1   MALLGYFRWAFFFTIIGVFGGGFVGWFETGSLIGFLKYFFICCVLGILEISLSFDNSIIN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L KM  +W +RFLTWGILIAVFGMRIIFP++IV   + I+PI A+ LA++ P  Y +
Sbjct: 61  ARILGKMDQLWSRRFLTWGILIAVFGMRIIFPLLIVAFAAWISPIAAVKLALWEPHQYAE 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           I++ AHV I+ FGGTFLMMV L +FF+ + ++HW+ F+E     +    G+ I IVL ++
Sbjct: 121 ILANAHVGIAAFGGTFLMMVGLKYFFDPKKEVHWLAFIEKPAQKVGSFVGVDIAIVLILM 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                 + T    + + +    ++ F  +  + S+L S  +  VT  K G+  FLYLEI+
Sbjct: 181 LFFLGQITTENKLTVLFAMLYGLLTFLVVEAVSSLLDSQKNTLVTIAKGGVGSFLYLEIL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGV+S+FA + N FII IGL IGA YVR++T+++++ G L  Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVMSAFAFSHNLFIIAIGLGIGAFYVRAITIMLVETGTLLHYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL+VIM++Q I+ +PE  TG     ++ ++ YSSI+ K
Sbjct: 301 LVLAVIMYIQIIMPVPEALTGLIGVCILGVAFYSSIRFK 339


>gi|269127400|ref|YP_003300770.1| hypothetical protein Tcur_3191 [Thermomonospora curvata DSM 43183]
 gi|268312358|gb|ACY98732.1| protein of unknown function DUF475 [Thermomonospora curvata DSM
           43183]
          Length = 383

 Score =  208 bits (529), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 120/356 (33%), Positives = 200/356 (56%), Gaps = 33/356 (9%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  +T                 L G  + + +  +LAV+EISLSF+NA++NAK
Sbjct: 2   ILRTFGWSFAITGL---------GLLAALLYGGPAGLALVAVLAVLEISLSFDNAVVNAK 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L++MS+ WQK FLT GI IAVFGMR++FP++IV I + + PIEA +LA   P++Y   +
Sbjct: 53  VLERMSTFWQKIFLTIGIAIAVFGMRLLFPLLIVGITAQMTPIEAFDLAFNDPKEYAHRM 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
            +A+  I+ FGG FLMM+ L F F  +    W+ +LE  ++ + K+  + + +    +  
Sbjct: 113 HEAYPTIAAFGGMFLMMLFLDFVFEERAD-KWLPWLERPLARIGKLDQLSVVVAAGALAL 171

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLS----------------------SDS 227
           ++ +   +     + +    ++ +  +N L  + S                        +
Sbjct: 172 VAGLFAED-TGQVMIAGVLGMVTYILVNGLGELFSQGGEDDGDGEEEVKVPAVKGTTGPN 230

Query: 228 SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLM 287
              +  GK G  LFLYLE++DAS S DGVI +FAI+ +  +I++GL IGA+Y+RS+T+ +
Sbjct: 231 GLVLATGKAGFFLFLYLEVLDASFSFDGVIGAFAISTDPVVIMLGLGIGAMYIRSLTVFL 290

Query: 288 LKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +++G L++Y YLEHG++++I  L+V M +   V +PE  TG     LI  +  SS+
Sbjct: 291 VRKGTLHEYVYLEHGAHWAIGALAVCMLISIAVHVPEAITGGLGAGLIIAAFLSSV 346


>gi|78778040|ref|YP_394355.1| hypothetical protein Suden_1846 [Sulfurimonas denitrificans DSM
           1251]
 gi|78498580|gb|ABB45120.1| Protein of unknown function DUF475 [Sulfurimonas denitrificans DSM
           1251]
          Length = 341

 Score =  208 bits (529), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 128/339 (37%), Positives = 206/339 (60%), Gaps = 4/339 (1%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F+++ + T    L  L  G+      S  +S + + +ILA +E+SLSF+NA++NA  
Sbjct: 1   MSYFKFSFIFTFIALLISLWWGYHLGG-WSSALSMMLVTLILASMEVSLSFDNAVVNASI 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+     W+K FLT GILIAVFGMR++FP++IV   + +  +E  NLA+ +P +Y   + 
Sbjct: 60  LKTWDEYWKKLFLTVGILIAVFGMRLLFPLVIVAQTADMGILEVWNLALDNPVEYSSKLI 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F  + +  +HWI  +E  +  L KI+ I IF+ + ++   
Sbjct: 120 AHHAEISAFGGVFLLLVFLNFMLDEEKNIHWIEIIEKKLGLLGKIEAISIFVSIVVLMFF 179

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN---VTHGKHGLNLFLYLEII 247
           +  +   +  + +++    II++  ++ L  VL  +        T  K  +  FLYLE++
Sbjct: 180 ATFVEEGQKLAVLNAGLWGIIVYVSVDILGFVLEKEDEKKHISSTVKKGSIGGFLYLEVL 239

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAITK+  +I++GL IGA++VRS+T+ ++++G L+ Y YLEHG++Y+I
Sbjct: 240 DASFSFDGVIGAFAITKDIVVIMLGLGIGAMFVRSITIYLVEKGTLDSYIYLEHGAHYAI 299

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            +L+ IM       IPE+FTG      I LS+YSSIK +
Sbjct: 300 GILAFIMLFGMKFHIPELFTGLVGVAFILLSLYSSIKYR 338


>gi|319404526|emb|CBI78131.1| conserved membrane hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 344

 Score =  207 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 152/339 (44%), Positives = 221/339 (65%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +L+ +FRWA   T+ G L G  IGW  T T+ G     +IC +L ++EISLSF+N+I+N
Sbjct: 1   MALLGYFRWAFFFTIIGILGGGLIGWLETGTIVGCFKYFFICCVLGILEISLSFDNSIIN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A+ L KM+ +W+ RFLTWGILIAVFGMRIIFP+++V + + INPI A+ LAI+ P  Y  
Sbjct: 61  ARFLGKMNQLWRHRFLTWGILIAVFGMRIIFPLLVVAVAAWINPIAAVQLAIWEPHQYAA 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           I++  H  I+ FGGTFLMMV L +FF+ + K+HW+ F+E     LS    I I I+L ++
Sbjct: 121 ILTDTHDSIAAFGGTFLMMVGLKYFFDPEKKVHWLTFIEKPAQRLSSFVRIDIIIILILM 180

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
              S  +      + + +    ++ F  +    S+L S  +  +T  K G  LFLYLE++
Sbjct: 181 LFFSGQIVAENKLTVLLAMLYGLLTFLIVEATCSLLDSQKNTLITVSKGGAGLFLYLEVL 240

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGV+ +FA + N FII IGL IGA YVR++T+++ + G L  Y+YLEHG++Y+I
Sbjct: 241 DASFSFDGVVGAFAFSHNLFIIAIGLGIGAFYVRAITIMLFETGTLLHYRYLEHGAFYAI 300

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL+VIM++Q I+ IPE  TG     +I ++ YSS++ K
Sbjct: 301 LVLAVIMYMQIIISIPEALTGLIGICIIGMAFYSSLRFK 339


>gi|111019440|ref|YP_702412.1| integral membrane protein [Rhodococcus jostii RHA1]
 gi|110818970|gb|ABG94254.1| possible integral membrane protein [Rhodococcus jostii RHA1]
          Length = 389

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 116/371 (31%), Positives = 197/371 (53%), Gaps = 39/371 (10%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
                   ++  F  +  VTV   +              G    V + +IL+++EISLSF
Sbjct: 3   TRERPRFVVLRIFGLSFAVTVISLIIAAIY---------GGPQAVLLVVILSILEISLSF 53

Query: 62  ENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYS 121
           +NA++NA  L++MS  WQK FLT GI+IAVFGMR++FP++IV + S + P+ A++LA+  
Sbjct: 54  DNAVINATVLRRMSEFWQKIFLTVGIVIAVFGMRLVFPLVIVWLASGLGPVAALDLALNP 113

Query: 122 P-----------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMS 170
           P             Y  +++ AH  I+ FGG FL+M+ L F    + ++ W+ +LE  ++
Sbjct: 114 PADGAAYFPDGSASYETLLTDAHPQIAAFGGMFLLMLFLGFILE-EREITWLSWLEKPLA 172

Query: 171 HLSKIKGIKIFIVLSIIFGISNILPTNEMY-SFVSSSTAAIIIFYGINFLESVLSSDSSN 229
              K+  + + I  +++   +  +   +   + + +    ++ +  +N L  + ++   +
Sbjct: 173 RAGKLDQLAVIIAGALLLITAAYIAPEDTVSTVMIAGVLGMVTYIAVNGLGELFNTPEGD 232

Query: 230 ----------------NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
                               GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL
Sbjct: 233 EDGELVEGSKGGPTELAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITSDPIIIALGL 292

Query: 274 TI-GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSST 332
              GA++VRS+T+ ++++G L+ Y YLEHG++++I  L+VI+ +     + E  TG    
Sbjct: 293 GFVGAMFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALAVILLVSIGYHVNENVTGLVGV 352

Query: 333 ILIFLSIYSSI 343
            LI  +  SSI
Sbjct: 353 ALIGAAFISSI 363


>gi|226361590|ref|YP_002779368.1| hypothetical protein ROP_21760 [Rhodococcus opacus B4]
 gi|226240075|dbj|BAH50423.1| hypothetical membrane protein [Rhodococcus opacus B4]
          Length = 389

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 115/371 (30%), Positives = 196/371 (52%), Gaps = 39/371 (10%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
                   ++  F  +  VTV   +              G    V + +IL+++EISLSF
Sbjct: 3   TRERPRFVVLRIFGLSFAVTVISIIIAALY---------GGPQAVLLVVILSILEISLSF 53

Query: 62  ENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYS 121
           +NA++NA  L++MS  WQK FLT GI+IAVFGMR++FP++IV + S + P+ A++LA+  
Sbjct: 54  DNAVINATVLRRMSEFWQKIFLTVGIVIAVFGMRLVFPLVIVWLASGLGPVAALDLALNP 113

Query: 122 P-----------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMS 170
           P             Y  +++ AH  I+ FGG FL+M+ L F    + ++ W+ +LE  ++
Sbjct: 114 PADGAAYFPDGSASYETLLTDAHPQIAAFGGMFLLMLFLGFILE-EREITWLSWLEKPLA 172

Query: 171 HLSKIKGIKIFIVLSIIFGISNILPTNEMY-SFVSSSTAAIIIFYGINFLESVLSSDSSN 229
              K+  + + +   ++   +  +   +   + + +    ++ +  +N L  + ++   +
Sbjct: 173 RAGKLDQLAVVVAGVLLLITAAYIAPEDTVSTVMIAGVLGMVTYIAVNGLGELFNTPEED 232

Query: 230 ----------------NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
                               GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL
Sbjct: 233 EDGEPVAGSTGGPTELAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITSDPIIIALGL 292

Query: 274 TI-GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSST 332
              GA++VRS+T+ ++++G L+ Y YLEHG++++I  L+VI+ +     + E  TG    
Sbjct: 293 GFVGAMFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALAVILLVSIGYHVNENVTGLVGV 352

Query: 333 ILIFLSIYSSI 343
            LI  +  SSI
Sbjct: 353 ALIGAAFISSI 363


>gi|257454294|ref|ZP_05619560.1| integral membrane protein [Enhydrobacter aerosaccus SK60]
 gi|257448311|gb|EEV23288.1| integral membrane protein [Enhydrobacter aerosaccus SK60]
          Length = 357

 Score =  206 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 121/350 (34%), Positives = 208/350 (59%), Gaps = 16/350 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF + I+ T          G+     +S  +S +++ +ILAV+EISLSF+NA++NA  
Sbjct: 1   MRHFYFDIVFTTIALAIAAWWGFSHGG-VSTMMSALFVTLILAVMEISLSFDNAVVNASV 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+     W+  FLT G+LIAVFGMR++FPI+IV + + +  ++ +N+A+ +P++Y   + 
Sbjct: 60  LKTWDKFWKMIFLTVGMLIAVFGMRLVFPIVIVAVTADMGMMDVINMALNNPKEYSAKLI 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           + H  I+ FGG FL++V L F F+ + ++ W  +LE  ++   K+  + +F+ L+++   
Sbjct: 120 EHHAEIAAFGGMFLLLVFLNFIFD-EKEVMWFEWLERKLARFGKVDAMSVFVALALLMMA 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN-------------NVTHGKHG 237
              +      + +++    I+I+   N L S+L     +                  K G
Sbjct: 179 LFWVDPARKAAVLTAGVFGILIYLATNVLSSLLEGADDDDESTPDVIEGKEVAGAIAKGG 238

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           +  FLYLE++DAS S DGVI +FAIT +  II++GL IGA++VRSMT+ ++++G L+++ 
Sbjct: 239 IAGFLYLEVLDASFSFDGVIGAFAITNDVIIIMLGLAIGAMFVRSMTIFLVEKGTLDEFV 298

Query: 298 YLEHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSIKNK 346
           YLEHG++Y+I  L+VIM L T+  ++PEI TG      I  ++ +SI  +
Sbjct: 299 YLEHGAHYAIGALAVIMLLATVHIEVPEIVTGLIGIAFIVWAVINSISYR 348


>gi|167589002|ref|ZP_02381390.1| hypothetical protein BuboB_26950 [Burkholderia ubonensis Bu]
          Length = 338

 Score =  206 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 120/334 (35%), Positives = 198/334 (59%), Gaps = 10/334 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F+  + +TV   +    +         G    + I  +L V+EISLS +NA++NA 
Sbjct: 1   MLKDFKIPLSLTVLALVVAYWL---------GGFKDMLIVAVLCVLEISLSLDNAVVNAS 51

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+  S  W+ RF+ +G+ +AVFGMR++FP++IV ++  I   EA+ LAI +P  Y  I+
Sbjct: 52  VLKNWSEKWRNRFMVFGLPVAVFGMRLVFPLLIVAVIGHIGMWEALTLAIDAPDKYAAIL 111

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  +S FGG FL+MV   F  ++    HWI   E  M HL +I  +++ + L+I+  
Sbjct: 112 TSAHHQVSAFGGAFLLMVFFKFMLDTGKDEHWIGIFEGPMRHLGRITALEVALTLAIVII 171

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  +P+ E  SF+ +    +I F   + +  ++           + G+  F+YLE++D+
Sbjct: 172 ASLYVPSAEQVSFLLAGAFGVISFVIAHGIGDLIGG-EDTGSRVVREGVAGFMYLEVLDS 230

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA++ N F+I +GL +GA Y+R MTL++LK+G L +Y+YLEHG++++I  
Sbjct: 231 SFSFDGVIGAFALSNNIFLIALGLGVGAAYIREMTLVLLKKGTLAQYRYLEHGAFWAIGA 290

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L+ IMFL   ++IPE+ TG      I  +++SSI
Sbjct: 291 LAAIMFLGVKLEIPEVVTGLIGAATIGAAVWSSI 324


>gi|269796668|ref|YP_003316123.1| hypothetical protein Sked_33950 [Sanguibacter keddieii DSM 10542]
 gi|269098853|gb|ACZ23289.1| uncharacterized conserved protein [Sanguibacter keddieii DSM 10542]
          Length = 419

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 115/389 (29%), Positives = 203/389 (52%), Gaps = 63/389 (16%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+ ++T    +  L           G    + +C+ILAV+E+SLSF+NA++NAK
Sbjct: 2   ILRTFGWSFVITALALVTALLY---------GGPEALVLCLILAVLEVSLSFDNAVVNAK 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQD 124
            L++MS  WQK FLT G+LIAVFGMR++FP+++V + + + P+EA+ LA+     + P  
Sbjct: 53  VLERMSEAWQKIFLTVGVLIAVFGMRLVFPLLVVSVTAGLGPVEAVRLAMAKGDVHEPGS 112

Query: 125 YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL 184
           Y  I+++AH  I+ F G   +++    F  S+ ++ W+ ++E  ++   K+  + + +  
Sbjct: 113 YGYILAEAHPQIAAF-GGLFLLMLFLDFVFSEREITWLSWIERPLARAGKLANLSVVVAA 171

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSS------------------- 225
             +   S +L  +  ++ + +    +I +  +N L S+                      
Sbjct: 172 IALVLASELLAED-SHTVLLAGVLGMITYLAVNGLGSLFEDSHVLDDDATADGVQEQEPV 230

Query: 226 ---------------------------DSSNNVTHGKHGLNLFLYLEIIDASLSLDGVIS 258
                                       +      GK G  LFLYLE++DAS S DGVI 
Sbjct: 231 ARAAAAGGADVSTDPRAPITSAARPTGPTGLAKATGKAGFFLFLYLEVLDASFSFDGVIG 290

Query: 259 SFAITKNFFIIVIGLTI-GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ 317
           +FAIT +  II +GL   GA++VRS+T+ ++++G L +Y YLEHG++++I  L+ I+ L 
Sbjct: 291 AFAITADPIIIALGLGFIGAMFVRSITIFLVRKGTLAEYVYLEHGAHWAIGALATILLLS 350

Query: 318 TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
               I E+ TG    + I  + +SS++++
Sbjct: 351 IHWHINEVVTGLIGVVFIGAAFWSSVRHR 379


>gi|320334757|ref|YP_004171468.1| hypothetical protein Deima_2163 [Deinococcus maricopensis DSM
           21211]
 gi|319756046|gb|ADV67803.1| protein of unknown function DUF475 [Deinococcus maricopensis DSM
           21211]
          Length = 354

 Score =  206 bits (524), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 139/341 (40%), Positives = 211/341 (61%), Gaps = 5/341 (1%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            SL   F +A +VTV   +     G +    +S  +S   I  IL V+E+SLSF+NA++N
Sbjct: 2   PSLTKEFGFAGIVTVICLVVAALYGLRTGG-VSQALSYFLIAAILGVMELSLSFDNAVVN 60

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+ MS +WQ+RFLTWGILIAVFGMR +FPI+IV +V+ +   E +NLA  +P  Y  
Sbjct: 61  ATVLRNMSEVWQRRFLTWGILIAVFGMRFLFPIVIVAVVAGLGFGEVINLAFTNPPAYAH 120

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV-LSI 186
            + +AH+PIS FGG FLM+V L +  +     HW+  +E  +S L ++  I++FI  + +
Sbjct: 121 HLEEAHIPISAFGGAFLMLVFLKYLIDPDKDTHWLAPIERRLSKLGRLDTIQVFITGVLL 180

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
           +  +   +P+ E +S + +    I+ +  ++ L  +  +D+         G   FLYLE+
Sbjct: 181 LLLVHFAVPSAEKFSALLAGVIGILTYVLVDALGGLFDADNLAADAAKA-GAISFLYLEV 239

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS SLDGVI +FAIT++  +I  GLTIGA++VRS+TL+++ +G L  Y+YLEHG++Y 
Sbjct: 240 LDASFSLDGVIGAFAITQDIVVIAAGLTIGAVFVRSITLMLVHRGTLQAYRYLEHGAHYG 299

Query: 307 IFVLSVIMFLQ--TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           I  L++IM L     V IPE+ TG      I LSI+SS++ 
Sbjct: 300 IGALAIIMLLSMNPNVHIPEVVTGLIGVGFIVLSIWSSLRY 340


>gi|71065324|ref|YP_264051.1| hypothetical protein Psyc_0764 [Psychrobacter arcticus 273-4]
 gi|71038309|gb|AAZ18617.1| uncharacterized transmembrane protein [Psychrobacter arcticus
           273-4]
          Length = 355

 Score =  206 bits (524), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 125/349 (35%), Positives = 206/349 (59%), Gaps = 15/349 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF    + T    +     G+     + G I+T+ I  ILAV+EISLSF+NA++NA  
Sbjct: 1   MRHFYLDFIFTAIALMVAAWWGYSHGG-MGGLITTLSITAILAVMEISLSFDNAVVNASV 59

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+     W+K FLT GILIAVFGMR++FPI+IV + + +  +E +NLA+Y P++Y   + 
Sbjct: 60  LKGWDEFWKKIFLTVGILIAVFGMRLVFPIVIVAVTADLGMMEVINLALYQPEEYSARLM 119

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  IS FGG FL++V L F F+   ++HW H+LE  ++ L K+  + +F+ L ++   
Sbjct: 120 AHHAEISAFGGIFLLLVFLNFIFD-DKEVHWFHWLESRLAKLGKVDAMSVFVALIVLMFA 178

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVL-------------SSDSSNNVTHGKHG 237
            +     +  + + +    I+++ G+  +  +L              S ++      K G
Sbjct: 179 VSWANAEQGSAVLIAGVWGILVYLGVQVISGMLEGDLEEDLENEENGSGAAATSAIMKGG 238

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           +  FLYLE++DAS S DGVI +FAIT +  +I++GL IGA++VRSMT+ ++ +G L+++ 
Sbjct: 239 IIGFLYLEVLDASFSFDGVIGAFAITNDVIVIMLGLAIGAMFVRSMTIFLVDKGTLDEFI 298

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           YLEHG++Y+I  L++IM L     +PE+ TG      I  ++ +S+K +
Sbjct: 299 YLEHGAHYAIGALAIIMLLSVKFHVPELITGLIGIAFIGWALLASLKYR 347


>gi|323519729|gb|ADX94110.1| hypothetical protein ABTW07_3693 [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 349

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 120/340 (35%), Positives = 191/340 (56%), Gaps = 17/340 (5%)

Query: 23  AGFLCGLGIGWQFTHTLS--GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQK 80
                    G+           +  + I  ILAV+E+SLSF+NA++NA  L+     W+ 
Sbjct: 2   VCLALSAYWGFTHGPEAGVSTMLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKM 61

Query: 81  RFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFG 140
            FLT GILIAVFGMR+IFP++IV + + +  IE   +A+  P+ Y + +   H  IS FG
Sbjct: 62  IFLTVGILIAVFGMRLIFPVVIVAVTADMGVIEVAKMALNDPKTYSERLMAHHAEISAFG 121

Query: 141 GTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY 200
           GTFL++V L FFF+ + + HW  +LE  ++ L+ +  + +F+ L  +  ++  +      
Sbjct: 122 GTFLLLVFLNFFFDDEKETHWFRWLESKLASLASVPAMSVFLALIALIVMAAYVDEVHRL 181

Query: 201 SFVSSSTAAIIIFYGINFLESVLSSD--------------SSNNVTHGKHGLNLFLYLEI 246
           + V +    I+++ G+  L  +L  +              S       K GL  FLYLE+
Sbjct: 182 AVVMAGIWGIVVYIGVEVLSHLLGGEPEIDENGNAVLQDGSGAASGVVKAGLGGFLYLEV 241

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT +  +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+
Sbjct: 242 LDASFSFDGVIGAFAITSDVVVIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYA 301

Query: 307 IFVLSVIMFLQ-TIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           I  L+ IM    T V +PE+ TG      I  ++ +SI+ 
Sbjct: 302 IGALAFIMIASGTGVHVPEVVTGLIGVAFIVWAVIASIQY 341


>gi|309811360|ref|ZP_07705147.1| putative membrane protein [Dermacoccus sp. Ellin185]
 gi|308434667|gb|EFP58512.1| putative membrane protein [Dermacoccus sp. Ellin185]
          Length = 379

 Score =  205 bits (521), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 124/371 (33%), Positives = 202/371 (54%), Gaps = 48/371 (12%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +T+AG + G  I         G  S + I  IL V+E+SLSF+NA++NA 
Sbjct: 2   LLKTFGWSAAITIAGLVGGFLI---------GGPSGLAIVAILIVLEVSLSFDNAVVNAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQD 124
            L++M++ WQK FLT GILIAVFGMR++FP++IVC+   + P+EA++LAI      +P  
Sbjct: 53  ILKRMNAFWQKIFLTVGILIAVFGMRLVFPLLIVCLTGHVGPMEAIDLAIKGGDQETPGT 112

Query: 125 YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL 184
           Y  ++  AH  I+ FGG FL+M+ L F F     L W+  +E  ++ + K+  + + + L
Sbjct: 113 YAHMLHDAHPSIAAFGGMFLLMLFLDFVFEK-RDLQWLRPIERPLAKIGKLDQLSVVVAL 171

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD------------------ 226
            ++  +S  L      + + S    ++ +  +  L  +  S                   
Sbjct: 172 LVLAVVSQTLAKEPG-TVLFSGILGLMTYLLVGGLGDLFESQGEDDDDAAAGDDDAERSV 230

Query: 227 --------------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG 272
                              T GK    LF+YLE++DAS S DGVI +FAI+++ FII +G
Sbjct: 231 ATKAGDTAAQAPASKGVGTTAGKAAFFLFMYLEVLDASFSFDGVIGAFAISQDIFIIALG 290

Query: 273 LTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSST 332
           L +GA+++RS+T+ +++QG L+ Y YLEHG+ ++I  L+ I+ +    ++PE+ TG    
Sbjct: 291 LGVGAMWIRSLTVYLVRQGTLDDYAYLEHGAMWAIGALAAILLISIKHEVPEVVTGLIGV 350

Query: 333 ILIFLSIYSSI 343
             I  +  SS+
Sbjct: 351 GFIGAAYLSSL 361


>gi|326563549|gb|EGE13808.1| hypothetical protein E9O_08327 [Moraxella catarrhalis 12P80B1]
          Length = 344

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 124/339 (36%), Positives = 196/339 (57%), Gaps = 20/339 (5%)

Query: 25  FLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLT 84
            +     G+     +S     + I  ILA++EISLSF+NA++NA  L+  +  W+K FLT
Sbjct: 1   MVIAAWWGYSHGG-ISEMFLALGITAILAIMEISLSFDNAVVNASILKGWNDFWKKIFLT 59

Query: 85  WGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFL 144
            GILIAVFGMR+IFPI IV + + +   E ++LA+ +P  Y + ++  H  IS FGG FL
Sbjct: 60  VGILIAVFGMRLIFPIAIVAVTANLGMGEVIHLALNNPVQYAEHLNAHHAEISAFGGMFL 119

Query: 145 MMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVS 204
           ++V L F F     +HW  +LE  +   SK+  + +F+ L ++    + +   +    + 
Sbjct: 120 LLVFLNFMF-GDKDVHWFKWLESRLVKFSKVDAMSVFVALVVLMISMSWVEEAKQGVVMV 178

Query: 205 SSTAAIIIFYGINFLESVLSSDSSNNV------------------THGKHGLNLFLYLEI 246
           +    I+++ G++ L ++L  D  +                    T  K G+  FLYLE+
Sbjct: 179 AGIWGILVYLGVSVLSALLEGDGDDKAAVYDAKGREITNTAGVSSTILKGGIAGFLYLEV 238

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT +  +I+IGL IGA++VRSMT+ ++ +G L+ + YLEHG++Y+
Sbjct: 239 LDASFSFDGVIGAFAITNDVIVIMIGLAIGAMFVRSMTIYLVNKGTLSDFIYLEHGAHYA 298

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           I  L++IM L T   +PEI TG      I LS+++SI+ 
Sbjct: 299 IGALAIIMLLSTRFHVPEIITGLIGVAFIVLSVFNSIQY 337


>gi|54027543|ref|YP_121785.1| hypothetical protein nfa55690 [Nocardia farcinica IFM 10152]
 gi|54019051|dbj|BAD60421.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 373

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 124/358 (34%), Positives = 203/358 (56%), Gaps = 34/358 (9%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F  + LVTVA  +              G  + +++C IL ++E+SLSF+NA++NA 
Sbjct: 2   VLRIFGLSGLVTVASLVVAFLY---------GGPTALFLCAILGILEVSLSFDNAVINAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------- 122
            L++MS  WQK FLT GILIAVFGMR++FP+ IV + + +NP++A++LA+  P       
Sbjct: 53  VLRRMSEFWQKIFLTIGILIAVFGMRLVFPLAIVWVTAGLNPVDALDLALNPPAGDAPYF 112

Query: 123 ----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                 Y  +++ AH  I+ FGG FL M+ L F F    ++ W+ +LE  ++   K+  +
Sbjct: 113 PDGSPSYETLLTDAHPQIAAFGGMFLAMLFLNFIFE-DREITWLSWLERPLARAGKLDML 171

Query: 179 KIFIVLSIIFGISNIL-PTNEMYSFVSSSTAAIIIFYGINFLESVL-----------SSD 226
            + +    +   +  L P ++  + + +    +II+  ++ L S+            S  
Sbjct: 172 AVVVSGVGLVLTAEFLAPDDKRATVLMAGLLGMIIYIAVDGLGSMFHTEELEEEAEKSGP 231

Query: 227 SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTL 285
           S      GK G  LFLYLE++DAS S DGVI +FAIT +  +I +GL  IGA++VRS+T+
Sbjct: 232 SDLAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITSDPILIALGLGLIGAMFVRSITV 291

Query: 286 LMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            ++++G L++Y YLEHG++++I  L+ I+ +   V I EI TG      I  +  SS+
Sbjct: 292 YLVRKGTLSEYVYLEHGAHWAIGALAAILLVSIGVHINEIITGLVGVAFIGAAFISSV 349


>gi|326387901|ref|ZP_08209507.1| hypothetical protein Y88_0816 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207947|gb|EGD58758.1| hypothetical protein Y88_0816 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 345

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 140/339 (41%), Positives = 221/339 (65%), Gaps = 3/339 (0%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F  ++L T+A     L  GW  T ++  T   +++ I+LAV+EISLSF+NA++NA 
Sbjct: 1   MLRQFTGSLLFTIAALFATLAYGWFLTGSVGATAGLIWVVIVLAVLEISLSFDNAVVNAA 60

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +M  IWQ+RFLTWG+L AVFGMRI+FP++IV + + + PI+A+ L++  P  Y +I+
Sbjct: 61  VLSEMDDIWQRRFLTWGMLFAVFGMRILFPLVIVALAAGLGPIDALKLSLTEPARYEQIV 120

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           S AH+ ISGFGG FL +V +T+F N +  +HWI +LE  +  ++ I+  +I ++L  +  
Sbjct: 121 SSAHIAISGFGGAFLALVGMTYFVNPEKTVHWIGWLERHLVAIATIRAAEIALLLVAMSV 180

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV---THGKHGLNLFLYLEI 246
           I+  LP +E   F+ +    I+ F  +  + +VL +            K GL  F+YL +
Sbjct: 181 IARFLPAHEALEFIEAGIGGIVAFVLVEGIGTVLEAREEARRAAGLAMKSGLGGFIYLNV 240

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FA++ N  II IGL++GA++VRS+TLL+++QG LN+Y+YLEHG++++
Sbjct: 241 LDASFSFDGVIGAFALSNNMVIIAIGLSVGAMFVRSITLLLVRQGTLNEYRYLEHGAFWA 300

Query: 307 IFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           I  L  IM L   V++PE  TG     LI +S++SS++ 
Sbjct: 301 IVALGTIMLLSPRVEVPETVTGLIGAALIGVSLWSSLRA 339


>gi|262204555|ref|YP_003275763.1| hypothetical protein Gbro_4752 [Gordonia bronchialis DSM 43247]
 gi|262087902|gb|ACY23870.1| protein of unknown function DUF475 [Gordonia bronchialis DSM 43247]
          Length = 380

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 118/371 (31%), Positives = 199/371 (53%), Gaps = 44/371 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F  + +VT+   +              G    + + +IL ++E+SLSF+NA++NA 
Sbjct: 2   VVRIFGISFVVTIGAMIIAFLY---------GGWQALILTVILGILEVSLSFDNAVINAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------- 122
            L++MS  WQK FLT GILIAVFGMR++FP+ IV + S + P++A++LA+  P       
Sbjct: 53  VLRRMSEFWQKIFLTIGILIAVFGMRLVFPLAIVWMASGLGPVQALDLALNPPPDDAAYF 112

Query: 123 ----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                 Y  II+ AH  I+ FGG FL+M+ L F    + ++ W+ ++E  +  + K++ +
Sbjct: 113 PNGDPSYETIITDAHPQIAAFGGMFLLMLFLGFVLE-EKEITWLSWIERPLERIGKLEML 171

Query: 179 KIFIVLSIIFGISNIL-PTNEMYSFVSSSTAAIIIFYGINFLESVL-------------- 223
           ++ I   ++   +  +    E  + + +    +I +  +N L  +               
Sbjct: 172 EVVIATGLLIITAEYIAAPEERSTVMIAGALGMITYIAVNGLGELFKVDNVVDDEDADPA 231

Query: 224 -------SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-I 275
                     S      GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL  I
Sbjct: 232 PENAKRSGGPSDLAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGLGLI 291

Query: 276 GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILI 335
           GA++VRS+T+ ++++G L++Y YLEHG++++I  L+ I+       + E+ TG    +LI
Sbjct: 292 GAMFVRSLTVYLVRKGTLSEYVYLEHGAHWAIGALAFILLYSIGTHVNEVITGLVGVVLI 351

Query: 336 FLSIYSSIKNK 346
             +  SSI  +
Sbjct: 352 GAAFASSIVRR 362


>gi|117164786|emb|CAJ88335.1| putative integral membrane protein [Streptomyces ambofaciens ATCC
           23877]
          Length = 366

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 123/367 (33%), Positives = 202/367 (55%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  FRWA  VT  G   G+              +   +  ILAV+E+SLSF+NA++NA 
Sbjct: 2   LVKTFRWAFAVTALGLAAGVLY---------EGWTAFGLVAILAVLEVSLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KMS+ WQK FLT GI+IAVFGMR++FP++IV + + ++P  A++LA+   + Y +++
Sbjct: 53  ILKKMSAFWQKIFLTVGIVIAVFGMRLVFPVVIVAVSARLSPWSAVHLALTDKERYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F      ++ W+  LE A++ L K+  + + + L ++  
Sbjct: 113 TDAHPSIAAFGGMFLLMIFLDFVLE-DREIKWLGPLERALAKLGKVDMLSVCVALIVLLV 171

Query: 190 ISNIL----------PTNEMYSFVSSSTAAIIIFYGINFLESVL---------------- 223
            +               ++  + + +    +I +  +  L                    
Sbjct: 172 SAITFGAHAHQHGGIHADKAETVLLAGIGGLITYMVVGGLSGFFEDRLEREEERERDAET 231

Query: 224 -----SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                  + S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 AAARSGGNRSAVALTGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+VI+ +    +I E+ TG    +LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAVILLVTIEYEINEVVTGLIGVVLIGAS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|325518381|gb|EGC98102.1| hypothetical protein B1M_43243 [Burkholderia sp. TJI49]
          Length = 338

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 124/334 (37%), Positives = 202/334 (60%), Gaps = 10/334 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F+  + +TV   +    +         G +  + I  +L+V+EISLS +NA++NA 
Sbjct: 1   MLKDFKIPLSLTVLALVAAYLL---------GGVKDMLIVAVLSVLEISLSLDNAVVNAS 51

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+  S  W+ RF+ +G+ +AVFGMR++FP++IV ++  I   +A+ LAI SP+ Y  ++
Sbjct: 52  VLKNWSEKWRNRFMVFGLPVAVFGMRLVFPLLIVAVIGHIGLWDALRLAIESPEQYAAML 111

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  +S FGG FL+MV   F  +++   HWI FLE  M HL +I  +++ + L II  
Sbjct: 112 TSAHHEVSAFGGAFLLMVFFKFMLDTEKDEHWIGFLEGPMRHLGRITALEVALTLGIIIV 171

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  +P  E  SF+ +    +I F   + +  ++           + GL  FLYLE++D+
Sbjct: 172 ASFYVPGAEQVSFLLAGAFGVIGFVIAHGVGDLVGG-EDTGTRVVREGLAGFLYLEVLDS 230

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA++ N F+I +GL +GA Y+R MTL++LK+G L +Y+YLEHG++++I  
Sbjct: 231 SFSFDGVIGAFALSNNIFLIALGLGVGAAYIREMTLVLLKKGTLAQYRYLEHGAFWAIGA 290

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L+ IMFL    D+PE+ TG     +I  +++SSI
Sbjct: 291 LAAIMFLGVKFDVPEVVTGLVGAAMIGAAVWSSI 324


>gi|134288489|ref|YP_001110652.1| hypothetical protein Bcep1808_6963 [Burkholderia vietnamiensis G4]
 gi|134133139|gb|ABO59849.1| protein of unknown function DUF475 [Burkholderia vietnamiensis G4]
          Length = 340

 Score =  203 bits (515), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 124/334 (37%), Positives = 201/334 (60%), Gaps = 10/334 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F+  + +T+   +    +         G +  + I  +L+V+EISLS +NA++NA 
Sbjct: 1   MLKDFKIPLALTLVALVAAYLM---------GGVKDMIIVGVLSVLEISLSLDNAVVNAS 51

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+  S  WQ RF+ +G+ IAVFGMR++FP++IV I+  I   EA +LA+  P  Y  I+
Sbjct: 52  VLKHWSKKWQDRFMVFGLPIAVFGMRLVFPLLIVAIIGHIGFWEAASLALKDPAQYASIL 111

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  +S FGG FL+MV   F F+S  + HWI F+E AM+ L +I  +++ + L I+  
Sbjct: 112 TSAHHEVSAFGGAFLLMVFFKFMFDSGKEEHWIGFVEQAMARLGRITAVEVALTLGIVVL 171

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  +P  E  +F+ +    +I F   + +  ++           + G+  FLYLE++D+
Sbjct: 172 ASFHVPAQEQIAFLLAGVFGVISFVVAHGIGDLMGG-EDTGTRVVREGVAGFLYLEVLDS 230

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA++ N F+I IGL +GA Y+R MTL++LK+G L  YKYLE G++++I  
Sbjct: 231 SFSFDGVIGAFALSDNVFLIAIGLGVGAAYIREMTLVLLKKGTLASYKYLECGAFWAIGA 290

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L+ IMFL    ++PE+ TG    + I L++++SI
Sbjct: 291 LATIMFLNVKFEVPEVVTGLIGAVTIGLAVWTSI 324


>gi|258653185|ref|YP_003202341.1| hypothetical protein Namu_3015 [Nakamurella multipartita DSM 44233]
 gi|258556410|gb|ACV79352.1| protein of unknown function DUF475 [Nakamurella multipartita DSM
           44233]
          Length = 379

 Score =  202 bits (513), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 119/371 (32%), Positives = 195/371 (52%), Gaps = 48/371 (12%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
             F W+ +VT    +     G           S V +C IL V+E+SLSF+NA++NA  L
Sbjct: 4   KIFMWSYIVTAVSLVVAFVYGSW---------SAVVLCAILGVLEVSLSFDNAVINATIL 54

Query: 72  QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP--------- 122
           ++MS  WQK FLT GI+IAVFGMR++ P++IV   + + P+EA  LA+  P         
Sbjct: 55  ERMSEFWQKMFLTVGIVIAVFGMRLLLPLLIVYFAAGLPPVEAFQLAMNPPADGAAYFPD 114

Query: 123 --QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
               Y  +++ AH  I+ FGG FL+M+ L + F  + +  W+ +LE  ++   ++  + I
Sbjct: 115 GSPSYETLLTDAHPIIAAFGGMFLLMLFLNWLFE-EKEHTWLTWLERPLAKAGRLDSMAI 173

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN---------- 230
            +   ++  +S  L  +   + + +    ++++  +N L +   +               
Sbjct: 174 LVACLLLLVVSETLAEDAE-TVLFAGLLGLVVYLAVNGLGTFFENAEHIGEDDGEARETN 232

Query: 231 ---------------VTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT- 274
                             GK G  LFLYLE++DAS S DGVI +FAIT +  +I +GL  
Sbjct: 233 VDHEPSVAGRNTKLVKAAGKAGFFLFLYLEVLDASFSFDGVIGAFAITSDPILIALGLGL 292

Query: 275 IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTIL 334
           IGA++VRS+T+ ++++G L++Y YLEHG++++I  L+VI+ +   V I E  TG      
Sbjct: 293 IGAMFVRSLTVYLVRKGTLSEYVYLEHGAHWAIGALAVILMISIGVHISEFITGLLGVAF 352

Query: 335 IFLSIYSSIKN 345
           I  +  SSI+ 
Sbjct: 353 IGAAFISSIQR 363


>gi|307324700|ref|ZP_07603906.1| protein of unknown function DUF475 [Streptomyces violaceusniger Tu
           4113]
 gi|306889582|gb|EFN20562.1| protein of unknown function DUF475 [Streptomyces violaceusniger Tu
           4113]
          Length = 397

 Score =  201 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 120/383 (31%), Positives = 202/383 (52%), Gaps = 59/383 (15%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           L+  F W+  +TV G      +              + I  IL+++EISLSF+NA++NA 
Sbjct: 2   LLKTFGWSFAITVIGLALAGVLWGWKG---------LAIVGILSILEISLSFDNAVINAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT G+LIAVFGMR++FP++IV I + ++P++A++LAI +   Y  ++
Sbjct: 53  ILRKMNAFWQKIFLTVGVLIAVFGMRLVFPVIIVAITAKLSPLQAVDLAINNKDKYEHLV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F  +  + W+ +LE  ++ L ++    + + L ++  
Sbjct: 113 TAAHPAIAAFGGMFLLMIFLDFIFE-ERDIRWLGWLEKPLAKLGRLDTFSVVVALVVLLI 171

Query: 190 ISNILPTNEMY-------SFVSSSTAAIIIFYGINFLESVLSSDSSNNV----------- 231
            +  + T+  +       + + +  A ++ +  +  + S                     
Sbjct: 172 SATTVATDVAHGGGDKSSTVLLAGVAGLVTYLIVGGISSYFEDKLEEEEEDDEDEEAAKG 231

Query: 232 -------------------------------THGKHGLNLFLYLEIIDASLSLDGVISSF 260
                                            GK    LFLYLE+IDAS S DGVI +F
Sbjct: 232 ADESGEETKSAANAQLNGSGGRGSSGATVVGLAGKAAFFLFLYLEVIDASFSFDGVIGAF 291

Query: 261 AITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIV 320
           AIT + F + +GL IGA+Y+RS+T+ ++++G L+ Y YLEHG++Y+I  L+ I+ +    
Sbjct: 292 AITNDIFEMALGLGIGAMYIRSLTVFLVRRGTLDDYVYLEHGAHYAIGALAGILLVTIKY 351

Query: 321 DIPEIFTGTSSTILIFLSIYSSI 343
           +I E+ TG    +LI  S +SS+
Sbjct: 352 EINEVITGLVGVVLIGASYWSSV 374


>gi|206560630|ref|YP_002231395.1| hypothetical protein BCAL2269 [Burkholderia cenocepacia J2315]
 gi|198036672|emb|CAR52570.1| putative membrane protein [Burkholderia cenocepacia J2315]
          Length = 330

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 116/303 (38%), Positives = 191/303 (63%), Gaps = 1/303 (0%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G +  + I  +L V+EISLS +NA++NA  L+  S  W+ RF+ +G+ +AVFGMR++FP+
Sbjct: 15  GGVKDMLIVAVLCVLEISLSLDNAVVNASVLKNWSEKWRNRFMVFGLPVAVFGMRLVFPL 74

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV ++  I   +A+ LAI SP  Y  +++ AH  +S FGG FL+MV   F  +++   H
Sbjct: 75  LIVAVIGHIGLWDALTLAIESPDKYAAVLTSAHHEVSAFGGAFLLMVFFKFMLDTEKDEH 134

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLE 220
           WI FLE  M HL +I  +++ + L+I+   S  +P  E  SF+ +    +I F   + + 
Sbjct: 135 WIGFLEGPMRHLGRITALEVALTLAIVIVASFYVPATEQVSFLLAGAFGVIGFVIAHGVG 194

Query: 221 SVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
            ++           + G+  F+YLE++D+S S DGVI +FA++ N F+I +GL +GA Y+
Sbjct: 195 DLVGG-EDTGTRVVREGVAGFMYLEVLDSSFSFDGVIGAFALSNNIFLIALGLGVGAAYI 253

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
           R MTL++LK+G L +Y++LEHG++++I  L+ IMFL    ++PE+ TG     +I  +++
Sbjct: 254 REMTLVLLKKGTLAQYRFLEHGAFWAIGALATIMFLGVKFEVPEVVTGLIGAAMIAAAVW 313

Query: 341 SSI 343
           SSI
Sbjct: 314 SSI 316


>gi|239931533|ref|ZP_04688486.1| hypothetical protein SghaA1_25160 [Streptomyces ghanaensis ATCC
           14672]
 gi|291439909|ref|ZP_06579299.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291342804|gb|EFE69760.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 379

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 123/367 (33%), Positives = 201/367 (54%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F W+  VT  G +              G  +   I  IL+++EISLSF+NA++NA 
Sbjct: 2   VLKTFGWSFAVTALGLVAAFLF---------GGWTAFGIVAILSILEISLSFDNAVVNAG 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+KM++ WQK FLT GILIAVFGMR++FP++IV + + + PIEA++LA+     Y +++
Sbjct: 53  ILKKMNAFWQKIFLTIGILIAVFGMRLVFPVVIVAVSAQLGPIEAVDLALSDKDRYQELV 112

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  I+ FGG FL+M+ L F F    ++ W+ +LE  ++ L K+  + + I L ++  
Sbjct: 113 TDAHPAIAAFGGMFLLMIFLDFIFE-DREIKWLAWLERPLAKLGKVDMLSVCIALIVLLI 171

Query: 190 ISNILPT----------NEMYSFVSSSTAAIIIFYGINFLESVLS--------------- 224
            +    T          ++  + + S  A +I +  +  L                    
Sbjct: 172 SATAFATQAHQHGGTHVDKAETVLLSGIAGLITYLVVGGLSGFFEGKLEEEEEREHEEEE 231

Query: 225 ------SDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                    S     GK    +FLYLE++DAS S DGVI +FAIT +  ++ +GL IGA+
Sbjct: 232 KAAREGKPRSAVALAGKAAFFMFLYLEVLDASFSFDGVIGAFAITNDIVLMALGLGIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           YVRS+T+ +++QG L+ Y YLEHG++Y+I  L+ ++ +    ++ E+ TG     LI  S
Sbjct: 292 YVRSLTVYLVRQGTLDDYVYLEHGAHYAIGALAALLLITIRYEVNELITGFIGVFLIGAS 351

Query: 339 IYSSIKN 345
            +SS++ 
Sbjct: 352 FWSSVRR 358


>gi|325123816|gb|ADY83339.1| putative integral membrane protein [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 327

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 120/319 (37%), Positives = 188/319 (58%), Gaps = 15/319 (4%)

Query: 42  TISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIM 101
            +  + I  ILAV+E+SLSF+NA++NA  L+     W+  FLT GILIAVFGMR+IFP+ 
Sbjct: 1   MLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKMLFLTVGILIAVFGMRLIFPVA 60

Query: 102 IVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHW 161
           IV + + +  IE   LA+  P+ Y + +   H  IS FGGTFL++V L FFF+ + + HW
Sbjct: 61  IVAVTADMGMIEVAKLALNDPKTYSERLMAHHAEISAFGGTFLLLVFLNFFFDEEKETHW 120

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
             +LE  +S L+ +  + +FI L  +  ++  +  ++      +    I+++ G+  L  
Sbjct: 121 FRWLEAKLSSLASVPAMSVFIALIAMLIMAANVDESQRLVVTMAGIWGIVVYIGVEVLSH 180

Query: 222 VLSSD--------------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFF 267
           +L  +              S       K G+  FLYLE++DAS S DGVI +FAIT +  
Sbjct: 181 MLGGEPEIDEDGNAIMKDGSGAASGVVKAGIGGFLYLEVLDASFSFDGVIGAFAITSDVV 240

Query: 268 IIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIF 326
           +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+I  L+ IM    T V +PE+ 
Sbjct: 241 VIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVV 300

Query: 327 TGTSSTILIFLSIYSSIKN 345
           TG      I  ++ +SI+ 
Sbjct: 301 TGLIGVAFIVWAVIASIQY 319


>gi|183985097|ref|YP_001853388.1| hypothetical protein MMAR_5129 [Mycobacterium marinum M]
 gi|183178423|gb|ACC43533.1| conserved hypothetical membrane protein [Mycobacterium marinum M]
          Length = 358

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 117/360 (32%), Positives = 202/360 (56%), Gaps = 34/360 (9%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            + I  F  ++LVT A  + G            G ++ +++ ++LA++EISLSF+NAI+N
Sbjct: 1   MTTIRVFGLSLLVTAAALVAGYW---------HGGVTALFLLVVLAILEISLSFDNAIIN 51

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP----- 122
           A  L++MS  WQ+ FLT GI+IAVFGMR++FP+ IV + + ++P+ AM LA+  P     
Sbjct: 52  ATILKQMSQFWQQMFLTIGIVIAVFGMRLVFPLTIVWVTAGLDPVRAMRLALNPPPGGAL 111

Query: 123 ------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
                   Y K+IS AH  I+ FGG FL+ + L F FN   ++ W+ ++E   + + ++ 
Sbjct: 112 DFPDGSPSYEKLISAAHPQIAAFGGMFLLTLFLDFVFN-DREIKWLKWIEAPFARIGRLG 170

Query: 177 GIKIFIVLSIIFGISNIL--PTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS------- 227
            + + +    +      L   ++++ + + +    ++ +  +N L   L           
Sbjct: 171 QVHVMVACVTLIFAGPGLTDSSDDLGTVMVAGLLGLVTYLVVNGLSRALQPPRVGAGPGE 230

Query: 228 -SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTL 285
            +     GK G  LF+YLE++DAS S DGV  +FAIT +  +I +GL  +GA++VRS+T+
Sbjct: 231 LAAQGAVGKAGFMLFMYLEVLDASFSFDGVTGAFAITSDPIVIALGLGLVGAMFVRSITI 290

Query: 286 LMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD--IPEIFTGTSSTILIFLSIYSSI 343
            +++Q  L++Y YLEHG++++I  L+VIM +       IPE  T +   + I  +  +S+
Sbjct: 291 YLVRQDALDRYVYLEHGAHWAIGALAVIMLMSIDHHLQIPEWITASIGVVFIGAAFTNSV 350


>gi|126643296|ref|YP_001086280.1| hypothetical protein A1S_3289 [Acinetobacter baumannii ATCC 17978]
          Length = 327

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 117/319 (36%), Positives = 190/319 (59%), Gaps = 15/319 (4%)

Query: 42  TISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIM 101
            +  + I  ILAV+E+SLSF+NA++NA  L+     W+  FLT GILIAVFGMR+IFP++
Sbjct: 1   MLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVV 60

Query: 102 IVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHW 161
           IV + + +  IE   +A+  P+ Y + +   H  IS FGGTFL++V L FFF+ + + HW
Sbjct: 61  IVAVTADMGVIEVAKMALNDPKTYSERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHW 120

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
             +LE  ++ L+ +  + +F+ L  +  ++  +  ++  +   +    I+++ G+  L  
Sbjct: 121 FRWLESKLASLASVPAMSVFLALIALIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSH 180

Query: 222 VLSSD--------------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFF 267
           +L  +              +       K GL  FLYLE++DAS S DGVI +FAIT +  
Sbjct: 181 LLGGEPEIDENGNAVLQDGTGAASGVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVV 240

Query: 268 IIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIF 326
           +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+I  L+ IM    T V +PE+ 
Sbjct: 241 VIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVV 300

Query: 327 TGTSSTILIFLSIYSSIKN 345
           TG      I  ++ +SI+ 
Sbjct: 301 TGLIGVAFIVWAVIASIQY 319


>gi|213159028|ref|YP_002321026.1| major facilitator family transporter [Acinetobacter baumannii
           AB0057]
 gi|213058188|gb|ACJ43090.1| major facilitator family transporter [Acinetobacter baumannii
           AB0057]
          Length = 327

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 117/319 (36%), Positives = 190/319 (59%), Gaps = 15/319 (4%)

Query: 42  TISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIM 101
            +  + I  ILAV+E+SLSF+NA++NA  L+     W+  FLT GILIAVFGMR+IFP++
Sbjct: 1   MLKALTITAILAVMEVSLSFDNAVVNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVV 60

Query: 102 IVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHW 161
           IV + + +  +E   +A+  P+ Y + +   H  IS FGGTFL++V L FFF+ + + HW
Sbjct: 61  IVAVTADMGVVEVAKMALNDPKTYSERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHW 120

Query: 162 IHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLES 221
             +LE  ++ L+ +  + +F+ L  +  ++  +  ++  +   +    I+++ G+  L  
Sbjct: 121 FRWLESKLASLASVPAMSVFLALIALIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSH 180

Query: 222 VLSSD--------------SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFF 267
           +L  +              S       K GL  FLYLE++DAS S DGVI +FAIT +  
Sbjct: 181 LLGGEPEIDENGNAVLQDGSGAASGVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVV 240

Query: 268 IIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ-TIVDIPEIF 326
           +I++GL IGAI+VRSMT+ ++++G L+ Y +LEHG++Y+I  L+ IM    T V +PE+ 
Sbjct: 241 VIMLGLAIGAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVV 300

Query: 327 TGTSSTILIFLSIYSSIKN 345
           TG      I  ++ +SI+ 
Sbjct: 301 TGLIGVAFIVWAVIASIQY 319


>gi|91774403|ref|YP_544159.1| hypothetical protein Mfla_0047 [Methylobacillus flagellatus KT]
 gi|91708390|gb|ABE48318.1| protein of unknown function DUF475 [Methylobacillus flagellatus KT]
          Length = 348

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 125/341 (36%), Positives = 203/341 (59%), Gaps = 5/341 (1%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR++  VT          G+Q    L G    + + +IL ++E+SLSF+NA++NA  
Sbjct: 1   MRDFRYSFFVTFLCLGLAALWGYQSKGGLVGIWPALSVALILGIMEVSLSFDNAVVNASI 60

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L++M   W+  FLT GILIAVFG+R++FP+++V   +    ++  ++AI +P  Y   + 
Sbjct: 61  LKEMDEKWRHIFLTVGILIAVFGVRLLFPLLLVAAATDQGLLDVADMAINNPVLYADYLD 120

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
             H  I+ FGG+FL +V L+F  + + +LHW+  LE A   L  ++ IKI ++L I+  +
Sbjct: 121 DGHTAIAAFGGSFLFLVFLSFLLDPEKELHWLGRLEAAFGKLGSLESIKIILILLILLSL 180

Query: 191 SNILP--TNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH---GLNLFLYLE 245
            N LP    E  + + +  + ++++  I+ L    SS +  +         G   FLYLE
Sbjct: 181 QNFLPISQAERLTILLAGLSGVVLYVFIDSLSGFFSSQAEGDAFAKTAKRNGAMGFLYLE 240

Query: 246 IIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYY 305
           I+DAS S DGVI +FAIT++  II++GLTIGA++VRSMT+ ++ +G L+ Y YLEHG++Y
Sbjct: 241 ILDASFSFDGVIGAFAITRDVVIIMLGLTIGAMFVRSMTVRLVYKGTLDNYVYLEHGAHY 300

Query: 306 SIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +I VL ++MF      +PE+ +G    + I  ++ SSI  K
Sbjct: 301 AIGVLGLVMFYTIYRPVPEVVSGLIGVVFIIAALLSSIFYK 341


>gi|296141865|ref|YP_003649108.1| hypothetical protein Tpau_4201 [Tsukamurella paurometabola DSM
           20162]
 gi|296029999|gb|ADG80769.1| protein of unknown function DUF475 [Tsukamurella paurometabola DSM
           20162]
          Length = 364

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 120/357 (33%), Positives = 196/357 (54%), Gaps = 34/357 (9%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F  +I+VT+A  +              G    + +  IL V+EISLSF+NA++NA  
Sbjct: 3   LRTFGLSIVVTIAALIVAFLY---------GGPQALLLTAILGVLEISLSFDNAVINATV 53

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP----QDYL 126
           L++MS  WQK FLT GILIAV GMR++FP+ IV I + ++P+ AM LA+  P      Y 
Sbjct: 54  LRRMSDFWQKMFLTVGILIAVVGMRLLFPLAIVWITAGLDPVHAMRLALNPPTDGSPTYE 113

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
            +++ AH  I+ FGG FL+M+ L F   ++  + W+ ++E  +  + ++  + + I    
Sbjct: 114 SLVTAAHPQIAAFGGIFLLMLFLDFVL-AEKDVTWLSWIEKPLEKIGRLDQLSVVIASGA 172

Query: 187 IFGISNILP-TNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN---------------- 229
           +   +  +    E  + + +    ++ +  +N L  +   D                   
Sbjct: 173 LLYTAMYIAHPGEETTVLVAGLLGMMTYLVVNGLGELFHIDEEAEIADLDAESKPNSGPS 232

Query: 230 --NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLL 286
                 GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL  IGA++VRS+T+ 
Sbjct: 233 ELAKAAGKAGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGLGLIGAMFVRSITVY 292

Query: 287 MLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +++QG L++Y YLEHG++++I  L+VI+       +PE+ TG    +LI  ++ SS+
Sbjct: 293 LVRQGTLSQYVYLEHGAHWAIGALAVILLYSIGTPVPEVVTGLIGLVLIIAALISSV 349


>gi|134296360|ref|YP_001120095.1| hypothetical protein Bcep1808_2261 [Burkholderia vietnamiensis G4]
 gi|134139517|gb|ABO55260.1| protein of unknown function DUF475 [Burkholderia vietnamiensis G4]
          Length = 338

 Score =  199 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 120/334 (35%), Positives = 202/334 (60%), Gaps = 10/334 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F+  + +TV   +    +         G +  + I  +L+V+EISLS +NA++NA 
Sbjct: 1   MLKDFKIPLALTVLALVAAYLL---------GGVKDMLIVAVLSVLEISLSLDNAVVNAS 51

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+  S  W+ RF+ +G+ +AVFGMR++FP++IV ++  I  ++A+ LAI +P+ Y  ++
Sbjct: 52  VLKNWSEKWRNRFMVFGLPVAVFGMRLVFPLLIVAVIGHIGLLDALTLAIEAPEKYAAVL 111

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           + AH  +S FGG FL+MV   F  + +   HWI FLE  M HL +I  +++ + L+I+  
Sbjct: 112 TSAHHEVSAFGGAFLLMVFFKFMLDKEKDEHWIGFLEGPMRHLGRITALEVALTLAIVIV 171

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
            S  +P  E  SF+ +    +I F   + +  ++           + G+  F+YLE++D+
Sbjct: 172 ASFYVPAAEQVSFLLAGAFGVIGFVIAHGVGDLVGG-EDTGTRVVREGVAGFMYLEVLDS 230

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
           S S DGVI +FA++ N F+I +GL +GA Y+R MTL++LK+G L +Y+YLEHG++++I  
Sbjct: 231 SFSFDGVIGAFALSNNIFLIALGLGVGAAYIREMTLVLLKKGTLAQYRYLEHGAFWAIGA 290

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L+ IMF+   +D+PEI TG      I  ++ SSI
Sbjct: 291 LATIMFVGVKLDVPEIVTGLIGAATIAAAVGSSI 324


>gi|118619378|ref|YP_907710.1| hypothetical protein MUL_4205 [Mycobacterium ulcerans Agy99]
 gi|118571488|gb|ABL06239.1| conserved hypothetical membrane protein [Mycobacterium ulcerans
           Agy99]
          Length = 358

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 117/360 (32%), Positives = 200/360 (55%), Gaps = 34/360 (9%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            + I  F  ++LVT A  + G            G ++ +++ ++LA++EISLSF+NAI+N
Sbjct: 1   MTTIRVFGLSLLVTAAALIAGYW---------HGGVTALFLLVVLAILEISLSFDNAIIN 51

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP----- 122
           A  L++MS  WQ+ FLT GI+IAVFGMR++FP+ IV + + ++P+ AM LA+  P     
Sbjct: 52  ATILKQMSQFWQQMFLTIGIVIAVFGMRLVFPLTIVWVTAGLDPVRAMRLALNPPPGGAL 111

Query: 123 ------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
                   Y K+IS AH  I+ FGG FL+ + L F FN   ++ W+ ++E   + + ++ 
Sbjct: 112 DFPDGSPSYEKLISAAHPQIAAFGGMFLLTLFLDFVFN-DREIKWLKWIEAPFARIGRLG 170

Query: 177 GIKIFIVLSIIFGISNILPT--NEMYSFVSSSTAAIIIFYGINFLESVLSSDS------- 227
            + + +    +      L    +++   + +    ++ +  +N L   L           
Sbjct: 171 QVHVMVACVTLIFAGPGLTDSSDDLGIVMVAGLLGLVTYLVVNGLSRALQPPRVGAGPGE 230

Query: 228 -SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTL 285
            +     GK G  LF+YLE++DAS S DGV  +FAIT +  +I +GL  +GA++VRS+T+
Sbjct: 231 LAAQGAVGKAGFMLFMYLEVLDASFSFDGVTGAFAITSDPIVIALGLGLVGAMFVRSITI 290

Query: 286 LMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVD--IPEIFTGTSSTILIFLSIYSSI 343
            +++Q  L++Y YLEHG++++I  L+VIM +       IPE  T +   + I  +  +S+
Sbjct: 291 YLVRQDALDRYVYLEHGAHWAIGALAVIMLMSIDHHLQIPEWITASIGVVFIGAAFTNSV 350


>gi|90409338|ref|ZP_01217428.1| hypothetical protein PCNPT3_06878 [Psychromonas sp. CNPT3]
 gi|90309556|gb|EAS37751.1| hypothetical protein PCNPT3_06878 [Psychromonas sp. CNPT3]
          Length = 344

 Score =  198 bits (504), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 140/340 (41%), Positives = 212/340 (62%), Gaps = 16/340 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR + LVT  G L G  I         G    +++  +L+V+EISLSF+NA++NA  
Sbjct: 4   LRFFRGSFLVTFIGALLGYLI---------GGFEALFLIFVLSVLEISLSFDNAVVNATV 54

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+KM ++W+KRFLTWGILI+VFGMR+IFP+ +V +V+ ++P  A+ +AI SP  Y  ++ 
Sbjct: 55  LKKMDALWRKRFLTWGILISVFGMRVIFPVAVVSVVAGVSPWSAILIAINSPSQYQVLMQ 114

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK-GIKIFIVLSIIFG 189
            AH+ + GFGG+FL++V L FF N     HWI  +E  + H+ K+K    IF VL I+  
Sbjct: 115 SAHISLMGFGGSFLLLVGLDFFLNEDKTEHWIGIIERPLLHIGKLKFSAPIFTVLGILLI 174

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN------NVTHGKHGLNLFLY 243
               LP  + YSF++S  + I+ F  I+ + + +             V   K  L +FLY
Sbjct: 175 AGLYLPDADQYSFIASGASGIVAFTLIHKISAQMEKREDRRASCNGTVVVAKSSLGMFLY 234

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           LE++DAS S DGVI +FAIT N  II  GL IGA++VRS+T++ ++  +L +Y+YL+HG+
Sbjct: 235 LELLDASFSFDGVIGAFAITTNLLIIATGLGIGAMFVRSLTIMFVENNVLEEYQYLQHGA 294

Query: 304 YYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +Y++  L++IMFL+T + +PEI TG      I L+   S+
Sbjct: 295 FYAVIALAIIMFLKTFIHVPEILTGLIGAGFIALAFIHSL 334


>gi|330984164|gb|EGH82267.1| hypothetical protein PLA107_03950 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 342

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 124/339 (36%), Positives = 210/339 (61%), Gaps = 12/339 (3%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + LVT+   +            + G  S  +  +IL V+E+S+S +NA+ NAK 
Sbjct: 1   MRNFWGSALVTLICMI---------GAFIYGGPSAAFAVLILGVLEVSVSLDNAVANAKV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ MS  WQ  FLT GI IAVF +R+I P+ IV + + ++ ++  ++ +  P  Y   + 
Sbjct: 52  LKDMSRFWQMAFLTVGIFIAVFVVRLILPVEIVALAANLSFMDTAHMLVNDPVQYSHHLH 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +AH+ IS FGG FL+MV L F FN + +  W+  +E  ++    + GIK F+ L+++ GI
Sbjct: 112 EAHLSISAFGGMFLLMVFLDFVFNDEKEHFWLGAVEEKLASFGGVDGIKAFVALAVLMGI 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK---HGLNLFLYLEII 247
           +++L   +  +F+ + +  ++IF+ ++ L+++     + +         GL  FLYLE++
Sbjct: 172 ASVLEGAKSATFLYAGSLGLVIFFAMSLLKNLFEEKETGDAVVNTVKKGGLVSFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS SLDGVI +FAI+K+  +I +GLTIGA++VRS+T+ ++K+G L++  YLE G+  +I
Sbjct: 232 DASFSLDGVIGAFAISKDPVVIGMGLTIGAMFVRSLTVYLVKKGTLDELVYLEAGAMCAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            VL++IM     VDIPE+FT     +LI LS++SS+++K
Sbjct: 292 GVLALIMISSGFVDIPELFTALVGAVLIGLSVWSSLRHK 330


>gi|315122332|ref|YP_004062821.1| hypothetical protein CKC_02920 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495734|gb|ADR52333.1| hypothetical protein CKC_02920 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 384

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 249/346 (71%), Positives = 299/346 (86%), Gaps = 1/346 (0%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           MK N     +IHHFRWAILVT+ G L  +GIGW+ +HTLSGT   +YICIILA++EISLS
Sbjct: 1   MKINPFQIDIIHHFRWAILVTIIGILLSIGIGWETSHTLSGTSEILYICIILAIIEISLS 60

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
            +NAILNAKN+QKMS +WQ+RFLTWGI+IAVFGMRI+FPI+IVCIV+TINPIEA+ +AI+
Sbjct: 61  CDNAILNAKNIQKMSPLWQRRFLTWGIVIAVFGMRIVFPIIIVCIVATINPIEAVKIAIF 120

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
           SPQDYLKIIS AH+PI+GFGGTFLMMVSLTFFFN    +HWI+FLEI MS+LS+I+GIK 
Sbjct: 121 SPQDYLKIISDAHIPIAGFGGTFLMMVSLTFFFNRNKNIHWINFLEIPMSYLSRIRGIKF 180

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSS-NNVTHGKHGLN 239
           F+VL +I GIS IL   ++Y  + SST A++ FY INFLES+LS D+   +V   KHGL+
Sbjct: 181 FLVLLLIIGISCILSIRDIYILIFSSTFALMTFYAINFLESILSGDNQTKSVAQKKHGLS 240

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
           LFLYLEIIDASLS DGVISSFAITKNFFII+IGLTIGA+YVRSMT+LMLK+G+L KYKYL
Sbjct: 241 LFLYLEIIDASLSFDGVISSFAITKNFFIIIIGLTIGAVYVRSMTVLMLKKGMLQKYKYL 300

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           EHGS+YSIFVLS++MFLQT++++PEIFTGTSS +LI LSIYSSIKN
Sbjct: 301 EHGSFYSIFVLSIVMFLQTVINVPEIFTGTSSVLLIILSIYSSIKN 346


>gi|34498819|ref|NP_903034.1| hypothetical protein CV_3364 [Chromobacterium violaceum ATCC 12472]
 gi|34104671|gb|AAQ61028.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 370

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 110/340 (32%), Positives = 201/340 (59%), Gaps = 3/340 (0%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            S   +FR +++ +VA        G             +    +LAV+E S+SF+NA++N
Sbjct: 30  PSTFSYFRGSLIFSVAVLAAVAWYGHMRGGAELAGAF-LLTTAVLAVLETSVSFDNAVVN 88

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
           A  L+ MS  W++ F+T GI +AVFGMR++FP++IV     ++  EA  +A   P+ Y +
Sbjct: 89  ATVLKAMSHRWRQVFMTVGIAVAVFGMRVLFPLLIVSTAGGVSLAEAFAVATRQPERYQQ 148

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
           I+  +H+ I GFG TFL+MV + +F   +   HW+  +E  ++ L  ++  +  + + ++
Sbjct: 149 IMHDSHLMIMGFGATFLLMVVIEYFVQHEKDEHWLPGIEPLLAKLGSVENAQSLVTILVV 208

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
             I+ +LP  +  +F+SS     ++F  ++  + +            K+GL  F+YLE++
Sbjct: 209 AAIAALLPAGQKMAFISSCFWGYVVFMVLHMFKQLFGGVDIQT-AAAKNGLIGFVYLEVL 267

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S+DGVI++FAIT +F++I  GL IGA++VRS+TL ++++ +++++KYLE  ++++I
Sbjct: 268 DASFSMDGVIAAFAITNDFWLIAAGLGIGAMFVRSLTLYLVERDVMSQFKYLEVSAFWAI 327

Query: 308 FVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSIKNK 346
             L  IMF   +  ++ E+ TG  S  +I L + +S+ ++
Sbjct: 328 AALVAIMFAAALHVELGEVATGLISVAIIGLGVLTSLPSR 367


>gi|15843241|ref|NP_338278.1| hypothetical protein MT3731 [Mycobacterium tuberculosis CDC1551]
 gi|13883597|gb|AAK48092.1| conserved hypothetical transmembrane protein [Mycobacterium
           tuberculosis CDC1551]
          Length = 374

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 112/367 (30%), Positives = 198/367 (53%), Gaps = 34/367 (9%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
           S+    S    F +++L+TV   + G          L G  + +++  +LA++E+SLSF+
Sbjct: 5   SSEGSMSTFRIFGFSLLMTVVALVTGY---------LHGGPTALFLLAVLALLEVSLSFD 55

Query: 63  NAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP 122
           NAI+NA  LQ+MS  WQ+ FLT GILIAVFGMR++FP+ I+   + ++P+ AM LA+  P
Sbjct: 56  NAIINAAILQRMSPFWQRMFLTIGILIAVFGMRLVFPLAIIWTTAGLDPVRAMELALRPP 115

Query: 123 -----------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSH 171
                        Y K+I+ AH  I+ FGG FL+M+ L F       + W+ ++E+  + 
Sbjct: 116 AHGALEFADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVV-HDRDIKWLKWIEVPFAR 174

Query: 172 LSKIKGIKIFIVL--SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS-- 227
           + ++  + + +     ++ G      +++  + + +    ++ +  +N +          
Sbjct: 175 IGRLGQVPVIVASVGLVLAGALLTHSSDQRGTVLIAGLLGMVTYLVVNGISRAFRPAGLG 234

Query: 228 ------SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG-LTIGAIYV 280
                       GK G  LFLYLE++DA+ S DGV  +FAIT +  II +G   +GA++V
Sbjct: 235 EATPGVQARQAAGKAGCALFLYLEVLDAAFSFDGVTGAFAITTDPIIIALGLGVVGAMFV 294

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLS 338
           RS+T+ +++Q  L++Y YLEHG++++I  L++I+ L       +PE  T +   + I  +
Sbjct: 295 RSITIYLVRQDTLDRYVYLEHGAHWAIGALAIILLLSIDHRFAVPEWVTASVGVVFIGAA 354

Query: 339 IYSSIKN 345
              S++ 
Sbjct: 355 FTESVRR 361


>gi|237749072|ref|ZP_04579552.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229380434|gb|EEO30525.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 336

 Score =  194 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 209/336 (62%), Gaps = 10/336 (2%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +F  + +V VA F+ G  I         G  + +     L V+E++LSF+NA++NA
Sbjct: 3   SYLSYFTSSFIVCVAAFVVGYAI---------GGPAAIATIFFLTVLEVALSFDNAVVNA 53

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+  S IW++ FL WGI +AVFGMR++FP++IVC+   + P EA+N+AIY P +Y +I
Sbjct: 54  GILKHWSHIWRQHFLLWGIFVAVFGMRLVFPLLIVCVAGHMGPAEALNIAIYLPHEYSRI 113

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  ++ FGG FL+MV L+FF       HW+ F+E  ++ L +++ I+  + L  + 
Sbjct: 114 MASAHHEVAAFGGVFLLMVFLSFFVARHKTEHWLAFIEKPLTRLGQMEAIQAALTLITLT 173

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH-GLNLFLYLEII 247
            I+  +  +E + F+ +    ++++     + S+LS        H  H G+  FLYLE+I
Sbjct: 174 AITYFVSPDERFEFLLAGMWGLVVYVLTKGVASLLSPHDQQIEQHIVHQGVGGFLYLELI 233

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGV+ +FA+T N FII +GL  GA++VRS T+L++++G L+ Y+YLEHG++++I
Sbjct: 234 DASFSFDGVLGAFAMTNNLFIIALGLGAGAMFVRSFTILLVEKGTLSHYRYLEHGAFWAI 293

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+++M L  +  +PE  TG    +LI  ++ SSI
Sbjct: 294 GSLALLMLLGVLFPVPEAITGLLGALLIIAALGSSI 329


>gi|15610765|ref|NP_218146.1| hypothetical protein Rv3629c [Mycobacterium tuberculosis H37Rv]
 gi|31794799|ref|NP_857292.1| hypothetical protein Mb3653c [Mycobacterium bovis AF2122/97]
 gi|121639542|ref|YP_979766.1| hypothetical protein BCG_3687c [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|148663492|ref|YP_001285015.1| hypothetical protein MRA_3665 [Mycobacterium tuberculosis H37Ra]
 gi|148824833|ref|YP_001289587.1| integral membrane protein [Mycobacterium tuberculosis F11]
 gi|167968548|ref|ZP_02550825.1| hypothetical protein MtubH3_11131 [Mycobacterium tuberculosis
           H37Ra]
 gi|215413549|ref|ZP_03422221.1| integral membrane protein [Mycobacterium tuberculosis 94_M4241A]
 gi|215424871|ref|ZP_03422790.1| integral membrane protein [Mycobacterium tuberculosis T92]
 gi|215432600|ref|ZP_03430519.1| integral membrane protein [Mycobacterium tuberculosis EAS054]
 gi|215447966|ref|ZP_03434718.1| integral membrane protein [Mycobacterium tuberculosis T85]
 gi|218755407|ref|ZP_03534203.1| integral membrane protein [Mycobacterium tuberculosis GM 1503]
 gi|219559700|ref|ZP_03538776.1| integral membrane protein [Mycobacterium tuberculosis T17]
 gi|224992039|ref|YP_002646728.1| putative integral membrane protein [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|253800667|ref|YP_003033668.1| hypothetical protein TBMG_03666 [Mycobacterium tuberculosis KZN
           1435]
 gi|254233127|ref|ZP_04926453.1| hypothetical protein TBCG_03552 [Mycobacterium tuberculosis C]
 gi|254366181|ref|ZP_04982225.1| conserved integral membrane protein [Mycobacterium tuberculosis
           str. Haarlem]
 gi|254552741|ref|ZP_05143188.1| hypothetical protein Mtube_20215 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260184546|ref|ZP_05762020.1| hypothetical protein MtubCP_00610 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260198668|ref|ZP_05766159.1| hypothetical protein MtubT4_00630 [Mycobacterium tuberculosis T46]
 gi|260202812|ref|ZP_05770303.1| hypothetical protein MtubK8_00645 [Mycobacterium tuberculosis K85]
 gi|289441058|ref|ZP_06430802.1| conserved membrane protein [Mycobacterium tuberculosis T46]
 gi|289445222|ref|ZP_06434966.1| conserved membrane protein [Mycobacterium tuberculosis CPHL_A]
 gi|289555888|ref|ZP_06445098.1| conserved membrane protein [Mycobacterium tuberculosis KZN 605]
 gi|289571865|ref|ZP_06452092.1| conserved membrane protein [Mycobacterium tuberculosis T17]
 gi|289572276|ref|ZP_06452503.1| integral membrane protein [Mycobacterium tuberculosis K85]
 gi|289748143|ref|ZP_06507521.1| conserved membrane protein [Mycobacterium tuberculosis T92]
 gi|289755756|ref|ZP_06515134.1| integral membrane protein [Mycobacterium tuberculosis EAS054]
 gi|289759787|ref|ZP_06519165.1| integral membrane protein [Mycobacterium tuberculosis T85]
 gi|289763805|ref|ZP_06523183.1| conserved integral membrane protein [Mycobacterium tuberculosis GM
           1503]
 gi|294995461|ref|ZP_06801152.1| hypothetical protein Mtub2_13345 [Mycobacterium tuberculosis 210]
 gi|297636301|ref|ZP_06954081.1| hypothetical protein MtubK4_19345 [Mycobacterium tuberculosis KZN
           4207]
 gi|297733295|ref|ZP_06962413.1| hypothetical protein MtubKR_19485 [Mycobacterium tuberculosis KZN
           R506]
 gi|298527105|ref|ZP_07014514.1| conserved integral membrane protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306777982|ref|ZP_07416319.1| conserved membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|306778513|ref|ZP_07416850.1| conserved membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|306786535|ref|ZP_07424857.1| conserved membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|306790902|ref|ZP_07429224.1| conserved membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|306791222|ref|ZP_07429524.1| conserved membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|306796008|ref|ZP_07434310.1| conserved membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|306801255|ref|ZP_07437923.1| conserved membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|306805469|ref|ZP_07442137.1| conserved membrane protein [Mycobacterium tuberculosis SUMu007]
 gi|306969761|ref|ZP_07482422.1| conserved membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|306974100|ref|ZP_07486761.1| conserved membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|307081808|ref|ZP_07490978.1| conserved membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|307086423|ref|ZP_07495536.1| conserved membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|313660626|ref|ZP_07817506.1| hypothetical protein MtubKV_19480 [Mycobacterium tuberculosis KZN
           V2475]
 gi|2105065|emb|CAB08828.1| PROBABLE CONSERVED INTEGRAL MEMBRANE PROTEIN [Mycobacterium
           tuberculosis H37Rv]
 gi|31620396|emb|CAD95839.1| PROBABLE CONSERVED INTEGRAL MEMBRANE PROTEIN [Mycobacterium bovis
           AF2122/97]
 gi|121495190|emb|CAL73676.1| Probable conserved integral membrane protein [Mycobacterium bovis
           BCG str. Pasteur 1173P2]
 gi|124602920|gb|EAY61195.1| hypothetical protein TBCG_03552 [Mycobacterium tuberculosis C]
 gi|134151693|gb|EBA43738.1| conserved integral membrane protein [Mycobacterium tuberculosis
           str. Haarlem]
 gi|148507644|gb|ABQ75453.1| putative conserved integral membrane protein [Mycobacterium
           tuberculosis H37Ra]
 gi|148723360|gb|ABR07985.1| conserved integral membrane protein [Mycobacterium tuberculosis
           F11]
 gi|224775154|dbj|BAH27960.1| putative integral membrane protein [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|253322170|gb|ACT26773.1| conserved membrane protein [Mycobacterium tuberculosis KZN 1435]
 gi|289413977|gb|EFD11217.1| conserved membrane protein [Mycobacterium tuberculosis T46]
 gi|289418180|gb|EFD15381.1| conserved membrane protein [Mycobacterium tuberculosis CPHL_A]
 gi|289440520|gb|EFD23013.1| conserved membrane protein [Mycobacterium tuberculosis KZN 605]
 gi|289536707|gb|EFD41285.1| integral membrane protein [Mycobacterium tuberculosis K85]
 gi|289545619|gb|EFD49267.1| conserved membrane protein [Mycobacterium tuberculosis T17]
 gi|289688730|gb|EFD56159.1| conserved membrane protein [Mycobacterium tuberculosis T92]
 gi|289696343|gb|EFD63772.1| integral membrane protein [Mycobacterium tuberculosis EAS054]
 gi|289711311|gb|EFD75327.1| conserved integral membrane protein [Mycobacterium tuberculosis GM
           1503]
 gi|289715351|gb|EFD79363.1| integral membrane protein [Mycobacterium tuberculosis T85]
 gi|298496899|gb|EFI32193.1| conserved integral membrane protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308213696|gb|EFO73095.1| conserved membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|308328450|gb|EFP17301.1| conserved membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|308328859|gb|EFP17710.1| conserved membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|308332700|gb|EFP21551.1| conserved membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|308340193|gb|EFP29044.1| conserved membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|308343480|gb|EFP32331.1| conserved membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|308347978|gb|EFP36829.1| conserved membrane protein [Mycobacterium tuberculosis SUMu007]
 gi|308351920|gb|EFP40771.1| conserved membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|308352679|gb|EFP41530.1| conserved membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|308356554|gb|EFP45405.1| conserved membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|308360512|gb|EFP49363.1| conserved membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|308364127|gb|EFP52978.1| conserved membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|323717679|gb|EGB26880.1| membrane protein [Mycobacterium tuberculosis CDC1551A]
 gi|326905464|gb|EGE52397.1| conserved membrane protein [Mycobacterium tuberculosis W-148]
 gi|328460397|gb|AEB05820.1| conserved membrane protein [Mycobacterium tuberculosis KZN 4207]
          Length = 365

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 111/362 (30%), Positives = 196/362 (54%), Gaps = 34/362 (9%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            S    F +++L+TV   + G          L G  + +++  +LA++E+SLSF+NAI+N
Sbjct: 1   MSTFRIFGFSLLMTVVALVTGY---------LHGGPTALFLLAVLALLEVSLSFDNAIIN 51

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP----- 122
           A  LQ+MS  WQ+ FLT GILIAVFGMR++FP+ I+   + ++P+ AM LA+  P     
Sbjct: 52  AAILQRMSPFWQRMFLTIGILIAVFGMRLVFPLAIIWTTAGLDPVRAMELALRPPAHGAL 111

Query: 123 ------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
                   Y K+I+ AH  I+ FGG FL+M+ L F       + W+ ++E+  + + ++ 
Sbjct: 112 EFADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVV-HDRDIKWLKWIEVPFARIGRLG 170

Query: 177 GIKIFIVL--SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS------- 227
            + + +     ++ G      +++  + + +    ++ +  +N +               
Sbjct: 171 QVPVIVASVGLVLAGALLTHSSDQRGTVLIAGLLGMVTYLVVNGISRAFRPAGLGEATPG 230

Query: 228 -SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG-LTIGAIYVRSMTL 285
                  GK G  LFLYLE++DA+ S DGV  +FAIT +  II +G   +GA++VRS+T+
Sbjct: 231 VQARQAAGKAGCALFLYLEVLDAAFSFDGVTGAFAITTDPIIIALGLGVVGAMFVRSITI 290

Query: 286 LMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSI 343
            +++Q  L++Y YLEHG++++I  L++I+ L       +PE  T +   + I  +   S+
Sbjct: 291 YLVRQDTLDRYVYLEHGAHWAIGALAIILLLSIDHRFAVPEWVTASVGVVFIGAAFTESV 350

Query: 344 KN 345
           + 
Sbjct: 351 RR 352


>gi|254374161|ref|ZP_04989643.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151571881|gb|EDN37535.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 340

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 126/336 (37%), Positives = 196/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSFFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +M   WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMPPKWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM--SHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  +    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYSDPNYQGSLAIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ I+ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAILLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|215405677|ref|ZP_03417858.1| integral membrane protein [Mycobacterium tuberculosis 02_1987]
 gi|289747465|ref|ZP_06506843.1| integral membrane protein [Mycobacterium tuberculosis 02_1987]
 gi|289687993|gb|EFD55481.1| integral membrane protein [Mycobacterium tuberculosis 02_1987]
          Length = 365

 Score =  193 bits (489), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 111/362 (30%), Positives = 196/362 (54%), Gaps = 34/362 (9%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            S    F +++L+TV   + G          L G  + +++  +LA++E+SLSF+NAI+N
Sbjct: 1   MSTFRIFGFSLLMTVVALVTGY---------LHGGPTALFLLAVLALLEVSLSFDNAIIN 51

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP----- 122
           A  LQ+MS  WQ+ FLT GILIAVFGMR++FP+ I+   + ++P+ AM LA+  P     
Sbjct: 52  AAILQRMSPFWQRMFLTIGILIAVFGMRLVFPLAIIWTTAGLDPVRAMELALRPPAHGAL 111

Query: 123 ------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
                   Y K+I+ AH  I+ FGG FL+M+ L F       + W+ ++E+  + + ++ 
Sbjct: 112 EFADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVV-HDRDIKWLKWIEVPFARIGRLG 170

Query: 177 GIKIFIVL--SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS------- 227
            + + +     ++ G      +++  + + +    ++ +  +N +               
Sbjct: 171 QVPVIVASVGLVLAGALLTHSSDQRGTVLIAGLLGMVTYLVVNGISRAFRPAGLGEATPG 230

Query: 228 -SNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG-LTIGAIYVRSMTL 285
                  GK G  LFLYLE++DA+ S DGV  +FAIT +  II +G   +GA++VRS+T+
Sbjct: 231 VQARQAAGKAGCALFLYLEVLDAAFSFDGVTGAFAITTDPIIIALGLGVVGAMFVRSITI 290

Query: 286 LMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSI 343
            +++Q  L++Y YLEHG++++I  L++I+ L       +PE  T +   + I  +   S+
Sbjct: 291 CLVRQDTLDRYVYLEHGAHWAIGALAIILLLSIDHRFAVPEWVTASVGVVFIGAAFTESV 350

Query: 344 KN 345
           + 
Sbjct: 351 RR 352


>gi|237746918|ref|ZP_04577398.1| predicted protein [Oxalobacter formigenes HOxBLS]
 gi|229378269|gb|EEO28360.1| predicted protein [Oxalobacter formigenes HOxBLS]
          Length = 336

 Score =  193 bits (489), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 132/336 (39%), Positives = 209/336 (62%), Gaps = 10/336 (2%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +F  + +V +   + G  I         G  + V     L V+E++LSF+NA++NA
Sbjct: 3   SHLSYFTTSFIVCLLALIAGFII---------GGTAAVATIFFLTVLEVALSFDNAVVNA 53

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+  + +W++ FL WGI IAVFGMR++FP+ IV +V+ INPIEA+N+A+Y P+ Y ++
Sbjct: 54  GVLKNWNHLWRQHFLIWGIFIAVFGMRLVFPLAIVSVVAHINPIEAVNVALYRPEIYSRL 113

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  ++ FGG FLMMV L+FF       HW+ F+E  ++ L +++ I+  + L  + 
Sbjct: 114 MAAAHHQVAAFGGVFLMMVFLSFFVARHKTEHWLAFIEKPLTRLGQMEAIQAALTLITLT 173

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH-GLNLFLYLEII 247
             S  +  +E + F+ +    +I++     + S+LS   ++   H  H G+  FLYLE+I
Sbjct: 174 MFSYFVSQSERFEFLLAGMWGLIVYVLTKGIASLLSPHDAHIEQHVVHQGVGGFLYLELI 233

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGV+ +FA+T N FII +GL  GA++VRS T+L++++G LN Y+YLEHG++++I
Sbjct: 234 DASFSFDGVLGAFAMTNNLFIIALGLGAGAMFVRSFTVLLVEKGTLNHYRYLEHGAFWAI 293

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ +M L  I  IPE  TG    ILI  S+ SSI
Sbjct: 294 GSLAFLMLLGVIFAIPEAITGLLGAILILASLGSSI 329


>gi|262202415|ref|YP_003273623.1| hypothetical protein Gbro_2489 [Gordonia bronchialis DSM 43247]
 gi|262085762|gb|ACY21730.1| protein of unknown function DUF475 [Gordonia bronchialis DSM 43247]
          Length = 374

 Score =  191 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 116/367 (31%), Positives = 193/367 (52%), Gaps = 41/367 (11%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
            I  F  + +VT+                     + + +C IL V+E+SLSF+NA++NA 
Sbjct: 2   TIRIFGLSAVVTLLALAVAF---------AYRGWTGLALCAILGVLEVSLSFDNAVINAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------- 122
            L++MS  WQ+ FLT G++IAVFGMR+ FP+ IV + + ++P +A  LA+  P       
Sbjct: 53  ILERMSEFWQRMFLTVGVIIAVFGMRLFFPLAIVWVTAGLDPADAFRLAMNPPADGSEYF 112

Query: 123 ----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                 Y  I+  A+  I+ FGG F +++    F  S  +  W+ + E  ++ L K+  +
Sbjct: 113 ADGSPSYETILHDANPQIAAFGGMF-LLLLFLNFVLSDRENTWLTWFERPLAALGKLDQL 171

Query: 179 KIFIVLSIIFGISNILP-TNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN-------- 229
            + I  + +  ++  L   ++  + + +    II +  ++ L S+ +    +        
Sbjct: 172 AVVIAAAALLAVAQFLAAEDKRATVLVAGLLGIITYILVDGLSSLFAGQGHDRAAGSGDG 231

Query: 230 ----------NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI-GAI 278
                         GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL   GA+
Sbjct: 232 SGGATGPTAVTRATGKAGFFLFLYLEVLDASFSFDGVIGAFAITPDPIIIALGLGFIGAM 291

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
           +VRS+T+ ++++G L +Y+YLEHG++++I  L+VI+     V IPEI TG      I  +
Sbjct: 292 FVRSITIFLVRKGTLAEYRYLEHGAHWAIGALAVILLTSVKVHIPEIITGLIGVAFIGAA 351

Query: 339 IYSSIKN 345
           + SSI+ 
Sbjct: 352 LLSSIRA 358


>gi|257461093|ref|ZP_05626191.1| integral membrane protein [Campylobacter gracilis RM3268]
 gi|257441467|gb|EEV16612.1| integral membrane protein [Campylobacter gracilis RM3268]
          Length = 336

 Score =  191 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 126/335 (37%), Positives = 196/335 (58%), Gaps = 16/335 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  +  V+    +    I         G     YIC++L V+EISLSF+NA++NAK 
Sbjct: 1   MKYFYSSFAVSFIAVIIAFYI---------GGAGAAYICVLLCVLEISLSFDNAVVNAKV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M+ +WQ RF+ WGI IAVFGMR +FP++IV   + +   E + LA+  PQ Y +I+S
Sbjct: 52  LKDMAPVWQSRFILWGIPIAVFGMRFLFPVLIVAASAHLGLWETLVLALKQPQRYHEILS 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +    I  FGG FL+MV   FFF++Q +LHW+  +E     +  +K I     L  +   
Sbjct: 112 ENEAQIYVFGGAFLLMVFCDFFFDAQRELHWLGIIENN-GLVRFLKRIPNAPTLIALAAG 170

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
             +L      +  ++   AI+++  I+  + +  +D        K+GL  FLYLE +DAS
Sbjct: 171 LVLLAKTGSATLGAAYFGAILLYLLISCFDRLFGTDG------VKNGLAGFLYLETLDAS 224

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA++ N FII++GL  GA++VRS+TL ++ +G L+ + YLEHG++Y+I  L
Sbjct: 225 FSFDGVIGAFALSDNIFIIMLGLGAGAMFVRSITLYLIARGTLSHFAYLEHGAHYAIACL 284

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + IMF +   ++ EI TGT   + I LS+ SS+  
Sbjct: 285 AFIMFAKLKFEVSEIITGTVGILFIALSLLSSVLY 319


>gi|115315063|ref|YP_763786.1| hypothetical protein FTH_1307 [Francisella tularensis subsp.
           holarctica OSU18]
 gi|115129962|gb|ABI83149.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
          Length = 340

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 198/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  ++ VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSLFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM--SHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  +    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYSDPNYQGSLDIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ I+ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAILLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|229489797|ref|ZP_04383654.1| integral membrane protein [Rhodococcus erythropolis SK121]
 gi|229323307|gb|EEN89071.1| integral membrane protein [Rhodococcus erythropolis SK121]
          Length = 373

 Score =  189 bits (481), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 120/361 (33%), Positives = 200/361 (55%), Gaps = 37/361 (10%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F  +I +++   +              G    +++ IIL+++EISLSF+NA++NA 
Sbjct: 2   VLRIFGLSIAISILAMIVAFIY---------GGPEALFLVIILSILEISLSFDNAVINAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP------- 122
            LQ+MS  WQK FLT G++IAVFGMR++FP++IV   S + P+ A++LA+  P       
Sbjct: 53  VLQRMSEFWQKIFLTIGVIIAVFGMRLVFPLVIVWAASGLGPVAALDLALNPPADDAAYF 112

Query: 123 ----QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                 Y  I++ AH  I+ FGG FL+M+ L F F  + ++ W+ +LE  ++ + K+  +
Sbjct: 113 ANGEPSYETILTDAHPQIAAFGGMFLLMLFLGFIFE-EREITWLSWLEKPLARIGKLDQL 171

Query: 179 KIFIVLSIIFGISNILPTNEMY-SFVSSSTAAIIIFYGINFLESVL-------------- 223
            + +   ++    + L  ++   + + S    +I +  +N L  +               
Sbjct: 172 SVVVAGIVLVLSGSFLAADDKVSTVMISGVLGMITYIAVNGLGELFNLPEEGEEEETAKS 231

Query: 224 SSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTI-GAIYVRS 282
              +      GK G  LFLYLE++DAS S DGVI +FAIT +  II +GL   GA++VRS
Sbjct: 232 GGPTQLAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGLGFVGAMFVRS 291

Query: 283 MTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           +T+ ++++G L+ Y YLEHG++++I  L+VI+ +   V I EI TG     LI  +  SS
Sbjct: 292 ITVFLVRKGTLSDYVYLEHGAHWAIGALAVILMVSIGVHINEIITGLVGVFLIGAAFISS 351

Query: 343 I 343
           +
Sbjct: 352 L 352


>gi|332184185|gb|AEE26439.1| hypothetical protein FN3523_1136 [Francisella cf. novicida 3523]
          Length = 340

 Score =  189 bits (481), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 194/336 (57%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  F  +  +T+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKFFYGSFFITIIGVVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +M   WQK F+  G+ IAVFGMR+IFPI++V + S IN I  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMPPKWQKIFIYIGLPIAVFGMRLIFPILLVSVTSGINFINVITLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM--SHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  +    +    G  I   + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNVVTKKIRNYDGGYILFAIIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
               +    N   +   +    II+   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIHYADPNYQGNLAIAFLLGIIVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ I+ L+    IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAILLLKIFTHIPEWFSGSIGILVLSLAFIHSV 332


>gi|89256645|ref|YP_514007.1| hypothetical protein FTL_1342 [Francisella tularensis subsp.
           holarctica LVS]
 gi|169656661|ref|YP_001428851.2| hypothetical protein FTA_1421 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|254367959|ref|ZP_04983979.1| hypothetical protein FTHG_01262 [Francisella tularensis subsp.
           holarctica 257]
 gi|290953536|ref|ZP_06558157.1| hypothetical protein FtulhU_04179 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313140|ref|ZP_06803822.1| hypothetical protein FtulhU_04164 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89144476|emb|CAJ79781.1| conserved hypothetical membrane protein [Francisella tularensis
           subsp. holarctica LVS]
 gi|134253769|gb|EBA52863.1| hypothetical protein FTHG_01262 [Francisella tularensis subsp.
           holarctica 257]
 gi|164551729|gb|ABU61896.2| putative membrane protein [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 340

 Score =  189 bits (481), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 126/336 (37%), Positives = 198/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  ++ VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSLFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM--SHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  +    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYSDPNYQGSLDIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ ++ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAVLLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|237749821|ref|ZP_04580301.1| integral membrane protein [Helicobacter bilis ATCC 43879]
 gi|229374571|gb|EEO24962.1| integral membrane protein [Helicobacter bilis ATCC 43879]
          Length = 324

 Score =  189 bits (480), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 130/332 (39%), Positives = 201/332 (60%), Gaps = 16/332 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + HF  + +VT+ G +    +G             +YICI+L+++E+SLSF+NA++NAK 
Sbjct: 1   MKHFYSSFVVTLIGLVLAFYVGAWQ---------AIYICILLSILEVSLSFDNAVVNAKV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L  M   WQKRF+ WGI IAVFGMR IFPI+IV + + +  +E +NLA+YSPQ+Y K + 
Sbjct: 52  LDTMDIKWQKRFIYWGIPIAVFGMRFIFPIVIVAVAARLGMLETLNLALYSPQEYHKTLE 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           +    I  FG  FL+MV L FFF+   ++HW+ F+E  +     +K     ++L+I  GI
Sbjct: 112 ETRFEIYAFGAGFLLMVCLQFFFSEDKEVHWLSFIEDNVIMRFFMKFPNFALLLAITLGI 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
             +L   +      +   AI+++  I+  +  L           ++GL  FLYLE++DAS
Sbjct: 172 I-LLALTDNILVGMAYFCAIVLYLIIHSADKFL------GAGGVRNGLMGFLYLEVLDAS 224

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+++N FII+IGL IGA++VRS+TL +++   L K  YLEHG++Y+I  L
Sbjct: 225 FSFDGVIGAFALSENIFIIMIGLGIGAMFVRSLTLYLVEHKTLQKLIYLEHGAHYAIGAL 284

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           ++IM L+  +++ EI TG      I ++   S
Sbjct: 285 AIIMLLKIFMEVSEIITGLIGVGFIGIAFICS 316


>gi|56707698|ref|YP_169594.1| hypothetical protein FTT_0569c [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670169|ref|YP_666726.1| hypothetical protein FTF0569c [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134302332|ref|YP_001122301.1| hypothetical protein FTW_1443 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|187931925|ref|YP_001891910.1| hypothetical protein FTM_1275 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|224456769|ref|ZP_03665242.1| hypothetical protein FtultM_03072 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254370204|ref|ZP_04986210.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874511|ref|ZP_05247221.1| integral membrane protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|56604190|emb|CAG45202.1| conserved hypothetical membrane protein [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320502|emb|CAL08585.1| conserved hypothetical membrane protein [Francisella tularensis
           subsp. tularensis FSC198]
 gi|134050109|gb|ABO47180.1| integral membrane protein [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|151568448|gb|EDN34102.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|187712834|gb|ACD31131.1| integral membrane protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254840510|gb|EET18946.1| integral membrane protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158865|gb|ADA78256.1| integral membrane protein [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 340

 Score =  189 bits (480), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 126/336 (37%), Positives = 197/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSFFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM--SHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  +    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYSDPNYQGSLAIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ ++ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAVLLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|208779126|ref|ZP_03246472.1| integral membrane protein [Francisella novicida FTG]
 gi|208744926|gb|EDZ91224.1| integral membrane protein [Francisella novicida FTG]
          Length = 340

 Score =  189 bits (480), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 128/336 (38%), Positives = 197/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSFFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V I S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSITSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM--SHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  +    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYANPNYQGSLAIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ I+ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAILLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|56552674|ref|YP_163513.1| hypothetical protein ZMO1778 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|4378178|gb|AAD19423.1| unknown [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56544248|gb|AAV90402.1| protein of unknown function DUF475 [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 339

 Score =  189 bits (479), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 120/335 (35%), Positives = 202/335 (60%), Gaps = 6/335 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQ-FTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           ++ HFR + LVT+ G +     G+    H L   ++  ++  +LA++E + SF+NA++NA
Sbjct: 1   MLKHFRASFLVTILGLITAFIFGYYAQGHHLISGLNAAFLAFLLAILETAFSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ ++  WQK FLTWG+++AVFGMRI+FP++IV   + ++P EA  +A+++   Y ++
Sbjct: 61  SVLKNLTPKWQKCFLTWGMIVAVFGMRILFPLLIVSFSAWVDPWEATKIALFNHARYEEV 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+GFG  FLM+V L+FF   ++   WI ++E  +  L  I  I   +   I+ 
Sbjct: 121 VTAAHASIAGFGSAFLMLVGLSFFVKEEHSPIWISWIEKPLMALRVIPFISYILTFLIMA 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
           G +      + YSF  ++   +  ++ +   E  +   +      GK GL  F+YLE +D
Sbjct: 181 GFAFWFDQKDSYSFSVAALFGMAAYFLLEQFERFMGKPTP-----GKAGLATFIYLEFLD 235

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T +  +I IGL IGA++VRSMT+ +++ G L++Y YLE G++Y+I 
Sbjct: 236 ASFSFDGVIGAFAVTNDIVLIAIGLGIGAMFVRSMTVALVQGGHLSQYPYLEAGAFYAIV 295

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            L+ I  L   +++PEI +G S  + I  S+  S+
Sbjct: 296 TLAFITALNVRIEVPEIISGLSGLVWIGGSLVYSM 330


>gi|226304083|ref|YP_002764041.1| hypothetical protein RER_05940 [Rhodococcus erythropolis PR4]
 gi|226183198|dbj|BAH31302.1| conserved hypothetical membrane protein [Rhodococcus erythropolis
           PR4]
          Length = 373

 Score =  189 bits (479), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 118/332 (35%), Positives = 192/332 (57%), Gaps = 28/332 (8%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           + G    +++ IIL+++EISLSF+NA++NA  L++MS  WQK FLT GI+IAVFGMR++F
Sbjct: 22  IYGGPEALFLVIILSILEISLSFDNAVINATVLRRMSDFWQKIFLTIGIVIAVFGMRLVF 81

Query: 99  PIMIVCIVSTINPIEAMNLAIYSP-----------QDYLKIISQAHVPISGFGGTFLMMV 147
           P++IV   S + P+ A++LA+  P             Y  I++ AH  I+ FGG FL+M+
Sbjct: 82  PLVIVWAASGLGPVAALDLALNPPADDAAYFANGEPSYETILTDAHPQIAAFGGMFLLML 141

Query: 148 SLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMY-SFVSSS 206
            L F F  + ++ W+ +LE  ++ + K+  + + +   ++    + L  ++   + + S 
Sbjct: 142 FLGFIFE-EREITWLSWLEKPLARIGKLDQLSVVVAGIVLVLSGSFLAADDKVSTVMISG 200

Query: 207 TAAIIIFYGINFLESVL--------------SSDSSNNVTHGKHGLNLFLYLEIIDASLS 252
              +I +  +N L  +                  +      GK G  LFLYLE++DAS S
Sbjct: 201 VLGMITYIAVNGLGELFNLPEEGEEEETTKSGGPTEFAKATGKAGFFLFLYLEVLDASFS 260

Query: 253 LDGVISSFAITKNFFIIVIGLTI-GAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLS 311
            DGVI +FAIT +  II +GL   GA++VRS+T+ ++++G L+ Y YLEHG++++I  L+
Sbjct: 261 FDGVIGAFAITADPIIIALGLGFVGAMFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALA 320

Query: 312 VIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           VI+ +   V I EI TG     LI  +  SS+
Sbjct: 321 VILMVSIGVHINEIITGLVGVFLIGAAFISSL 352


>gi|241668789|ref|ZP_04756367.1| hypothetical protein FphipA2_08475 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254877320|ref|ZP_05250030.1| integral membrane protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254843341|gb|EET21755.1| integral membrane protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 341

 Score =  189 bits (479), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 196/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G    + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSFFVTLIGVGIAIFIY------PTAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN    + LA+  PQ Y  I+
Sbjct: 57  ILGQMSQKWQKIFIYLGLPIAVFGMRLLFPILLVSVTSGINFTNVVTLALNDPQQYQNIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E       +    G  I   + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENEGHHWIPIVENNRITRKIRDYNGGYILFAIFIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
             I      +   S   +    I++   I  L S+  +   ++ T  ++G+  F+YLEII
Sbjct: 177 LIIIYDAEPDYQGSLAIAYFLGIVVHESIGMLNSIFDTSHIDSSTVARNGIMGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ ++ L+  V IPE F+G+   +++F++   S+
Sbjct: 297 GFLAAVLLLKIFVHIPEWFSGSIGILVLFIAFIHSV 332


>gi|260753678|ref|YP_003226571.1| hypothetical protein Za10_1449 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258553041|gb|ACV75987.1| protein of unknown function DUF475 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 339

 Score =  189 bits (479), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 120/335 (35%), Positives = 201/335 (60%), Gaps = 6/335 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQ-FTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           ++ HFR + LVT+ G +     G+    H L   +   ++  +LA++E + SF+NA++NA
Sbjct: 1   MLKHFRASFLVTILGLITAFIFGYYAQGHHLISGLDAAFLAFLLAILETAFSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ ++  WQK FLTWG+++AVFGMRI+FP++IV   + ++P EA  +A+++   Y ++
Sbjct: 61  SVLKNLTPKWQKCFLTWGMIVAVFGMRILFPLLIVSFSAWVDPWEATKIALFNHARYEEV 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+GFG  FLM+V L+FF   ++   WI ++E  +  L  I  I   +   I+ 
Sbjct: 121 VTAAHASIAGFGSAFLMLVGLSFFVKEEHSPIWISWIEKPLMALRVIPFISYILTFLIMA 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
           G +      + YSF  ++   +  ++ +   E  +   +      GK GL  F+YLE +D
Sbjct: 181 GFAFWFDQKDGYSFSVAALFGMAAYFLLEQFERFMGKPTP-----GKAGLATFIYLEFLD 235

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T +  +I IGL IGA++VRSMT+ +++ G L++Y YLE G++Y+I 
Sbjct: 236 ASFSFDGVIGAFAVTNDIVLIAIGLGIGAMFVRSMTVALVQGGHLSQYPYLEAGAFYAIV 295

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            L+ I  L   +++PEI +G S  + I  S+  S+
Sbjct: 296 TLAFITALNVRIEVPEIISGLSGLVWIGGSLVYSM 330


>gi|241762087|ref|ZP_04760170.1| protein of unknown function DUF475 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373337|gb|EER62937.1| protein of unknown function DUF475 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 339

 Score =  189 bits (479), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 118/335 (35%), Positives = 199/335 (59%), Gaps = 6/335 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQ-FTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           ++ HF  + LVT+ G +     G+    H L   +   ++  +LA++E + SF+NA++NA
Sbjct: 1   MLKHFWASFLVTILGLITAFIFGYYAQGHHLMSGLDAAFLAFLLAILETAFSFDNAVVNA 60

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L+ ++  WQK FLTWG+++AVFGMRI+FP++IV   + ++P EA  +A+++   Y ++
Sbjct: 61  SILKNLTPKWQKCFLTWGMIVAVFGMRILFPLLIVSFSAWVDPWEATKIALFNHARYEEV 120

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+GFG  FLM+V L+FF   ++   WI ++E  +  L  I  I   +   I+ 
Sbjct: 121 VTAAHASIAGFGSAFLMLVGLSFFVKEEHSPIWISWIEKPLMALRVIPFISYILTFLIMA 180

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIID 248
           G +      + YSF  ++   +  ++ +   E  +   +      GK GL  F+YLE +D
Sbjct: 181 GFAFWFDQKDGYSFSVAALFGMAAYFLLEQFERFMGKPTP-----GKAGLATFIYLEFLD 235

Query: 249 ASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIF 308
           AS S DGVI +FA+T +  +I IGL IGA++VRSMT+ +++ G L++Y YLE G++Y+I 
Sbjct: 236 ASFSFDGVIGAFAVTNDIVLIAIGLGIGAMFVRSMTVALVQGGHLSQYPYLEAGAFYAIV 295

Query: 309 VLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            L+ I  L   +++PEI +  S  + I  S+  S+
Sbjct: 296 TLAFITALNVRIEVPEIISCLSGLVWIGGSLVYSM 330


>gi|296166693|ref|ZP_06849118.1| integral membrane protein [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295897958|gb|EFG77539.1| integral membrane protein [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 358

 Score =  189 bits (479), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 109/323 (33%), Positives = 195/323 (60%), Gaps = 21/323 (6%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
           G ++ + + + LA++EISLSF+NAI+NA  L++MS  W++ FLT G+L+AVFGMR++FP+
Sbjct: 25  GGLNALLLLLALALLEISLSFDNAIINAAILKQMSPFWRQMFLTIGVLVAVFGMRLLFPL 84

Query: 101 MIVCIVSTINPIEAMNLAIYSP-----------QDYLKIISQAHVPISGFGGTFLMMVSL 149
           +IV + + ++P+ AM LA++ P             Y K+I  AH  I+ FGGTFL+M+ L
Sbjct: 85  LIVWVTAGLDPVRAMELALHPPPNGALEFPDGSPSYEKLIGAAHPQIAAFGGTFLLMLFL 144

Query: 150 TFFFNSQNKLHWIHFLEIAMSHLSKIKG--IKIFIVLSIIFGISNILPTNEMYSFVSSST 207
            F F     + W+ ++E+  + + ++    + + +V  ++ G+       E  + +++  
Sbjct: 145 DFVF-HDRDIKWLKWIEVPFARIGRLGQVSVAVTVVALVVVGMRLTHSGEERATVLTAGL 203

Query: 208 AAIIIFYGINFLESVLSSD----SSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAIT 263
             ++ +  +N L           + +    GK GL LFLYLE++DA+ S DGV  +FAIT
Sbjct: 204 LGLVTYLVVNGLSRAFRPPHIEAAGDGEAVGKAGLTLFLYLEVLDAAFSFDGVTGAFAIT 263

Query: 264 KNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT--IV 320
            +  +I +GL  +G+++VRS+T+ ++KQ  L++Y YLEHG++++I VL+VIM +      
Sbjct: 264 SDPIVIALGLGLVGSMFVRSITIFLVKQDALDRYVYLEHGAHWAIGVLAVIMLVSIEPRF 323

Query: 321 DIPEIFTGTSSTILIFLSIYSSI 343
           ++P+  T +   + I  ++  S+
Sbjct: 324 EVPDPVTASVGVVFIGAALGWSV 346


>gi|118497338|ref|YP_898388.1| hypothetical protein FTN_0743 [Francisella tularensis subsp.
           novicida U112]
 gi|195536025|ref|ZP_03079032.1| membrane protein, putative [Francisella tularensis subsp. novicida
           FTE]
 gi|118423244|gb|ABK89634.1| conserved hypothetical membrane protein [Francisella novicida U112]
 gi|194372502|gb|EDX27213.1| membrane protein, putative [Francisella tularensis subsp. novicida
           FTE]
          Length = 340

 Score =  188 bits (478), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 128/336 (38%), Positives = 197/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSFFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQTIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM--SHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  +    +    G  I   + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILFAIIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
               +    N   S   +    II+   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIHYANPNYQGSLAIAFLLGIIVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ I+ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAILLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|167626357|ref|YP_001676857.1| hypothetical protein Fphi_0136 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167596358|gb|ABZ86356.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 364

 Score =  188 bits (478), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 197/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G    + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 26  ILKYFYGSFFVTLIGIGIAIFIY------PTAPLETIYSVLILAILEISLSFDNAVINAK 79

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN    + LA+  PQ Y  I+
Sbjct: 80  ILGQMSQKWQKIFIYLGLPIAVFGMRLLFPILLVSVTSGINFTNVVTLALNDPQQYQNIL 139

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLE--IAMSHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E       +    G  I   + I 
Sbjct: 140 EHSMPYICSFGGSFLLMVFLNFFLSENEGHHWIPIVENNRITRKIRDYNGGYILFAIFIG 199

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
             I     ++   S   +    I++   I  L S+  +   ++ T  ++G+  F+YLEII
Sbjct: 200 LIIIYDAESDYQGSLAIAYFLGIVVHESIGMLNSIFDTSHIDSSTVARNGIMGFIYLEII 259

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 260 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 319

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ ++ L+  V IPE F+G+   +++F++   S+
Sbjct: 320 GFLAAVLLLKIFVHIPEWFSGSIGILVLFIAFIHSV 355


>gi|167011127|ref|ZP_02276058.1| hypothetical protein Ftulh_10562 [Francisella tularensis subsp.
           holarctica FSC200]
          Length = 338

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 126/336 (37%), Positives = 198/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  ++ VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSLFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MS  WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM--SHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  +    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYSDPNYQGSLDIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ ++ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAVLLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|254369516|ref|ZP_04985527.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122470|gb|EDO66605.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 340

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 127/336 (37%), Positives = 198/336 (58%), Gaps = 8/336 (2%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++ +F  +  VT+ G +  + I        +  + T+Y  +ILA++EISLSF+NA++NAK
Sbjct: 3   ILKYFYGSFFVTLIGIVIAVFIY------PNAPLETIYSVLILAILEISLSFDNAVINAK 56

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L +MSS WQK F+  G+ IAVFGMR++FPI++V + S IN +  + LA+ +PQ Y  I+
Sbjct: 57  ILGQMSSRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAIL 116

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM--SHLSKIKGIKIFIVLSII 187
             +   I  FGG+FL+MV L FF +     HWI  +E  +    +    G  I + + I 
Sbjct: 117 EHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIG 176

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                    N   S   +    I++   I  L S+  +   +     ++GL  F+YLEII
Sbjct: 177 VITIYYSDPNYQGSLAIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEII 236

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT N  II+IGL IGA++VRS+T+L +++  L KY YLEHG++Y+I
Sbjct: 237 DASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAI 296

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L+ ++ L+  + IPE F+G+   +++ L+   S+
Sbjct: 297 GFLAAVLLLKIFMHIPEWFSGSIGILVLTLAFIHSV 332


>gi|41406532|ref|NP_959368.1| hypothetical protein MAP0434 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41394881|gb|AAS02751.1| hypothetical protein MAP_0434 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 359

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 109/357 (30%), Positives = 199/357 (55%), Gaps = 31/357 (8%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F  ++LVT A  + G            G   ++Y+ ++LA +E+SLSF+NA++NA  
Sbjct: 1   MRTFGVSLLVTAAALVLGY---------AYGGPKSLYLLLVLAALEVSLSFDNAVINAAV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP-------- 122
           L++MS  WQ+ FLT GIL+AVFGMR++FP++IV   + ++P+ A+ LA+  P        
Sbjct: 52  LKQMSRFWQRMFLTIGILVAVFGMRLLFPLLIVWATAGLDPVRALELALRPPPHGALEFP 111

Query: 123 ---QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                Y K+++ AH  I+ FGG FL+M+ L F       + W+ ++E+  + + ++  + 
Sbjct: 112 DGSPSYQKLLTAAHPQIAAFGGIFLLMLFLDFLLI-DRDIKWLKWIEVPFARIGRLGQVS 170

Query: 180 IFI--VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVL-----SSDSSNNVT 232
           + +  +  ++ G      + E  + +++    ++ +  +N L                  
Sbjct: 171 VVLSGLTLVLVGTGLTHSSQEAVTVLTAGLLGMVAYLVVNGLSRAFRPSGVGQPQPAGPA 230

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIG-LTIGAIYVRSMTLLMLKQG 291
            G  GL+LFLYLE++DA+ S DGV  +FAIT +  +IV+G   +G+++VRS+T+ ++ Q 
Sbjct: 231 TGWAGLSLFLYLEVLDAAFSFDGVTGAFAITSDPVVIVLGLGAVGSMFVRSITIYLVHQE 290

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMF--LQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L++Y YLEHG++++I  L+VIM   ++  + +PE  T +     I  ++  S+  +
Sbjct: 291 TLDRYVYLEHGAHWAIGALAVIMLASIEPRLTVPEPVTASVGVFFIGTAVGFSVLRR 347


>gi|240172428|ref|ZP_04751087.1| hypothetical protein MkanA1_24140 [Mycobacterium kansasii ATCC
           12478]
          Length = 355

 Score =  186 bits (471), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 118/357 (33%), Positives = 196/357 (54%), Gaps = 31/357 (8%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            + I  F  ++L T      G            G  + +++ ++LAV+E+SLSF+NAI+N
Sbjct: 1   MTTIRIFGLSLLFTTGALAIGYW---------HGGPTALFLLVVLAVLEVSLSFDNAIIN 51

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP----- 122
           A  L++MS  WQ+ FLT GILIAVFGMR++FP+ IV + + ++P+ AM+LA+  P     
Sbjct: 52  AAILKQMSRFWQQMFLTVGILIAVFGMRLVFPLAIVWVTAGLDPVHAMDLALNPPPNGAL 111

Query: 123 ------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
                   Y K+I  AH  I+ FGG FL+M+ L F F     + W+ ++E   + + ++ 
Sbjct: 112 EFPDGSPSYEKLIKAAHPQIAAFGGMFLLMLFLDFVF-HDRDIKWLKWIEAPFARVGRLG 170

Query: 177 G--IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDS-----SN 229
              + +  V  ++ G       +E  + + +    ++I+  +N L               
Sbjct: 171 QVPVVVACVALVLVGTELTHSGDERANVLIAGLLGLVIYLVVNGLSRAFRPPEAAADVGG 230

Query: 230 NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLML 288
               GK G  LFLYLE++DAS S DGV  +FAIT +  II +GL  +GA++VRS+T+ ++
Sbjct: 231 AGAVGKAGFTLFLYLEVLDASFSFDGVTGAFAITSDPIIIALGLGLVGAMFVRSITIYLV 290

Query: 289 KQGILNKYKYLEHGSYYSIFVLSVIMFLQTIV--DIPEIFTGTSSTILIFLSIYSSI 343
           +Q  L++Y YLEHG++++I  L+VIM +       +PE  T +   + I  ++ +S+
Sbjct: 291 RQETLDRYVYLEHGAHWAIGALAVIMLISVNHRLQLPEWITASIGVVFIAAAVTNSV 347


>gi|224372322|ref|YP_002606694.1| hypothetical protein NAMH_0271 [Nautilia profundicola AmH]
 gi|223588816|gb|ACM92552.1| integral membrane protein [Nautilia profundicola AmH]
          Length = 318

 Score =  185 bits (469), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 126/332 (37%), Positives = 200/332 (60%), Gaps = 19/332 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + ++   G +    I            S VY+  ILA++E+SLSF+NA++NAK 
Sbjct: 1   MRYFYVSFIIAAIGLILSFFI---------DGWSAVYLTSILAILEVSLSFDNAVVNAKI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M  IW+KRFLTWG++IAVFGMR IFPI+IV + + +  +E +N+AI  P+ Y +++ 
Sbjct: 52  LKDMDKIWEKRFLTWGMVIAVFGMRFIFPILIVAVAANLGVVETLNIAINHPEQYHEVLL 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           ++   I  FGG FL +V   F F    ++ WI  +E     L ++  I + +   I   +
Sbjct: 112 KSENLIYAFGGAFLWLVFTDFLFEH-KEIRWIKPVERYAEKLGRVNNISLIVATVIGIIV 170

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
              +  ++ Y    +    ++ +  +N +    + +        K+GL  FLYLEI+DAS
Sbjct: 171 ---IYDSKSYEIGIAYLLGMLTYSLLNGINEAFAVEG------AKNGLMGFLYLEILDAS 221

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FAIT N FII+IGL IGA++VRS+T+ M+++G+L++YKYLEHG++Y+I VL
Sbjct: 222 FSFDGVIGAFAITGNIFIIMIGLGIGAMFVRSLTIWMVEKGVLSEYKYLEHGAHYAIGVL 281

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           +VIM L+  + I E+ TGT    L+ ++   S
Sbjct: 282 AVIMLLKIFMHIGEVLTGTIGLGLLAIAFLHS 313


>gi|71901998|ref|ZP_00684045.1| Protein of unknown function DUF475 [Xylella fastidiosa Ann-1]
 gi|71728243|gb|EAO30427.1| Protein of unknown function DUF475 [Xylella fastidiosa Ann-1]
          Length = 311

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 112/314 (35%), Positives = 197/314 (62%), Gaps = 6/314 (1%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           ++  FR + + T          G+    T  G    +++C++L+V+E+SLSF+NA++NA 
Sbjct: 1   MLRDFRISFIFTAFCLSLAAWWGY---STALGVWQALWLCLVLSVLEVSLSFDNAVINAG 57

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
            L+ MS  W+K FLT GILIAVFGMR++FPI+IV + + +  I  M LA+  P+ Y  ++
Sbjct: 58  ILKHMSEFWRKLFLTIGILIAVFGMRLVFPIVIVAVATGMGLIPVMKLALEHPEQYSLVL 117

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
           +  +  I+ FGG FL++V L F F+++ +LHW+  +E  ++ L K   + + + ++ + G
Sbjct: 118 TDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKADAMAVIVAVACLMG 177

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG---KHGLNLFLYLEI 246
               LP       + +    I+++  ++ ++++   D   +   G   + G+  FLYLE+
Sbjct: 178 TKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMGPGKRSGVAAFLYLEV 237

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
           +DAS S DGVI +FAIT++  II++GL IGA++VRS+TL ++++G L+++ +LEHG++Y+
Sbjct: 238 LDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRKGTLDEFVFLEHGAHYA 297

Query: 307 IFVLSVIMFLQTIV 320
           I VL+VIM +   +
Sbjct: 298 IGVLAVIMLVVPYI 311


>gi|154148595|ref|YP_001405960.1| integral membrane protein [Campylobacter hominis ATCC BAA-381]
 gi|153804604|gb|ABS51611.1| integral membrane protein [Campylobacter hominis ATCC BAA-381]
          Length = 324

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 140/336 (41%), Positives = 204/336 (60%), Gaps = 16/336 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + ++T  G L    I         G+ + VYIC +L V+E+SLSF+NA++NAK 
Sbjct: 1   MKYFYLSFVITFLGLLIAFFI---------GSFAAVYICFLLTVLEVSLSFDNAVVNAKI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L  MS IWQ+RF+TWGI IAVFGMR+IFPI+IV I +     E   LA+  P  Y +I+S
Sbjct: 52  LNNMSKIWQRRFITWGIFIAVFGMRLIFPILIVSIATKHGLTETFMLALKDPDLYHEILS 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
           ++   I  FGG FLMM+ L FFF+ +  + WI   E  +      K   I + L++I G+
Sbjct: 112 ESKNEIYIFGGGFLMMIFLNFFFDKERDVFWIKPFEKNIITEFFKKFNNISLTLALILGV 171

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
             I  + +  S + +  +AII++  I   + V S +        ++G+  FLYLE++DAS
Sbjct: 172 FIIYQSGD-ISLILAYFSAIILYNLIQNFDDVFSKNG------IRNGIVGFLYLEMLDAS 224

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+++N FII+IGL  GA++VRSMTL +++   L  + +LEHG++Y+IF L
Sbjct: 225 FSFDGVIGAFALSENIFIIMIGLGSGAMFVRSMTLYLVEHKTLEHFIFLEHGAHYAIFAL 284

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +VIM L+T + I EI TGT     I LS   SI  K
Sbjct: 285 AVIMLLKTQMQISEILTGTLGFGFILLSFLCSIFYK 320


>gi|149194204|ref|ZP_01871302.1| integral membrane protein [Caminibacter mediatlanticus TB-2]
 gi|149136157|gb|EDM24635.1| integral membrane protein [Caminibacter mediatlanticus TB-2]
          Length = 321

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 132/336 (39%), Positives = 205/336 (61%), Gaps = 19/336 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F ++  + + G L    I         G +S +YI  ILA++EISLSF+NA++NAK 
Sbjct: 1   MRYFYFSFFIGIVGILLAFFI---------GGLSAIYITSILALLEISLSFDNAVVNAKI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M  +WQ+RFLTWGILIAVFGMR +FPI+IV + + I  I+ +NLA++ PQ Y +++ 
Sbjct: 52  LKNMDKVWQRRFLTWGILIAVFGMRFVFPILIVSVAANIGIIKTINLALFDPQKYHEVLV 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
                I  FGG FL MV   F F  + ++ WI  +E       ++  I + + + I   +
Sbjct: 112 NVEKLIYAFGGAFLWMVFSDFLFE-EKEVRWIKPIEKTAEKFGRVNNISLIVAMIIGLIV 170

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
              +  ++ Y    +    I+I+  ++ + S LS++        K GL  FLYLE++DAS
Sbjct: 171 ---IYDSKDYKIAIAYFLGILIYSILHGINSALSTEG------AKSGLMGFLYLEVLDAS 221

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FAIT N  II++GL IGA++VRS+T+ M+++G+L++YKYLEHG++Y+I +L
Sbjct: 222 FSFDGVIGAFAITSNILIIMLGLGIGAMFVRSLTIWMVERGVLDEYKYLEHGAHYAIGIL 281

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +VIM L+    I E  TGT   +L+ ++   S   K
Sbjct: 282 AVIMLLKIFFHISEEITGTLGLLLLIIAFLHSKYEK 317


>gi|300744120|ref|ZP_07073139.1| integral membrane protein [Rothia dentocariosa M567]
 gi|300379845|gb|EFJ76409.1| integral membrane protein [Rothia dentocariosa M567]
          Length = 365

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 120/350 (34%), Positives = 199/350 (56%), Gaps = 24/350 (6%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +L+  F++ +L+T+A  +              G I  +    IL V+EI  SF+NA +N
Sbjct: 1   MALLKFFKYDLLITLAALI---------GAAFYGGIVGMVSAAILIVLEIVFSFDNAGVN 51

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSP 122
           AK L KMS  W+  FLT G+L+AVFGMR+IFP +IVC+   + P+EA NLA+     ++P
Sbjct: 52  AKYLDKMSHAWRNIFLTVGVLVAVFGMRLIFPFLIVCLAGNVGPVEAWNLAMERGDPHTP 111

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
             Y  I+  AH  I+ FGG FL+M+ L+F F +   +HW+  +E  ++       + + +
Sbjct: 112 GTYGYILESAHHTIASFGGMFLLMLFLSFLFEAGKDVHWLSVIEKPLAKAGHFDSMPVLV 171

Query: 183 VLSIIFGISNIL--PTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN--------NVT 232
              I+   S +     +E Y+ + S    ++ F   N L + +   + +         V 
Sbjct: 172 SGVILVTASQLFGAEHHEQYTILLSGLLGMLTFLATNGLATFMEDRNESQEESLANVAVL 231

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK   ++F++LE++DAS S DGV+ +FA+T +  II IGL +GA++VRSMT+ ++++G 
Sbjct: 232 TGKAAFSMFIFLEVLDASFSFDGVLGAFAVTSDPIIIAIGLGVGALFVRSMTIYLVEKGT 291

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           L + +YL+HG++++I VL++++      DIP+   G S  + I  SI SS
Sbjct: 292 LQELRYLDHGAHWAIGVLALMLLATLKWDIPDYVIGLSGIVFIAGSIISS 341


>gi|311112703|ref|YP_003983925.1| integral membrane protein [Rothia dentocariosa ATCC 17931]
 gi|310944197|gb|ADP40491.1| integral membrane protein [Rothia dentocariosa ATCC 17931]
          Length = 365

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 120/350 (34%), Positives = 199/350 (56%), Gaps = 24/350 (6%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +L+  F++ +L+T+A  +              G I  +    IL V+EI  SF+NA +N
Sbjct: 1   MALLKFFKYDLLITLAALI---------GAAFYGGIVGMVSAAILIVLEIVFSFDNAGVN 51

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSP 122
           AK L KMS  W+  FLT G+L+AVFGMR+IFP +IVC+   + P+EA NLA+     ++P
Sbjct: 52  AKYLDKMSHAWRNIFLTVGVLVAVFGMRLIFPFLIVCLAGNVGPVEAWNLAMERGDPHTP 111

Query: 123 QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFI 182
             Y  I+  AH  I+ FGG FL+M+ L+F F +   +HW+  +E  ++       + + +
Sbjct: 112 GTYGYILESAHHTIASFGGMFLLMLFLSFLFEAGKDVHWLSVIEKPLAKAGHFDSMPVLV 171

Query: 183 VLSIIFGISNIL--PTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN--------NVT 232
              I+   S +     +E Y+ + S    ++ F   N L + +   + +         V 
Sbjct: 172 SGVILVTASQLFGAEHHEQYAILLSGLLGMLTFLATNGLATFMEDRNESQEESLANVAVL 231

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGI 292
            GK   ++F++LE++DAS S DGV+ +FA+T +  II IGL +GA++VRSMT+ ++++G 
Sbjct: 232 TGKAAFSMFIFLEVLDASFSFDGVLGAFAVTSDPIIIAIGLGVGALFVRSMTIYLVEKGT 291

Query: 293 LNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           L + +YL+HG++++I VL++++      DIP+   G S  + I  SI SS
Sbjct: 292 LQELRYLDHGAHWAIGVLALMLLATLKWDIPDYVIGLSGIVFIAGSIISS 341


>gi|111223995|ref|YP_714789.1| putative membrane protein TerC [Frankia alni ACN14a]
 gi|111151527|emb|CAJ63245.1| Putative membrane protein TerC [Frankia alni ACN14a]
          Length = 363

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 47/343 (13%), Positives = 104/343 (30%), Gaps = 74/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W++L    G      I        +G  +  ++      +E SLS +
Sbjct: 27  RKAHVIGFREAAWWSVLWVSLGLGFAGVIWAWQGPGAAGEYTAAWL------LEKSLSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G+L A+  +R +F    V                 
Sbjct: 81  NLFVFALIFSYFKVPREYQHRVLFYGVLGAL-VLRFVFIAAGVA---------------- 123

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    I    G FL+  ++    +S  ++                     
Sbjct: 124 --------LLEQFSFIIYIFGAFLIYTAVKMLRDSGVEMDPG------------------ 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +     +         + G +F+                  L +
Sbjct: 158 ---------------QSRAVRLLRRVMPVTDQYEGQHFVLRR------AGRLVATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   + D V ++  +T   F+I     +  + +RS+    L  G++ ++ +L 
Sbjct: 197 LVAIETADVLFAFDSVPAALGVTDRTFLIYTSNALAILGLRSL--FFLLAGLMERFHHLA 254

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            G  + +  + V M L  +  +P   +     + + +S+  S+
Sbjct: 255 TGLAFILAFIGVKMLLTDVWHMPIALSLGVIAVALAVSVVWSL 297


>gi|312197687|ref|YP_004017748.1| integral membrane protein TerC [Frankia sp. EuI1c]
 gi|311229023|gb|ADP81878.1| Integral membrane protein TerC [Frankia sp. EuI1c]
          Length = 355

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 52/343 (15%), Positives = 102/343 (29%), Gaps = 73/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ L    G    L I      T +G  +  ++      +E SLS +
Sbjct: 27  RRAHVIRFREAALWSALWVSLGLGFALVIWAWQGPTAAGQYTAAWL------LEKSLSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G+L A+  +R  F    +                 
Sbjct: 81  NLFVFALIFGYFKVPRQYQHRVLFYGVLGAL-VLRFAFIAGGMA---------------- 123

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   +  A   +    G FL+  ++     S                         
Sbjct: 124 --------LLNAFHVVIYLFGAFLVYTAIKMVRGSGE----------------------- 152

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                    +      +     +         + G  FL           V      L +
Sbjct: 153 ---------VDMDPGQSRAVRLLRRVIPVTDQYEGQRFLLRR------RGVLVATPLLAV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   + D V ++  +T   F++     +  + +RS+    L  G L+++ +L 
Sbjct: 198 LVAVETADVLFAFDSVPAALGVTDQTFLVYTANALAILGLRSL--FFLLSGALDRFHHLG 255

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            G    +  +   M L  +V IP   +  +  +++  SI  S+
Sbjct: 256 TGLAVILAFIGTKMLLTDVVHIPIAVSLGAIGVVLTASIIWSL 298


>gi|125624168|ref|YP_001032651.1| hypothetical protein llmg_1349 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|124492976|emb|CAL97939.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300070945|gb|ADJ60345.1| hypothetical protein LLNZ_06975 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 356

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 117/330 (35%), Positives = 190/330 (57%), Gaps = 25/330 (7%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           + G +  + +  IL ++E+SLSF+NAI+NA+ L++MS  W+  FLT G+LIAV GMR IF
Sbjct: 20  VYGGVDALILATILGIMEVSLSFDNAIVNARILERMSHRWRNIFLTVGMLIAVLGMRFIF 79

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQ-----DYLKIISQAHVPISGFGGTFLMMVSLTFFF 153
           P+ +V + + ++P++A++LA+          Y  I+  AH  I+ FGG FL+M++L FFF
Sbjct: 80  PLAVVSVSAQMSPMKALHLAMEKGNPETVGTYGYILQHAHPVIAAFGGAFLLMLALNFFF 139

Query: 154 NSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIF 213
           +     HW    E  +  + K       IVL ++  IS  +   + Y    S  A ++++
Sbjct: 140 DEN-DYHWFVLPEKLLFKIGKFPMATPMIVLVVMMVISKWVSG-QSYLVFFSGAAGMVLY 197

Query: 214 YGINFLESVLSSDS-----------------SNNVTHGKHGLNLFLYLEIIDASLSLDGV 256
             +  L +++                      + +  GK    LFLYLE+IDAS S DG 
Sbjct: 198 MAVEGLGNLMEHHGTLAEVAEEIENDEPLIAQSILATGKQAFVLFLYLEMIDASFSFDGA 257

Query: 257 ISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF 315
           I +FAIT +  +I++GL  IGA++VRS+T+ ++++G LN + YL+HG++++I  LS+++ 
Sbjct: 258 IGAFAITSDPIVIMLGLGLIGAMFVRSLTVYLVEKGTLNDFVYLDHGAHWAILTLSILLL 317

Query: 316 LQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +   ++IPEI TG    ILI  S  SSI  
Sbjct: 318 VSINIEIPEIVTGLIGAILIGASFLSSIFY 347


>gi|315637371|ref|ZP_07892586.1| integral membrane protein [Arcobacter butzleri JV22]
 gi|315478345|gb|EFU69063.1| integral membrane protein [Arcobacter butzleri JV22]
          Length = 359

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 126/332 (37%), Positives = 194/332 (58%), Gaps = 14/332 (4%)

Query: 27  CGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWG 86
             +         L G    VY   IL+V+E+SLSF+NA++NA  L  M+ +W+KRFL WG
Sbjct: 14  FAVWFIATILLFLYGGFFAVYQGTILSVLELSLSFDNAVVNATILATMALVWRKRFLIWG 73

Query: 87  ILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMM 146
           ++IAVFG+R +FPI+IV   + +  I++ NLA+ +P +Y +II  +H  I  FGG FL+M
Sbjct: 74  MIIAVFGVRFVFPILIVYFSTPMGFIDSFNLAVTNPDEYERIIESSHHVIMSFGGMFLLM 133

Query: 147 VSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN--------- 197
           + L F F+    LHWI  +E   + +SKI  +KI  +L ++ GI+ I P           
Sbjct: 134 LFLKFIFDENKDLHWIKSIENFATKISKIGDVKILFILFLMLGITYIAPNQVVMGDNMVN 193

Query: 198 -EMYSFVSSSTAAIIIFYGINFLESVLSSDSSN----NVTHGKHGLNLFLYLEIIDASLS 252
                 ++     +I FY I FL+  +   +       +T    G   F+YLE+ID S S
Sbjct: 194 VNKIEILAPMIIGVIAFYMIEFLKGFIEHRNEEESDSKITQVSGGFISFMYLELIDMSFS 253

Query: 253 LDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSV 312
           LDGV+ +FAIT+N  II++GL IGA+ VRS+T+ M+++ +++KY YLEHG+ +SI +LS+
Sbjct: 254 LDGVLGAFAITQNIVIIMLGLGIGAMAVRSLTIYMVERDVVSKYIYLEHGAMWSIGLLSL 313

Query: 313 IMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
            M +Q    +P +   T + + I L+   SI 
Sbjct: 314 SMLVQIFHHLPPMLVTTFAIVPITLAFIHSIY 345


>gi|157737609|ref|YP_001490292.1| hypothetical protein Abu_1367 [Arcobacter butzleri RM4018]
 gi|157699463|gb|ABV67623.1| conserved hypothetical protein (DUF475 domain protein) [Arcobacter
           butzleri RM4018]
          Length = 359

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 126/332 (37%), Positives = 194/332 (58%), Gaps = 14/332 (4%)

Query: 27  CGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWG 86
             +         L G    VY   IL+V+E+SLSF+NA++NA  L  M+ +W+KRFL WG
Sbjct: 14  FAVWFIATILLFLYGGFFAVYQGTILSVLELSLSFDNAVVNATILATMALVWRKRFLIWG 73

Query: 87  ILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMM 146
           ++IAVFG+R +FPI+IV   + +  I++ NLA+ +P +Y +II  +H  I  FGG FL+M
Sbjct: 74  MIIAVFGVRFVFPILIVYFSTPMGFIDSFNLAVTNPDEYERIIESSHHVIMSFGGMFLLM 133

Query: 147 VSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN--------- 197
           + L F F+    LHWI  +E   + +SKI  +KI  +L ++ GI+ I P           
Sbjct: 134 LFLKFIFDENKDLHWIKSIENFATKISKIGDVKILFILFLMLGITYIAPNQVVMGDNMVN 193

Query: 198 -EMYSFVSSSTAAIIIFYGINFLESVLSSDSSN----NVTHGKHGLNLFLYLEIIDASLS 252
                 ++     +I FY I FL+  +   +       +T    G   F+YLE+ID S S
Sbjct: 194 VNKIEILAPMIIGVIAFYMIEFLKGFIEHKNEEESDSKITQVSGGFISFMYLELIDMSFS 253

Query: 253 LDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSV 312
           LDGV+ +FAIT+N  II++GL IGA+ VRS+T+ M+++ +++KY YLEHG+ +SI +LS+
Sbjct: 254 LDGVLGAFAITQNIVIIMLGLGIGAMAVRSLTIYMVERDVVSKYIYLEHGAMWSIGLLSL 313

Query: 313 IMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
            M +Q    +P +   T + + I L+   SI 
Sbjct: 314 SMLVQIFHHLPPMLVTTFAIVPITLAFIHSIY 345


>gi|261886382|ref|ZP_06010421.1| hypothetical protein CfetvA_15863 [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 325

 Score =  179 bits (453), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 125/334 (37%), Positives = 195/334 (58%), Gaps = 17/334 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + ++T+ G L    I         G    VYIC +L ++E+SLSF+NA++NAK 
Sbjct: 1   MKYFYSSFIITILGLLLAYFI---------GGFLAVYICFLLGILEVSLSFDNAVVNAKI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L  M+  WQ RF+ +GI IAVFGMR +FPI+IV + + +   E  +LA+  P  Y   +S
Sbjct: 52  LSGMNKKWQDRFIIFGIPIAVFGMRFLFPILIVSVAANLGMWETFSLALNDPDAYHNALS 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
                I  FGG FL+MV L+FFF  +  + WI F+E         K   I + ++I+ G+
Sbjct: 112 ANKNQIYIFGGAFLLMVFLSFFFE-EKDVKWIRFIEDNYLVHILSKTNSIALFIAILTGM 170

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
             +  T +  S+  S   A+++   ++  + + S++        K G   FLYLE++DAS
Sbjct: 171 IIVFLT-QNTSYALSYFGAVLLHMALSLFDDIFSANG------VKSGFMGFLYLEVLDAS 223

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+++N FII+IGL IGA++VRS+T+ M+ +  L  + YLEHG++Y+I  L
Sbjct: 224 FSFDGVIGAFAMSENIFIIMIGLGIGAMFVRSLTIYMVHKKTLESFIYLEHGAHYAILAL 283

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           ++IMF+    ++ E  TGT    LI ++  SSI 
Sbjct: 284 AIIMFINVFHEVGEAITGTIGFGLIVIAFLSSIY 317


>gi|254773497|ref|ZP_05215013.1| hypothetical protein MaviaA2_02300 [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 359

 Score =  178 bits (452), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 108/357 (30%), Positives = 197/357 (55%), Gaps = 31/357 (8%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F  ++LVT A  + G            G   ++Y+ ++LA +E+SLSF+NA++NA  
Sbjct: 1   MRTFGVSLLVTAAALVLGY---------AYGGPKSLYLLLVLAALEVSLSFDNAVINAAV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP-------- 122
           L++MS  WQ+ FLT GIL+AVFGMR++FP++IV   + ++P+ A+ LA+  P        
Sbjct: 52  LKQMSRFWQRMFLTIGILVAVFGMRLLFPLLIVWATAGLDPVRALELALRPPPHGALEFP 111

Query: 123 ---QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                Y K+++ AH  I+ FGG FL+M+ L F       + W+ ++E+  + + ++  + 
Sbjct: 112 DGSPSYQKLLTAAHPQIAAFGGIFLLMLFLDFLLI-DRDIKWLKWIEVPFARIGRLGQVS 170

Query: 180 IFI--VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVL-----SSDSSNNVT 232
           + +  +  ++ G      + E  + +++    ++ +  +N L                  
Sbjct: 171 VVLSGLTLVLVGTGLTHSSQEAVTVLTAGLLGMVAYLVVNGLSRAFRPSGVGQPQPAGPA 230

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNF-FIIVIGLTIGAIYVRSMTLLMLKQG 291
            G  GL+LFLYLE++DA+ S DGV  +FAIT +   I++    +GA++VRS+T+ ++ Q 
Sbjct: 231 TGWAGLSLFLYLEVLDAAFSFDGVTGAFAITSDPVVIVLGLGVVGAMFVRSITIYLVHQE 290

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMF--LQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L++Y YLEHG++++I  L+VIM   ++  + +PE  T +     I  ++  S+  +
Sbjct: 291 TLDRYVYLEHGAHWAIGALAVIMLASIEPRLTVPEPVTASVGVFFIGTAVGFSVLRR 347


>gi|118463569|ref|YP_879807.1| hypothetical protein MAV_0528 [Mycobacterium avium 104]
 gi|118164856|gb|ABK65753.1| integral membrane protein [Mycobacterium avium 104]
          Length = 362

 Score =  178 bits (452), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 108/357 (30%), Positives = 197/357 (55%), Gaps = 31/357 (8%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  F  ++LVT A  + G            G   ++Y+ ++LA +E+SLSF+NA++NA  
Sbjct: 4   LRTFGVSLLVTAAALVLGY---------AYGGPKSLYLLLVLAALEVSLSFDNAVINAAV 54

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP-------- 122
           L++MS  WQ+ FLT GIL+AVFGMR++FP++IV   + ++P+ A+ LA+  P        
Sbjct: 55  LKQMSRFWQRMFLTIGILVAVFGMRLLFPLLIVWATAGLDPVRALELALRPPPHGALEFP 114

Query: 123 ---QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                Y K+++ AH  I+ FGG FL+M+ L F       + W+ ++E+  + + ++  + 
Sbjct: 115 DGSPSYQKLLTAAHPQIAAFGGIFLLMLFLDFLLI-DRDIKWLKWIEVPFARIGRLGQVS 173

Query: 180 IFI--VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVL-----SSDSSNNVT 232
           + +  +  ++ G      + E  + +++    ++ +  +N L                  
Sbjct: 174 VVLSGLTLVLVGTGLTHSSQEAVTVLTAGLLGMVAYLVVNGLSRAFRPSGVGQPQPAGPA 233

Query: 233 HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNF-FIIVIGLTIGAIYVRSMTLLMLKQG 291
            G  GL+LFLYLE++DA+ S DGV  +FAIT +   I++    +GA++VRS+T+ ++ Q 
Sbjct: 234 TGWAGLSLFLYLEVLDAAFSFDGVTGAFAITSDPVVIVLGLGVVGAMFVRSITIYLVHQE 293

Query: 292 ILNKYKYLEHGSYYSIFVLSVIMF--LQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            L++Y YLEHG++++I  L+VIM   ++  + +PE  T +     I  ++  S+  +
Sbjct: 294 TLDRYVYLEHGAHWAIGALAVIMLASIEPRLTVPEPVTASVGVFFIGTAVGFSVLRR 350


>gi|118475138|ref|YP_891227.1| hypothetical protein CFF8240_0017 [Campylobacter fetus subsp. fetus
           82-40]
 gi|118414364|gb|ABK82784.1| integral membrane protein [Campylobacter fetus subsp. fetus 82-40]
          Length = 325

 Score =  178 bits (451), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 124/334 (37%), Positives = 195/334 (58%), Gaps = 17/334 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  + ++T+ G L    I         G    VYIC +L ++E+SLSF+NA++NAK 
Sbjct: 1   MKYFYSSFIITILGLLLAYFI---------GGFLAVYICFLLGILEVSLSFDNAVVNAKI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L  M+  WQ RF+ +GI IAVFGMR +FPI+IV + + +   E  +LA+  P  Y   +S
Sbjct: 52  LSGMNKKWQDRFIIFGIPIAVFGMRFLFPILIVSVAANLGMWETFSLALNDPDAYHNALS 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
                I  FGG FL+MV L+FFF  +  + WI F+E         K   I + ++I+ G+
Sbjct: 112 ANKNQIYIFGGAFLLMVFLSFFFE-EKDVKWIRFIEDNYLVHILSKTNSIALFIAILTGM 170

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
             +  T +  S+  S   A+++   ++  + + S++        K G   FL+LE++DAS
Sbjct: 171 IIVFLT-QNTSYALSYFGAVLLHMALSLFDDIFSANG------VKSGFMGFLHLEVLDAS 223

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+++N FII+IGL IGA++VRS+T+ M+ +  L  + YLEHG++Y+I  L
Sbjct: 224 FSFDGVIGAFAMSENIFIIMIGLGIGAMFVRSLTIYMVHKKTLESFIYLEHGAHYAILAL 283

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           ++IMF+    ++ E  TGT    LI ++  SSI 
Sbjct: 284 AIIMFINVFHEVGEAITGTIGFGLIVIAFLSSIY 317


>gi|227549071|ref|ZP_03979120.1| tellurium resistance protein [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227078853|gb|EEI16816.1| tellurium resistance protein [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 393

 Score =  177 bits (448), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 49/359 (13%), Positives = 110/359 (30%), Gaps = 86/359 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            ++   SL     W         L G  I W +    +    T Y+       E +LS +
Sbjct: 31  KDAHEPSLKESGFWTAFYVTIALLFGGVIWWLWDGEHAAQYYTGYVT------EKALSVD 84

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A  +        +Q++ L  GI+IA+  MR+IF ++   +++             
Sbjct: 85  NLFVFALIMGAFKIPRKYQQKVLLLGIVIALI-MRLIFILLGAAVIA------------- 130

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   +      FL+  ++   ++                          
Sbjct: 131 -----------AWSDVFYLFAIFLIWTAIKLAYDEATDQE-------------------- 159

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             +   +         ++G   +       +             
Sbjct: 160 ----------ETDPNDMFIVKALRRVFPVTKSYHGDKLVSV-----TQTGKKALTPLFIA 204

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +  +D   +LD + + + IT   FI+        + +R M    L  G+L++  YL 
Sbjct: 205 LLAIGFVDVMFALDSIPAIYGITSEPFIVFTTNAFALLGLRQM--YFLLDGLLDRLVYLS 262

Query: 301 HGSYYSIFVLSVIMFLQTIVD-------------IPEI---FTGTSSTILIFLSIYSSI 343
           +G    +  + + + L  + +             +PEI    + +    ++ +++ +S+
Sbjct: 263 YGLAIILGFIGIKLLLHALHENNLPFINGGENVTVPEIGTFTSLSVIIGVLVVTVVASL 321


>gi|116511931|ref|YP_809147.1| hypothetical protein LACR_1193 [Lactococcus lactis subsp. cremoris
           SK11]
 gi|116107585|gb|ABJ72725.1| hypothetical protein LACR_1193 [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 339

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 126/346 (36%), Positives = 199/346 (57%), Gaps = 22/346 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR +I+V++   +              G  + ++I +ILAV+EISLS +NAI+NA+ 
Sbjct: 1   MKIFRGSIIVSLIALIIAFIY---------GGWNGLFITLILAVLEISLSMDNAIVNARI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQDY 125
           L++MS  WQK FLT G+LIAV GMR++FP++IV + + I+PI A+ LA+      +   Y
Sbjct: 52  LERMSPAWQKTFLTLGVLIAVVGMRLVFPLLIVGVSAQIDPISALRLALEKGNPSTAGTY 111

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
             I+  AH  I+ FGG FL+M++L FFF+      W+   E  +  +         I + 
Sbjct: 112 GYILHHAHPQIAAFGGMFLLMLALGFFFD-DRAHTWLKLPEKFLQKIGHFPAANAIISII 170

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-----VTHGKHGLNL 240
           I+   S  +  +  ++ + +    I+ F  ++     +S   +       V  GK GL L
Sbjct: 171 ILLITSEFIAKD-SHAVLFAGILGILTFMLVDGFGETMSHSKAATSTHFVVATGKAGLAL 229

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIG-LTIGAIYVRSMTLLMLKQGILNKYKYL 299
           FLYLE+IDAS S DGVI +FAIT +  II++G   IGA++VRS+TL ++++G LN   YL
Sbjct: 230 FLYLEVIDASFSFDGVIGAFAITADPIIILLGLGVIGAMFVRSLTLYLVQKGTLNDLVYL 289

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           EHG++++I  L+ ++ +    +I E+ TG +  ILI LS  SS+  
Sbjct: 290 EHGAHWAILTLAFLILVSIKWEIGEVVTGLTGAILIILSFVSSVIY 335


>gi|326383858|ref|ZP_08205542.1| hypothetical protein SCNU_13023 [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326197317|gb|EGD54507.1| hypothetical protein SCNU_13023 [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 351

 Score =  176 bits (446), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 114/350 (32%), Positives = 200/350 (57%), Gaps = 23/350 (6%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
            +  F  + +V++A  +              G  + + + +IL V+E+SLSF+NA++NA 
Sbjct: 2   TLRVFGMSFVVSIAALIAAFLY---------GGTTAMVLTLILGVLEVSLSFDNAVINAT 52

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP----QDY 125
            L +MS  WQK FLT G++IAVFGMR++FP+MIV + + +NP++A++LA+  P      Y
Sbjct: 53  VLARMSEFWQKMFLTVGVIIAVFGMRLLFPLMIVWVTAGLNPVDALDLALNPPTDGSPTY 112

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
             I++ AH  I+ F G   +++    F     +L W+ ++E  +    K++GI + + LS
Sbjct: 113 ESIVTAAHPQIASF-GGMFLLMLFLGFLFEDRELTWLSWIERPLQRAGKLRGISVVVALS 171

Query: 186 IIFGISNIL-PTNEMYSFVSSSTAAIIIFYGINFLESVL-------SSDSSNNVTHGKHG 237
           ++   +  + P +E  + + S    +I +  +N    +           S      G+ G
Sbjct: 172 LLVLTATYIAPDDETSTVMISGALGLITYIVVNGFGELFHVEEESSGGPSGLVKATGRAG 231

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKY 296
             LFLYLE++DAS S DGVI +FAIT +  II +GL  IGA++VRS+T+ ++ +G L++Y
Sbjct: 232 FFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGLGLIGAMFVRSITIYLVHRGTLSEY 291

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            +LEHG++++I  L++I+      D+PE+ TG +    I  ++ +S+  +
Sbjct: 292 VFLEHGAHWAIGALALILLYSLGTDVPELVTGLTGLCFILAALATSLWYR 341


>gi|125624286|ref|YP_001032769.1| hypothetical protein llmg_1480 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|124493094|emb|CAL98058.1| putative membrane protein [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300071068|gb|ADJ60468.1| hypothetical protein LLNZ_07620 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 339

 Score =  176 bits (446), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 126/346 (36%), Positives = 199/346 (57%), Gaps = 22/346 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR +I+V++   +              G  + ++I +ILAV+EISLS +NAI+NA+ 
Sbjct: 1   MKIFRGSIIVSLIALIIAFIY---------GGWNGLFITLILAVLEISLSMDNAIVNARI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQDY 125
           L++MS  WQK FLT G+LIAV GMR++FP++IV + + I+PI A+ LA+      +   Y
Sbjct: 52  LERMSPAWQKTFLTLGVLIAVVGMRLVFPLLIVGVSAQIDPISALRLALEKGNPSTAGTY 111

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
             I+  AH  I+ FGG FL+M++L FFF+ +    W+   E  +  +         I + 
Sbjct: 112 GYILHHAHPQIAAFGGMFLLMLALGFFFD-ERAHTWLKLPEKFLQKIGHFPAANAIISII 170

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-----VTHGKHGLNL 240
           I+   S  +     ++ + +    I+ F  ++     +S   +       V  GK GL L
Sbjct: 171 ILLITSEFIAKE-SHAVLFAGILGILTFMLVDGFGETMSHSKAATSTDFVVATGKAGLAL 229

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIG-LTIGAIYVRSMTLLMLKQGILNKYKYL 299
           FLYLE+IDAS S DGVI +FAIT +  II++G   IGA++VRS+TL ++++G LN   YL
Sbjct: 230 FLYLEVIDASFSFDGVIGAFAITADPIIILLGLGVIGAMFVRSLTLYLVQKGTLNDLVYL 289

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           EHG++++I  L+ ++ +    +I E+ TG +  ILI LS  SS+  
Sbjct: 290 EHGAHWAILTLAFLILVSIKWEIGEVVTGLTGAILIILSFVSSVIY 335


>gi|148927769|ref|ZP_01811201.1| protein of unknown function DUF475 [candidate division TM7
           genomosp. GTL1]
 gi|147886881|gb|EDK72419.1| protein of unknown function DUF475 [candidate division TM7
           genomosp. GTL1]
          Length = 344

 Score =  176 bits (446), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 119/350 (34%), Positives = 198/350 (56%), Gaps = 14/350 (4%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           MK+ S  A+L+  +  A  VT+                L G  + ++  I+L  +E + S
Sbjct: 1   MKNTSSRAALLKIYWLAASVTLL---------IWLGAALWGGFTALFTVIVLTFLETTFS 51

Query: 61  FENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
            +NA++N+K L  MS  WQK F+T GI IAVF +R + PI+IV + + +   E + LAI 
Sbjct: 52  ADNAVVNSKVLASMSPRWQKLFMTLGIFIAVFLVRFLVPILIVVLTAGLGSTEVIQLAIN 111

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
            P  Y + +++A   IS FGGTFL+M++L++F + + + HW+ FLE  +  L +   + I
Sbjct: 112 EPHRYEQELAKAEPIISAFGGTFLLMIALSYFVDYEKQSHWLKFLERRLGKLGRFDDLTI 171

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN----NVTHGKH 236
           F++L    G+   +      + + +S AA+++  G+N LE++   +           G  
Sbjct: 172 FVMLLAALGLFFTVERAYHTAVLIASIAAMVLHIGLNLLEALFEKNKKGLFSIKPKVGGA 231

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
            L  FLYLEI+DAS S DGVI +FAIT +  +I+ GL  GA++VR+MT+ +++   L KY
Sbjct: 232 ALAAFLYLEILDASFSFDGVIGAFAITGSVVLIMAGLGAGAVWVRAMTIHLVRAKALTKY 291

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSIKN 345
            +LEHG+++++  L ++M L+    + PE F G +  ++I  SI  S + 
Sbjct: 292 VFLEHGAHWALVFLGLVMLLKLYHIEFPEWFVGLAGIVVIAFSIVWSRRW 341


>gi|116512028|ref|YP_809244.1| hypothetical protein LACR_1294 [Lactococcus lactis subsp. cremoris
           SK11]
 gi|116107682|gb|ABJ72822.1| hypothetical protein LACR_1294 [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 355

 Score =  176 bits (446), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 123/330 (37%), Positives = 193/330 (58%), Gaps = 25/330 (7%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
           + G +  + +  IL ++E+SLSF+NAI+NA+ L++MS  W+  FLT G+LIAV GMR IF
Sbjct: 20  VYGGVDALVLATILGIMEVSLSFDNAIVNARILERMSHRWRNIFLTVGMLIAVLGMRFIF 79

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQ-----DYLKIISQAHVPISGFGGTFLMMVSLTFFF 153
           P+ +V I + ++P+EA++LA+          Y  I+  AH  I+ FGG FL+M++L FFF
Sbjct: 80  PLAVVSISAQLSPLEALHLAMEKGDPETIGTYGYILQHAHPMIAAFGGAFLLMLALNFFF 139

Query: 154 NSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIF 213
           +     HWI   E  +  + K       IVL ++ GIS  +  ++ Y    +  A ++++
Sbjct: 140 DEN-DYHWIVIPEKLLFRIGKFPMATPMIVLIVMMGISKWVS-SQSYLIFFAGAAGMVLY 197

Query: 214 YGINFLESVLSSDS-----------------SNNVTHGKHGLNLFLYLEIIDASLSLDGV 256
             +  L S++                        +  GK    LFLYLE+IDAS S DG 
Sbjct: 198 MAVEGLGSLMEHHGTLAEVTEEIENDEPLIAQTVLATGKQAFVLFLYLEMIDASFSFDGA 257

Query: 257 ISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF 315
           I +FAIT +  +I++GL  IGA++VRS+T+ ++++G LN + YL+HG++++I VLSV++ 
Sbjct: 258 IGAFAITSDPIVIMLGLGLIGAMFVRSLTVYLVEKGTLNDFVYLDHGAHWAILVLSVLLL 317

Query: 316 LQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +   V+IPEI TG    ILI  S  SS+  
Sbjct: 318 ISINVEIPEIITGLIGAILIGASFLSSVLY 347


>gi|270307614|ref|YP_003329672.1| membrane protein, TerC family [Dehalococcoides sp. VS]
 gi|270153506|gb|ACZ61344.1| membrane protein, TerC family [Dehalococcoides sp. VS]
          Length = 308

 Score =  176 bits (446), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 52/343 (15%), Positives = 114/343 (33%), Gaps = 74/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ +  +   + G  + +   + +     + YI       E+SLS +
Sbjct: 15  RRAHEVKTKEALIWSGVWILLALIFGGLVYFSLGNEIGLNYLSGYII------ELSLSVD 68

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +             +Q + L WGIL A+  MR +F +  + ++  ++          
Sbjct: 69  NLFVFIMIFSYFCIKREYQHKVLFWGILGAII-MRAVFIVAGITLIENLS---------- 117

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+   +    +   ++H                    
Sbjct: 118 --------------WVLYIFGAFLIYTGIRMVKDQNKEIHP------------------- 144

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N + +FV          +G +F          N        + +
Sbjct: 145 --------------DKNPLVNFVCRILPMTNKLHGDHFFI------KENGRKLATPLILV 184

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E +D   ++D + +  AIT + FI+        + +R+M   M   G++ K  YL 
Sbjct: 185 LVTIEAMDLVFAIDSIPAVMAITLDPFIVFTSNMFAVMGLRAM--YMALSGVIQKLHYLH 242

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  L + M +   V +P   + +   +++ +SI +S+
Sbjct: 243 YGLAAILSFLGIKMLISDFVHLPVALSLSVVAVILVISIAASL 285


>gi|256391404|ref|YP_003112968.1| hypothetical protein Caci_2208 [Catenulispora acidiphila DSM 44928]
 gi|256357630|gb|ACU71127.1| protein of unknown function DUF475 [Catenulispora acidiphila DSM
           44928]
          Length = 356

 Score =  176 bits (446), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 99/332 (29%), Positives = 178/332 (53%), Gaps = 14/332 (4%)

Query: 24  GFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFL 83
           G   G  +         G I +  +  +LAV+E++LSF+NA++NA  L++    WQ+ FL
Sbjct: 7   GVAYGATLLGLVLALWLGGIRSATVVAMLAVLEVALSFDNAVVNATVLRRFDLRWQRIFL 66

Query: 84  TWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTF 143
           T G+LIAVFGMR++ P+ ++  V+  +P   ++ +++ P  Y   I      I+ FGG F
Sbjct: 67  TVGVLIAVFGMRLVIPMAVLVAVTRQSPFHVLSSSVHDPNGYAHEILGVQPLIAAFGGVF 126

Query: 144 LMMVSLTFFFNSQNKLHWIHFLEIAMSHLSK------IKGIKIFIVLSIIFGISNILPTN 197
           L+M+++ FF +    L W+ F E  ++   +      ++  ++  V+  +F  +    T+
Sbjct: 127 LLMIAMDFFLSGH-DLIWLPFFERRLAAFGERFKPLALEAFQVVGVVLFLFVAAGTFATD 185

Query: 198 EMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNV-------THGKHGLNLFLYLEIIDAS 250
                  +    +  ++ I  L    +  S +           G+  L LF+YLE++DA+
Sbjct: 186 HPVGVPIAGVIGLATYFTIKRLSDAAADRSESLADEADETPPQGRQALMLFIYLEVLDAT 245

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S D V+  F++T +  +  IGL IGA YVRS+T+ ++++  L++Y YLEHG+YYSI VL
Sbjct: 246 FSFDSVMGGFSVTVDIALFTIGLGIGAAYVRSLTVFLVRKKTLDRYVYLEHGAYYSIGVL 305

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           +V++ ++   D+P+     + T +I  +   S
Sbjct: 306 AVLLLVEIGPDVPDWLASVAGTSMIVAAFIHS 337


>gi|254819880|ref|ZP_05224881.1| hypothetical protein MintA_08144 [Mycobacterium intracellulare ATCC
           13950]
          Length = 356

 Score =  176 bits (445), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 101/302 (33%), Positives = 174/302 (57%), Gaps = 21/302 (6%)

Query: 60  SFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           SF+NAI+NA  L++MS  W++ FLT GI+IAVFGMR++FP++IV   + I P+ AM LA+
Sbjct: 44  SFDNAIINAAILKRMSPFWRQMFLTVGIVIAVFGMRLLFPLVIVWATAGIGPVRAMELAL 103

Query: 120 YSP-----------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIA 168
           + P             Y K+I  AH  I+ FGG FL+M+ L F F     + W+ ++E+ 
Sbjct: 104 HPPPNGALEFADGSPSYEKMILSAHPQIAAFGGMFLLMLFLDFVF-HDRDIKWLKWIEVP 162

Query: 169 MSHLSKIKGIKIFI--VLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSD 226
            + + ++  + + +     ++ G       +E  + +++    ++ +  +N L       
Sbjct: 163 FARIGRLGQVSVVVAGATLVLVGSRLTHSADERATVLTAGVLGLVTYLVVNGLSRAFRPA 222

Query: 227 SSNNVT----HGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVR 281
           +   +T     G+ G  LFLYLE++DA+ S DGV  +FAIT +  +I +GL  IG+++VR
Sbjct: 223 NVEGMTVGEAVGRAGFTLFLYLEVLDAAFSFDGVTGAFAITSDPIVIALGLGLIGSMFVR 282

Query: 282 SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF--LQTIVDIPEIFTGTSSTILIFLSI 339
           S+T+ ++KQ  L++Y YLEHG++++I  L+VIM   +   + +PE  T +   + I  ++
Sbjct: 283 SITIYLVKQETLDRYVYLEHGAHWAIGALAVIMLGSIDPGLQVPEAVTASVGVVFIGAAL 342

Query: 340 YS 341
             
Sbjct: 343 GW 344


>gi|15827010|ref|NP_301273.1| hypothetical protein ML0205 [Mycobacterium leprae TN]
 gi|221229488|ref|YP_002502904.1| hypothetical protein MLBr_00205 [Mycobacterium leprae Br4923]
 gi|3097236|emb|CAA18813.1| putative membrane protein [Mycobacterium leprae]
 gi|13092557|emb|CAC29713.1| putative membrane protein [Mycobacterium leprae]
 gi|219932595|emb|CAR70298.1| putative membrane protein [Mycobacterium leprae Br4923]
          Length = 356

 Score =  176 bits (445), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 111/355 (31%), Positives = 190/355 (53%), Gaps = 29/355 (8%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILN 67
            +    F  ++L T    L              G ++++   I+LA+ E+SLSF+NAI+N
Sbjct: 1   MAAFRGFGISLLTTAIALLVAYIY---------GGLASLLPLIVLAIFEVSLSFDNAIIN 51

Query: 68  AKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSP----- 122
           A  L++MS  W+K FLT GILIA FGMR+IFP +IV   + ++P+  M+LA++ P     
Sbjct: 52  AAILKQMSRFWRKMFLTIGILIAAFGMRLIFPAVIVWATAKLDPVRTMDLALHPPPNHAL 111

Query: 123 ------QDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
                   Y K+I  AH  I+ FGGTFL+M+ L F F     + W+ ++E   + + ++ 
Sbjct: 112 EFPDGSPSYQKLIMSAHPQIAAFGGTFLLMLFLDFVFQ-DRDIKWLKWIEAPFTRIGRLG 170

Query: 177 GIKIF-IVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN----V 231
            + +  I + ++   +     +E    + +   +++ +  ++ L         +      
Sbjct: 171 PLSVVAIFVLVLIATALTHSGDERAKVLIAGLLSLVTYLLVSVLNRAFRPPDIDTASGRR 230

Query: 232 THGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLT-IGAIYVRSMTLLMLKQ 290
             G+ GL  FLYLEI+DA+ S DGV  +FAIT +  II +GL  I ++++RS+T+ ++ Q
Sbjct: 231 MAGRAGLVRFLYLEILDATFSFDGVTGAFAITSDPVIIALGLGLISSVFIRSITIYLVHQ 290

Query: 291 GILNKYKYLEHGSYYSIFVLSVIMFLQT--IVDIPEIFTGTSSTILIFLSIYSSI 343
             L++Y YLE+G++++I  LSV+M L      +I E  T     + I  ++  S+
Sbjct: 291 DALDRYVYLEYGAHWAIGALSVMMLLSVEPRFEILEAVTALVGVLFIGAALTWSV 345


>gi|281491592|ref|YP_003353572.1| hypothetical protein LLKF_1120 [Lactococcus lactis subsp. lactis
           KF147]
 gi|281375310|gb|ADA64823.1| Hypothetical protein LLKF_1120 [Lactococcus lactis subsp. lactis
           KF147]
          Length = 339

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 124/346 (35%), Positives = 197/346 (56%), Gaps = 22/346 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR + +V++   +                 + ++I +ILAV+EISLS +NAI+NA+ 
Sbjct: 1   MKIFRGSFIVSLIALIIAFVY---------AGWNGLFITLILAVLEISLSMDNAIVNARI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQDY 125
           L++MSS WQK FLT G+LIAV GMR+IFP++IV + + I+PI A+ LA+      +   Y
Sbjct: 52  LERMSSAWQKAFLTLGVLIAVLGMRLIFPLLIVGVSAQIDPISALKLALEKGNPNTVGTY 111

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
             I+  AH  I+ FGG FL+M++L FFF+ +    W+   E  +  +         I + 
Sbjct: 112 GYILHHAHPQIAAFGGMFLLMLALGFFFD-ERAHTWLKIPEKILQKIGNFPAANAIISII 170

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-----VTHGKHGLNL 240
           ++   S  +  +  ++ + +    I+ F  ++     +S   + N     V  GK GL L
Sbjct: 171 LLLITSEFIAKD-AHAVLFAGILGILTFMLVDGFGETMSHSKAANTTSSVVATGKAGLAL 229

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIG-LTIGAIYVRSMTLLMLKQGILNKYKYL 299
           FLYLE+IDAS S DGVI +FAIT +  II++G   IGA++VRS+TL ++++G LN   YL
Sbjct: 230 FLYLEVIDASFSFDGVIGAFAITADPIIILLGLGVIGAMFVRSLTLYLVQKGTLNDLVYL 289

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           EHG++++I  L+ ++      +I E+ TG    + I LS  SS+  
Sbjct: 290 EHGAHWAILTLAFLILASIKWEIGEVVTGLLGAVFIILSFISSVIY 335


>gi|289432194|ref|YP_003462067.1| integral membrane protein TerC [Dehalococcoides sp. GT]
 gi|288945914|gb|ADC73611.1| Integral membrane protein TerC [Dehalococcoides sp. GT]
          Length = 321

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 52/343 (15%), Positives = 107/343 (31%), Gaps = 74/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ +      + G  +             + YI       E+SLS +
Sbjct: 27  RRAHEVKTKEALVWSGVWIALALIFGGLVYSSLGSETGLNYLSGYII------ELSLSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +             +Q + L WGIL A+  MR +F    + ++  ++          
Sbjct: 81  NLFVFIMIFSYFCIKREYQHKVLFWGILGAII-MRAVFIAAGITLIENLS---------- 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+   +    +   ++H                    
Sbjct: 130 --------------WVLYIFGVFLIYTGIKMVKDQNKEIHP------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N + +FV          +G +F          N        + +
Sbjct: 157 --------------DKNPLVNFVCRILPMTNKLHGDHFFI------KENGRKLATPLILV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E +D   ++D + +  AIT + FII        + +R+M   M   G++ K  YL 
Sbjct: 197 LVSIEAMDLVFAVDSIPAVMAITLDPFIIFTSNIFAVMGLRAM--YMALSGVIQKLHYLH 254

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  L + M +     +P   +     +++ +SI +S+
Sbjct: 255 YGLAAILAFLGIKMLISDFFHMPVTASLGVVAVILAISIAASL 297


>gi|73748117|ref|YP_307356.1| TerC family membrane protein [Dehalococcoides sp. CBDB1]
 gi|147668819|ref|YP_001213637.1| integral membrane protein TerC [Dehalococcoides sp. BAV1]
 gi|73659833|emb|CAI82440.1| membrane protein, TerC family [Dehalococcoides sp. CBDB1]
 gi|146269767|gb|ABQ16759.1| Integral membrane protein TerC [Dehalococcoides sp. BAV1]
          Length = 321

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 52/343 (15%), Positives = 107/343 (31%), Gaps = 74/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ +      + G  +             + YI       E+SLS +
Sbjct: 27  RRAHEVKTKEALVWSGVWIALALIFGGLVYSSLGSETGLNYLSGYII------ELSLSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +             +Q + L WGIL A+  MR +F    + ++  ++          
Sbjct: 81  NLFVFIMIFSYFCIKREYQHKVLFWGILGAII-MRAVFIAAGITLIENLS---------- 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+   +    +   ++H                    
Sbjct: 130 --------------WVLYIFGVFLIYTGIKMVKDQNKEIHP------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N + +FV          +G +F          N        + +
Sbjct: 157 --------------DKNPLVNFVCRILPMTNKLHGDHFFI------KENGRKLATPLILV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E +D   ++D + +  AIT + FII        + +R+M   M   G++ K  YL 
Sbjct: 197 LVSIEAMDLVFAVDSIPAVMAITLDPFIIFTSNIFAVMGLRAM--YMALSGVIQKLHYLH 254

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  L + M +     +P   +     +++ +SI +S+
Sbjct: 255 YGLAAILAFLGIKMLISDFFHMPVTASLGVVAVILAISIAASL 297


>gi|159896549|ref|YP_001542796.1| integral membrane protein TerC [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159889588|gb|ABX02668.1| Integral membrane protein TerC [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 328

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 49/346 (14%), Positives = 109/346 (31%), Gaps = 75/346 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            NS   S+     W+++         +G+ +     ++    T Y+       E SLS +
Sbjct: 28  RNSHEVSVKEAAIWSVVWISLALTFNVGLYFWQGGDVALKFLTGYLI------EKSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +           + +Q R L WG+  A+  MR I   +                   
Sbjct: 82  NIFVFVLIFSYFQVPAKYQHRVLFWGVFGAL-VMRAILIFVGAA---------------- 124

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    I    G FL+   L  F   +  L                     
Sbjct: 125 --------LIERFEWIIYVFGAFLIYTGLKMFRQGETHLDP------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   V         ++G +F                     +
Sbjct: 158 --------------DNNPVVKLVRKVLPVTSEYHGEHFFTR------HAGKLMATPLFLV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   ++D + + FA+T + F++        + +RS+    +  G+++K+ YL+
Sbjct: 198 LVLVEASDLIFAVDSIPAIFAVTTDTFLVYTSNVFAILGLRSL--YFVLAGVVDKFYYLK 255

Query: 301 HGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIKN 345
           +G    +  +   M +  +   +P   +      ++ +++ +S++ 
Sbjct: 256 YGLAVILTFVGSKMLIIALGYHVPTPVSLAVIIGVLAVAVIASLRR 301


>gi|313683193|ref|YP_004060931.1| hypothetical protein Sulku_2071 [Sulfuricurvum kujiense DSM 16994]
 gi|313156053|gb|ADR34731.1| protein of unknown function DUF475 [Sulfuricurvum kujiense DSM
           16994]
          Length = 326

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 121/333 (36%), Positives = 200/333 (60%), Gaps = 17/333 (5%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +F  +  +   G +    +         G ++ +YI  +L V+EISLSF+NA++NAK 
Sbjct: 1   MRYFISSFAIMAMGLIAAFYL---------GGLTAIYITFLLIVLEISLSFDNAVVNAKV 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M  +WQKRF+ +GI IAVFGMR++FP+ IV IV+ +  +E + +A+  P +Y K++ 
Sbjct: 52  LETMDPVWQKRFIVFGIPIAVFGMRLVFPLAIVSIVTGMGLMETLQVAMNQPSEYEKVLK 111

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
                I  FGG FL+MV L FFF  +  + W+ F+E +    +      I ++ +I+ GI
Sbjct: 112 ATESTIFAFGGAFLLMVFLDFFFE-ERDIKWVTFVEGSKMMETFSGVANIELITAIMIGI 170

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
           +      + +  V +    +++   +  L+  LSSD+       K G+  F+YLE++DAS
Sbjct: 171 ALGH-ITQDFGVVLAFMYGVLLHSLLGMLDHFLSSDT------VKSGIAGFIYLEVLDAS 223

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            S DGVI +FA+T N FII+IGL +GA++VRS+TL  ++   L++++YLEHG++Y+I +L
Sbjct: 224 FSFDGVIGAFALTSNIFIIMIGLGVGAMFVRSITLYFVEHKTLSEFRYLEHGAHYAIGIL 283

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           ++IM ++    I E+ TGT    LI ++   SI
Sbjct: 284 AIIMLMKITTHISEMVTGTIGIGLITIAFLHSI 316


>gi|222148431|ref|YP_002549388.1| transporter [Agrobacterium vitis S4]
 gi|221735419|gb|ACM36382.1| transporter [Agrobacterium vitis S4]
          Length = 352

 Score =  173 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 53/346 (15%), Positives = 110/346 (31%), Gaps = 71/346 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            NS    +   F ++      G L G  I WQ          T +      V+E SL+ +
Sbjct: 59  KNSKEIGMAESFAFSAFYITLGVLFGGWIWWQSGPQAGLEYLTGF------VIEKSLAMD 112

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +GIL  V  +R I       IV              
Sbjct: 113 NIFVIAMIFGYFAIPRAYQHRVLLYGILG-VIILRGIMIAAGAAIV-------------- 157

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +++  +  F   FL+   +    ++ ++                      
Sbjct: 158 ----------ESYHWVLYFFAAFLVFTGVKMLLSADSEYD-------------------- 187

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                        +  N                 G  F+       +    T+    L  
Sbjct: 188 -------------VANNPALKLARRYLPVTDKLEGDRFVVRKQDETTGKLKTYITPLLLA 234

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E +D   ++D + + FAIT + +I+        + +R++        +++++ YL+
Sbjct: 235 LIMVEFVDLVFAVDSIPAIFAITTDPYIVYTSNIFAILGLRAL--YFALSALIHRFAYLK 292

Query: 301 HGSYYSIFVLSVIMFLQTIV---DIPEIFTGTSSTILIFLSIYSSI 343
           +     +  +   +FL  ++    IP + + T +  ++   I  S+
Sbjct: 293 YALSVVLIFIGSKIFLADMLGITKIPPLLSLTITLAILAAGIVGSL 338


>gi|288919864|ref|ZP_06414188.1| Integral membrane protein TerC [Frankia sp. EUN1f]
 gi|288348779|gb|EFC83032.1| Integral membrane protein TerC [Frankia sp. EUN1f]
          Length = 363

 Score =  173 bits (437), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 46/343 (13%), Positives = 101/343 (29%), Gaps = 74/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W++     G      I        +G  +  Y+      +E SLS +
Sbjct: 27  RKAHVIGFREAAWWSVGWVSLGITFAFVIWAWQGPGAAGEYTAAYL------LEKSLSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G+L A+  +R +F    +                 
Sbjct: 81  NLFVFALIFSYFKVPREYQHRVLFYGVLGAL-VLRFVFIAAGIT---------------- 123

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    +    G FL+  +     +    +                     
Sbjct: 124 --------LLEHFSFVIYIFGAFLLFTAFKMVRDDGVDMDPG------------------ 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           ++    +         + G +F+                  L +
Sbjct: 158 ---------------QSKAVKLLRKVMPVTDSYEGQHFVLRR------AGKLVATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   + D V ++  +T   F++     +  + +RS+    L  G++ K+ +L 
Sbjct: 197 LVAIETADVLFAFDSVPAALGVTNETFLVYTANALAILGLRSL--FFLLSGLMEKFHHLA 254

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V M L  +  +P   + T   +++  SI  S+
Sbjct: 255 TGLAVILAFIGVKMLLTDVWHMPIWLSLTVIAVVLAGSITWSL 297


>gi|15673075|ref|NP_267249.1| hypothetical protein L99421 [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12724049|gb|AAK05191.1|AE006341_10 conserved hypothetical protein [Lactococcus lactis subsp. lactis
           Il1403]
 gi|326406643|gb|ADZ63714.1| conserved hypothetical protein [Lactococcus lactis subsp. lactis
           CV56]
          Length = 339

 Score =  172 bits (436), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 123/346 (35%), Positives = 196/346 (56%), Gaps = 22/346 (6%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           +  FR + +V++   +                 + ++I +ILAV+EISLS +NAI+NA+ 
Sbjct: 1   MKIFRGSFIVSLIALIIAFVY---------AGWNGLFITLILAVLEISLSMDNAIVNARI 51

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI-----YSPQDY 125
           L++MS  WQK FLT G+LIAV GMR+IFP++IV + + I+PI A+ LA+      +   Y
Sbjct: 52  LERMSFAWQKAFLTLGVLIAVLGMRLIFPLLIVGVSAQIDPISALKLALEKGNPNTVGTY 111

Query: 126 LKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLS 185
             I+  AH  I+ FGG FL+M++L FFF+ +    W+   E  +  +         I + 
Sbjct: 112 GYILHHAHPQIAAFGGMFLLMLALGFFFD-ERAHTWLKIPEKILQKIGNFPAANAIISII 170

Query: 186 IIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNN-----VTHGKHGLNL 240
           ++   S  +  +  ++ + +    I+ F  ++     +S   + N     V  GK GL L
Sbjct: 171 LLLITSEFIAKD-AHAVLFAGILGILTFMLVDGFGETMSHSKAANTTSSVVATGKAGLAL 229

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIG-LTIGAIYVRSMTLLMLKQGILNKYKYL 299
           FLYLE+IDAS S DGVI +FAIT +  II++G   IGA++VRS+TL ++++G LN   YL
Sbjct: 230 FLYLEVIDASFSFDGVIGAFAITADPIIILLGLGVIGAMFVRSLTLYLVQKGTLNDLVYL 289

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           EHG++++I  L+ ++      +I E+ TG    + I LS  SS+  
Sbjct: 290 EHGAHWAILTLAFLILASIKWEIGEVVTGLLGAVFIILSFISSVIY 335


>gi|300087366|ref|YP_003757888.1| Integral membrane protein TerC [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527099|gb|ADJ25567.1| Integral membrane protein TerC [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 326

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 53/345 (15%), Positives = 104/345 (30%), Gaps = 74/345 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            ++          W ++      + GLGIG       +      Y+       E SLS +
Sbjct: 28  RHAHVLKFKEAIGWVVVWISLAIVFGLGIGVFSGWEHATDYFAAYVV------EESLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +             ++ R L WGI+ A+  MR  F    + +++             
Sbjct: 82  NLFVFLMLFTYFCVPREYRHRVLFWGIVGAIL-MRAGFIFGGIALIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   I    G FL+   +      +   H                    
Sbjct: 128 -----------AFHWIIYIFGAFLVFTGVRMGMKKEEDPHP------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   V         + G NF          N        L +
Sbjct: 158 --------------EANPVLKLVRRFLPMSQQYDGGNFFTV------ENGRRVATPLLAV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   ++D + +  +IT + FI+        + +RS+      +G  ++  YL 
Sbjct: 198 LVAVETTDIIFAVDSIPAVLSITTDPFIVFTSNMFAIMGLRSI--YFALEGFADRLYYLH 255

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +G    +  L   M +  +  +P   +     +++ +S+ +S+K 
Sbjct: 256 YGLAIILVFLGFKMLISGVYHMPTFLSLAVIFVVLGISVIASLKR 300


>gi|300780984|ref|ZP_07090838.1| possible tellurium resistance protein [Corynebacterium genitalium
           ATCC 33030]
 gi|300532691|gb|EFK53752.1| possible tellurium resistance protein [Corynebacterium genitalium
           ATCC 33030]
          Length = 391

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 48/359 (13%), Positives = 105/359 (29%), Gaps = 86/359 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     WA        + G  + WQ+         T YI       E+SLS +
Sbjct: 28  RTPHEPSMKESGGWAAFYMTMAAIFGGIVWWQWDAEHGVQFFTGYIT------ELSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A  +        +Q++ L  GI++A+   R+IF ++   I+S             
Sbjct: 82  NLFVFALIMGAFKIPRAYQQKVLLIGIVMAL-VFRLIFILLGAVIIS------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   +      FL+  ++   ++                          
Sbjct: 128 -----------AWSWVFYIFAAFLLYTAIKLVYDEATDQ--------------------- 155

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             +   +  +      ++G   +       +             
Sbjct: 156 ---------PETDPNDMLVVKTLRKAIPVTQSYHGDKLMSV-----TEAGKKAVTPLFVA 201

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +  ID   + D + + F IT   F++        + +R +    L  G+L+K  YL 
Sbjct: 202 LLAIGFIDVMFAFDSIPAIFGITTEPFLVFTANAFALLGLRQL--YFLLNGLLDKLVYLP 259

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + + + L  +                 +I  + +      ++ ++  +S+
Sbjct: 260 YGLAVVLVFIGIKLLLHALHENNLPFINGGEGFAVPEIGTVTSLVVIVGVLAITAIASL 318


>gi|319789385|ref|YP_004151018.1| protein of unknown function DUF475 [Thermovibrio ammonificans HB-1]
 gi|317113887|gb|ADU96377.1| protein of unknown function DUF475 [Thermovibrio ammonificans HB-1]
          Length = 332

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 109/307 (35%), Positives = 175/307 (57%), Gaps = 4/307 (1%)

Query: 39  LSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIF 98
               I  V+    L+++EISLSF+NA++NA  L  MS +W++RFLTWG++IAVFGMR +F
Sbjct: 23  AYMGIKGVFEGTTLSLLEISLSFDNAVMNAVILAGMSQLWRRRFLTWGMVIAVFGMRFLF 82

Query: 99  PIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNK 158
           P++IV + + +   + + LA   P+ Y   +  A   I  FGG FL+MV + + F++  +
Sbjct: 83  PVLIVAVTAGLPVTKVVELAFKEPEKYAHHLEHAEPLILAFGGAFLLMVFINWLFDAGKE 142

Query: 159 LHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINF 218
           L WI  LE   S  +K+  +K+ I LS+IF +  +     +   +        + + I  
Sbjct: 143 LFWIRKLEEMASKAAKMGEVKLIIALSVIFTVGYLKREPNIILALILGILLFEVVHFIKG 202

Query: 219 LESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAI 278
                             GL  F+YLE++DAS SLDG + +FAI+KN  II +GL++GA 
Sbjct: 203 AIEYFKEHGGA----VDAGLGSFIYLELLDASCSLDGTVGAFAISKNLIIITVGLSVGAF 258

Query: 279 YVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLS 338
            +R++TL  ++ G L +  YLEHG+++ I  L ++M L+  + IPE    + + + I  S
Sbjct: 259 ILRTLTLYFVESGKLKELPYLEHGAHWGIGGLGIMMLLELFIHIPEPVISSVALLFILSS 318

Query: 339 IYSSIKN 345
           +YSS+K 
Sbjct: 319 LYSSVKR 325


>gi|57235066|ref|YP_180932.1| TerC family membrane protein [Dehalococcoides ethenogenes 195]
 gi|57225514|gb|AAW40571.1| membrane protein, TerC family [Dehalococcoides ethenogenes 195]
          Length = 321

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 53/343 (15%), Positives = 111/343 (32%), Gaps = 74/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ +  +   + G  I +           + YI       E+SLS +
Sbjct: 27  RRAHEVKTKEALIWSGVWILLALIFGGLIYFSMGSEFGLNYLSGYII------ELSLSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +             +Q + L WGIL A+  MR +F    + ++  ++          
Sbjct: 81  NLFVFIMIFSYFCIKREYQHKVLFWGILGAII-MRAVFIAAGITLIENLS---------- 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+   +    +   ++H                    
Sbjct: 130 --------------WVLYIFGAFLIYTGIRMVKDQNQEIHP------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N + +FV          +G +F          N        + +
Sbjct: 157 --------------DKNPLVNFVCRILPMTNKLHGDHFFI------KENGRKLATPLILV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E +D   ++D + +  AIT + FI+        + +R+M   M   GI+ K  YL 
Sbjct: 197 LVTIEAMDLVFAIDSIPAVMAITLDPFIVFTSNIFAVMGLRAM--YMALSGIIQKLHYLH 254

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  L + M +   V +P   + +   +++ +S+ +S+
Sbjct: 255 YGLAAILSFLGIKMLISEFVHLPVALSLSVVAVILAVSVAASL 297


>gi|269839441|ref|YP_003324133.1| integral membrane protein TerC [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269791171|gb|ACZ43311.1| Integral membrane protein TerC [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 313

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 51/345 (14%), Positives = 109/345 (31%), Gaps = 74/345 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   S+     W+ +    G   G  I   F  T +G     Y+       E SLS +
Sbjct: 28  REAHVVSMREAATWSAIWVAMGLAFGGLIWVWFGPTAAGEYLAGYLI------EKSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A         + +Q R L WG++ A+                         L   
Sbjct: 82  NVFVFALIFSYFAVPAAYQHRVLFWGVVGAI-------------------------LMRA 116

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
           +       + +A   I    G  L++  +        ++H                    
Sbjct: 117 AFIAAGAALLEAFHWIIYVFGALLVVTGVRMATRRHEEVHP------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   V      +  +    F                   L +
Sbjct: 158 --------------EQNPILRLVRRLIPMLPEYRSQRFFIR------EGGRLWATPLLAV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   ++D + + FA+T+  F++        + +R++    L  G+++++ YL+
Sbjct: 198 LIVVETTDVIFAIDSIPAIFAVTREPFLVFTSNAFAILGLRAL--YFLLAGMMHRFVYLK 255

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +G    +  +   M L  I  +P   +    ++L+ +S+ +S++ 
Sbjct: 256 YGLAGILVFVGAKMLLSDIYKVPIWISLAVISVLVGVSVVASLRA 300


>gi|291301232|ref|YP_003512510.1| Integral membrane protein TerC [Stackebrandtia nassauensis DSM
           44728]
 gi|290570452|gb|ADD43417.1| Integral membrane protein TerC [Stackebrandtia nassauensis DSM
           44728]
          Length = 399

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 45/362 (12%), Positives = 98/362 (27%), Gaps = 91/362 (25%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S      W           G G+         G     +I       E S+S
Sbjct: 26  IGRRPHEPSTKEATLWVAFYLGLAAAFGAGVWLFSEPRYGGEFFAGWIT------EYSMS 79

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    +        +Q++ L  GI++A+  +R +F  +   +V+           
Sbjct: 80  VDNLFVFILIMSSFAVPRKYQQKVLMIGIIMALI-LRAVFIGIGAGLVNQ---------- 128

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                          V +    G FL+  ++       N                     
Sbjct: 129 --------------FVWVFFIFGAFLIFTAIQLLRGDDNDDENY---------------- 158

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N +  +          + G      V      N        L
Sbjct: 159 -----------------ENAVIRWTRRVVPVSKDYDGAKITTKV------NGRRVATPML 195

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + +   D   ++D + ++F +TK  F++        + +R +    L  G+L +  Y
Sbjct: 196 IVMVAIGSADLLFAVDSIPATFGLTKEAFLVFTVNVFALMGLRQL--YFLLGGLLQRLVY 253

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYS 341
           L +G    +  + V +    +                  DI    +      ++ ++  +
Sbjct: 254 LNYGLAAILGFIGVKLVFHALHDNDVPFINGGKPVPGIPDINTWVSLGVIVGILVVATVA 313

Query: 342 SI 343
           S+
Sbjct: 314 SL 315


>gi|116696037|ref|YP_841613.1| tellurium resistance protein TerC [Ralstonia eutropha H16]
 gi|113530536|emb|CAJ96883.1| Membrane protein TerC, possibly involved in tellurium resistance
           [Ralstonia eutropha H16]
          Length = 339

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 52/344 (15%), Positives = 116/344 (33%), Gaps = 70/344 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLS 60
            ++   S      W +  +    L G+ + W    +     +   +       ++E+SLS
Sbjct: 31  RHAHRVSTREALGWTLAWSTLAVLFGIALWWLLAGSAGRETADRKVLEFYTGYLIELSLS 90

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A            Q+R L +G++ A   MR +  ++ V ++S  +        
Sbjct: 91  VDNMFVFAMIFGYFAVPPELQRRVLLFGVVGA-IVMRAVMILLGVWLISEFS-------- 141

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            I    G FL+   +   F S+                      
Sbjct: 142 ----------------WILYVFGVFLLFTGIKMLFVSRR--------------------- 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                       +  L  N +  F+ +       ++G +F   V      + + H     
Sbjct: 165 ------------APDLSRNPIVRFLCAHMRITADYHGEHFFVRV------DGLRHATPMF 206

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +E  D   ++D + + FA+T + FI+        + +R++    L   +   + Y
Sbjct: 207 LVVLLVEATDLVFAVDSIPAIFAVTTDPFIVFTSNIFAIMGLRAL--YFLLANLAQHFHY 264

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           L++G    +  +   M  +    +P  ++  +  + +F+S+  S
Sbjct: 265 LKYGLAIVLAFIGAKMLAEPWFHVPVHWSLGAVAMTLFVSVLVS 308


>gi|86740333|ref|YP_480733.1| integral membrane protein TerC [Frankia sp. CcI3]
 gi|86567195|gb|ABD11004.1| Integral membrane protein TerC [Frankia sp. CcI3]
          Length = 334

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 44/344 (12%), Positives = 103/344 (29%), Gaps = 74/344 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W++L    G      I        +G  +  ++      +E SLS +
Sbjct: 27  RRAHVIGFREAAWWSVLWVSLGIGFAGVIWAWQGPGPAGEYAAAWL------LEKSLSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G+L A+  +R +F    +                 
Sbjct: 81  NLFVFALIFSYFKVPRAYQHRVLFYGVLGAL-VLRFLFIAAGIA---------------- 123

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    +    G FL+  ++T       ++                     
Sbjct: 124 --------LLERFSFVIYVFGAFLLYTAVTMLRGDGVEMDPGR----------------- 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +   + +         + G  F+                  L +
Sbjct: 159 ----------------SRAVALLRKVIPVTDDYQGQRFVFRR------AGKLVATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   + D V ++  +T   F++     +  + +RS+    L  G++ ++ +L 
Sbjct: 197 LVVIETADVLFAFDSVPAALGVTDKVFLVYTSNALAILGLRSL--FFLLSGLMERFHHLA 254

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
            G  + +  + V M L  +   P   +     + + ++I  S++
Sbjct: 255 TGLAFILAFIGVKMLLTDVWHPPIALSLGVIVVTLIVAIVWSLR 298


>gi|209966627|ref|YP_002299542.1| Integral membrane protein TerC family [Rhodospirillum centenum SW]
 gi|209960093|gb|ACJ00730.1| Integral membrane protein TerC family [Rhodospirillum centenum SW]
          Length = 359

 Score =  169 bits (427), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 45/346 (13%), Positives = 101/346 (29%), Gaps = 68/346 (19%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +        +      +    +     G  + W    T      T +       +E +L+
Sbjct: 38  LNRKDHEIGVKESLWLSAFYILIAVAFGGWLWWYMGPTPGMQYFTGF------ALEKALA 91

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + +          ++Q R L WGIL  V  +R +   +   +V+  +        
Sbjct: 92  LDNVFVISLIFSYFAIPRLYQHRVLFWGILG-VILLRGLMIGLGAALVTRFD-------- 142

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL+   +     S  +                    
Sbjct: 143 ----------------WVLYIFGAFLLATGVKMLLMSGEEE------------------- 167

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +   +          +G +F        S           
Sbjct: 168 -------------TDLSKNRLLMALKRRVPVTDRLHGNSFFVREPDPVSGRLKRVATPLF 214

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              L +EI D   ++D V + FAIT + FI+        + +R++        ++++++Y
Sbjct: 215 LALLMVEIADLVFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAAMVHRFRY 272

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
           L++     +  +   +F   I   +    + + +  L+   +  S+
Sbjct: 273 LKYALSLVLVFIGAKIFWNQIYGKVDPAISLSVTFALLASGVLYSL 318


>gi|254240979|ref|ZP_04934301.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|126194357|gb|EAZ58420.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
          Length = 347

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 52/345 (15%), Positives = 108/345 (31%), Gaps = 69/345 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           + +     +      +      G   G  + + F  T +    T ++       E SLS 
Sbjct: 39  QRDHHEIGVRESLLLSAGYFACGLAFGGWVWYAFGPTSAVEYYTGFLV------EQSLSM 92

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A           +Q + L WGIL A   +R I   +   +V             
Sbjct: 93  DNVFVMAMIFSFFGIPRRYQHQVLFWGILGA-IVLRAIMIGLGAALV------------- 138

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                      +    I    G FL+   +   FN   +                     
Sbjct: 139 -----------KEFDWIMYVFGAFLLFSGVKMLFNKHEEE-------------------- 167

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         L  N +  F+          +  +F   +  + S   V +      
Sbjct: 168 ------------PDLEHNPVLRFLRKHMRVTKELHEHHFFVRLPDA-SGKLVRYATPLFF 214

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + +E+ D   ++D V + FAIT++ FI+        + +R++        +++++ YL
Sbjct: 215 ALVLIELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRAL--YFSLAAMIHRFVYL 272

Query: 300 EHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
           ++     +  +   + L  ++  IP   +   +  L+   I  S+
Sbjct: 273 KYALALVLVFIGTKIMLHGVIGKIPAGLSLGVTFGLLAGGILLSL 317


>gi|34557555|ref|NP_907370.1| hypothetical protein WS1186 [Wolinella succinogenes DSM 1740]
 gi|34483272|emb|CAE10270.1| INTEGRAL MEMBRANE PROTEIN [Wolinella succinogenes]
          Length = 333

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 115/336 (34%), Positives = 190/336 (56%), Gaps = 15/336 (4%)

Query: 11  IHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKN 70
           + +FR++ ++ + G L              G +   YI  +LA++E+S+SF+NA++NAK 
Sbjct: 7   MKYFRFSFVLALVGVLVAYFF--------LGGLYAAYIVALLALLEVSISFDNAVINAKV 58

Query: 71  LQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIIS 130
           L+ M+  W++RF+ +GI IAVFG+R I PI+IV + S    IE +NLA+     Y + + 
Sbjct: 59  LEGMTPKWRERFIIYGIPIAVFGVRFILPIIIVSLASGEGMIEILNLALSDAALYAEKLE 118

Query: 131 QAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGI 190
                I  FGG FL+MV L FFF+   ++ W+  LE       +I  I    +L  I   
Sbjct: 119 GVMGKIYAFGGAFLLMVFLEFFFDEDREVVWLRRLEQN-RITQRISQINFIELLVAILVG 177

Query: 191 SNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDAS 250
             +   +       +    I ++  I  ++  L           + G+  FLYLE++DAS
Sbjct: 178 VVLSFLSGELGVSLAYFIGIALYALIRGIDHALIKGG------ARSGVIGFLYLEVLDAS 231

Query: 251 LSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVL 310
            SLDGVI +FA++ N FIIVIGL IGA +VRS+T+  +++ +L+++ YLEHG+ Y+I +L
Sbjct: 232 FSLDGVIGAFALSSNIFIIVIGLAIGAFFVRSLTIYFVEKKVLSEFIYLEHGARYAILIL 291

Query: 311 SVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +++MF+Q  + + E   G+   ++I  ++  SI +K
Sbjct: 292 ALMMFVQIFMHVSEAIVGSVGVVIILGALLHSIIHK 327


>gi|107101996|ref|ZP_01365914.1| hypothetical protein PaerPA_01003043 [Pseudomonas aeruginosa PACS2]
 gi|218891472|ref|YP_002440339.1| putative membrane protein, TerC family [Pseudomonas aeruginosa
           LESB58]
 gi|218771698|emb|CAW27472.1| putative membrane protein, TerC family [Pseudomonas aeruginosa
           LESB58]
          Length = 347

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 52/345 (15%), Positives = 108/345 (31%), Gaps = 69/345 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           + +     +      +      G   G  + + F  T +    T ++       E SLS 
Sbjct: 39  QRDHHEIGVRESLLLSAGYFACGLAFGGWVWYAFGPTSAVEYYTGFLV------EQSLSM 92

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A           +Q + L WGIL A   +R I   +   +V             
Sbjct: 93  DNVFVMAMIFSFFGIPRRYQHQVLFWGILGA-IVLRAIMIGLGAALV------------- 138

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                      +    I    G FL+   +   FN   +                     
Sbjct: 139 -----------KEFDWIMYVFGAFLLFSGMKMLFNKHEEE-------------------- 167

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         L  N +  F+          +  +F   +  + S   V +      
Sbjct: 168 ------------PDLEHNPVLRFLRKHMRVTKELHEHHFFVRLPDA-SGKLVRYATPLFF 214

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + +E+ D   ++D V + FAIT++ FI+        + +R++        +++++ YL
Sbjct: 215 ALVLIELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRAL--YFSLAAMIHRFVYL 272

Query: 300 EHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
           ++     +  +   + L  ++  IP   +   +  L+   I  S+
Sbjct: 273 KYALALVLVFIGTKIMLHGVIGKIPAGLSLGVTFGLLAGGILLSL 317


>gi|152988134|ref|YP_001348048.1| hypothetical protein PSPA7_2688 [Pseudomonas aeruginosa PA7]
 gi|150963292|gb|ABR85317.1| membrane protein, putative [Pseudomonas aeruginosa PA7]
          Length = 346

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 52/345 (15%), Positives = 108/345 (31%), Gaps = 69/345 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           + +     +      +      G   G  + + F  T +    T ++       E SLS 
Sbjct: 39  QRDHHEIGVRESLLLSAGYFACGLAFGGWVWYAFGPTSAVEYYTGFLV------EQSLSM 92

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A           +Q + L WGIL A   +R I   +   +V             
Sbjct: 93  DNVFVMAMIFSFFGIPRRYQHQVLFWGILGA-IVLRAIMIGLGAALV------------- 138

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                      +    I    G FL+   +   FN   +                     
Sbjct: 139 -----------KEFDWIMYVFGAFLLFSGVKMLFNKHEEE-------------------- 167

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         L  N +  F+          +  +F   +  + S   V +      
Sbjct: 168 ------------PDLEHNPVLRFLRKHMRVTKELHEHHFFVRLPDA-SGKLVRYATPLFF 214

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + +E+ D   ++D V + FAIT++ FI+        + +R++        +++++ YL
Sbjct: 215 ALVLIELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRAL--YFSLAAMIHRFVYL 272

Query: 300 EHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
           ++     +  +   + L  ++  IP   +   +  L+   I  S+
Sbjct: 273 KYALALVLVFIGAKIMLHGVIGKIPAGLSLGVTFGLLAGGILLSL 317


>gi|49087256|gb|AAT51437.1| PA2549 [synthetic construct]
          Length = 348

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 52/345 (15%), Positives = 108/345 (31%), Gaps = 69/345 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           + +     +      +      G   G  + + F  T +    T ++       E SLS 
Sbjct: 39  QRDHHEIGVRESLLLSAGYFACGLAFGGWVWYAFGPTSAVEYYTGFLV------EQSLSM 92

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A           +Q + L WGIL A   +R I   +   +V             
Sbjct: 93  DNVFVMAMIFSFFGIPRRYQHQVLFWGILGA-IVLRAIMIGLGAALV------------- 138

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                      +    I    G FL+   +   FN   +                     
Sbjct: 139 -----------KEFDWIMYVFGAFLLFSGVKMLFNKHEEE-------------------- 167

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         L  N +  F+          +  +F   +  + S   V +      
Sbjct: 168 ------------PDLEHNPVLRFLRKHMRVTKELHEHHFFVRLPDA-SGKLVRYATPLFF 214

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + +E+ D   ++D V + FAIT++ FI+        + +R++        +++++ YL
Sbjct: 215 ALVLIELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRAL--YFSLAAMIHRFVYL 272

Query: 300 EHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
           ++     +  +   + L  ++  IP   +   +  L+   I  S+
Sbjct: 273 KYALALVLVFIGAKIMLHGVIGKIPAGLSLGVTFGLLAGGILLSL 317


>gi|284990474|ref|YP_003409028.1| Integral membrane protein TerC [Geodermatophilus obscurus DSM
           43160]
 gi|284063719|gb|ADB74657.1| Integral membrane protein TerC [Geodermatophilus obscurus DSM
           43160]
          Length = 387

 Score =  168 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 41/360 (11%), Positives = 99/360 (27%), Gaps = 89/360 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +L     W+ +      + GL + W      +G     YI       E SLS +
Sbjct: 28  RTPHAPTLRESAIWSAVYVGIAVVFGLLVLWFSGGQYAGEYFAGYIT------EKSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI  A+  +R IF  +    +              
Sbjct: 82  NLFVFVLIMASFAVPRELQQKVLLFGIAFAL-VLRTIFIFVGAAAI-------------- 126

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +    I    G FL+  +     +  +                       
Sbjct: 127 ----------EQFSWIFYVFGGFLIWTAWAQARSGGHSHD-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N               ++    + ++          +       
Sbjct: 157 -----------EEFKENVALRLARKVFPTTDEYHSDRMVTTI------RGKRYITPLAIA 199

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   ++D + + F +T+  +++        + +R +    L  G+L++  YL 
Sbjct: 200 LVAIASADILFAVDSIPAIFGLTQETYLVFTANAFALLGLRQL--FFLIDGLLDRLVYLS 257

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + +  +                  ++P   + T     + ++  +S+
Sbjct: 258 YGLAVILGFIGVKLLIHALHENELPFINGGEHVTVVPEVPTWLSLTVILATLVVTTVASL 317


>gi|15597745|ref|NP_251239.1| hypothetical protein PA2549 [Pseudomonas aeruginosa PAO1]
 gi|254235541|ref|ZP_04928864.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|9948608|gb|AAG05937.1|AE004683_1 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126167472|gb|EAZ52983.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
          Length = 347

 Score =  168 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/345 (15%), Positives = 108/345 (31%), Gaps = 69/345 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           + +     +      +      G   G  + + F  T +    T ++       E SLS 
Sbjct: 39  QRDHHEIGVRESLLLSAGYFACGLAFGGWVWYAFGPTSAVEYYTGFLV------EQSLSM 92

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A           +Q + L WGIL A   +R I   +   +V             
Sbjct: 93  DNVFVMAMIFSFFGIPRRYQHQVLFWGILGA-IVLRAIMIGLGAALV------------- 138

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                      +    I    G FL+   +   FN   +                     
Sbjct: 139 -----------KEFDWIMYVFGAFLLFSGVKMLFNKHEEE-------------------- 167

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         L  N +  F+          +  +F   +  + S   V +      
Sbjct: 168 ------------PDLEHNPVLRFLRKHMRVTKELHEHHFFVRLPDA-SGKLVRYATPLFF 214

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + +E+ D   ++D V + FAIT++ FI+        + +R++        +++++ YL
Sbjct: 215 ALVLIELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRAL--YFSLAAMIHRFVYL 272

Query: 300 EHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
           ++     +  +   + L  ++  IP   +   +  L+   I  S+
Sbjct: 273 KYALALVLVFIGAKIMLHGVIGKIPAGLSLGVTFGLLAGGILLSL 317


>gi|329118520|ref|ZP_08247224.1| tellurium resistance protein TerC family protein [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327465255|gb|EGF11536.1| tellurium resistance protein TerC family protein [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 325

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 49/350 (14%), Positives = 103/350 (29%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYI----CIILAVVEI 57
           K+ S   S      W  +   A       + W+     +                 V+E 
Sbjct: 33  KNGSHKVSTKEALAWTAVWIAASCAFAGWLYWEIATNPAYGHELAKTKVMEYFTGYVLEK 92

Query: 58  SLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+  A+  +R +   +   +VS        
Sbjct: 93  SLAVDNLFVFLLIFGYFKIPPQYQHRILLYGVFGAII-LRAVMIFVGAVLVSRFE----- 146

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                               I    G FL+   +     S ++                 
Sbjct: 147 -------------------WILYLFGAFLLYTGIKMIRQSGDED---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  N +  ++           G  F          N      
Sbjct: 172 ----------------ADLSQNPILQWLQKHIRVSQTLDGEKFFTR------ENGRRLAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   + ++
Sbjct: 210 PLLLVLVMVELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADMADR 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L +G  + +  +   M L   + IP   +       +  S+ +S+  
Sbjct: 268 FVFLNYGLAFVLSFIGGKMLLLHWIHIPVAVSLAVVFGALGASVLTSLAY 317


>gi|167033092|ref|YP_001668323.1| integral membrane protein TerC [Pseudomonas putida GB-1]
 gi|166859580|gb|ABY97987.1| Integral membrane protein TerC [Pseudomonas putida GB-1]
          Length = 354

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 53/327 (16%), Positives = 105/327 (32%), Gaps = 68/327 (20%)

Query: 20  VTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--SSI 77
               G L G G+ +Q     +    T ++       E SLS +N  + A           
Sbjct: 57  YFSVGVLFGAGVWYQLGAQSALEFYTGFLV------EQSLSMDNVFVMAMIFSYFAIPRR 110

Query: 78  WQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPIS 137
           +Q R L WGIL  V  +R I   +   +V                        Q    + 
Sbjct: 111 YQHRVLFWGILG-VVLLRAIMIGVGAALV------------------------QNFAWVL 145

Query: 138 GFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN 197
              G FL+   +    + ++                                    L  N
Sbjct: 146 YIFGAFLLFTGVKMALSKEDSH--------------------------------PDLANN 173

Query: 198 EMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVI 257
            +  FV          +G +F         S  + +        + +E+ D   ++D V 
Sbjct: 174 PIIKFVRRHMRVTDQIHGSHFFIRQTPPGHSKALRYATPLFLALVLIELADLVFAVDSVP 233

Query: 258 SSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ 317
           + FAIT++ FI+        + +RS+        +++++ YL++     +  +   +F  
Sbjct: 234 AIFAITQDPFIVYTSNIFAILGLRSL--YFALSALMHRFVYLKYALALVLIFIGCKIFYH 291

Query: 318 TIV-DIPEIFTGTSSTILIFLSIYSSI 343
            +V  +P + +   +  L+   +  S+
Sbjct: 292 GMVGKVPALLSLGVTFGLLLGGVVVSL 318


>gi|148548465|ref|YP_001268567.1| integral membrane protein TerC [Pseudomonas putida F1]
 gi|148512523|gb|ABQ79383.1| Integral membrane protein TerC [Pseudomonas putida F1]
          Length = 354

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 56/340 (16%), Positives = 111/340 (32%), Gaps = 72/340 (21%)

Query: 7   YASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAIL 66
             SL+ +          G L G G+ +Q     +    T ++       E SLS +N  +
Sbjct: 48  RESLLRYSG----YFSVGVLFGAGVWYQLGAQSALEFYTGFLV------EQSLSMDNVFV 97

Query: 67  NAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQD 124
            A           +Q R L WGIL  VF +R I   +   +V                  
Sbjct: 98  MAMIFSYFAIPRRYQHRVLFWGILGVVF-LRAIMIGVGAALV------------------ 138

Query: 125 YLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVL 184
                 Q    +    G FL+   +    + ++                           
Sbjct: 139 ------QNFAWVLYIFGAFLLFTGVKMALSKEDS-------------------------- 166

Query: 185 SIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYL 244
                    L  N +  FV          +G +F      +  S  + +        + +
Sbjct: 167 ------RPDLANNPILKFVRRHMRVTDQIHGSHFFVRHTPAGHSKALRYATPLFLALVLI 220

Query: 245 EIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSY 304
           E+ D   ++D V + FAIT++ FI+        + +RS+        +++++ YL++   
Sbjct: 221 ELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRSL--YFALAALMHRFVYLKYALA 278

Query: 305 YSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
             +  +   +F   +V  +P + +   +  L+   +  S+
Sbjct: 279 LVLIFIGCKIFYHGMVGKVPALLSLGVTFGLLLGGVVISL 318


>gi|325294438|ref|YP_004280952.1| hypothetical protein Dester_0236 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064886|gb|ADY72893.1| protein of unknown function DUF475 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 329

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 110/304 (36%), Positives = 192/304 (63%), Gaps = 5/304 (1%)

Query: 41  GTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPI 100
             +  ++    L+++EISLSF+NA++NA  L  MS IW++RFLTWG++IAVFGMR +FP+
Sbjct: 25  MGVKGIFEGTTLSLLEISLSFDNAVMNAVVLSGMSYIWRRRFLTWGMIIAVFGMRFLFPV 84

Query: 101 MIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLH 160
           +IV + + I   +   +A  +P++Y   +  A   I  FGG+FL+MV + + F++  +L+
Sbjct: 85  LIVSLTAGIGIEKVTEMAFSNPEEYAHYLEIAEPLILSFGGSFLLMVFINWLFDAGKELY 144

Query: 161 WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLE 220
           WI FLE   + L+K+  IK+ + L+++F +  +   +   + + +    I++F  ++F++
Sbjct: 145 WIRFLEEKAAKLAKVGEIKLIVALTVVFIVGFLKKDS---NILLAMILGILLFELVHFIK 201

Query: 221 SVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYV 280
             +     N+++ G  GL  F+YLE++DAS SLDG + +FAI++N  II +GL++GA  +
Sbjct: 202 GAIEYFKRNSISSG--GLANFIYLELLDASCSLDGAVGAFAISQNLIIITLGLSVGAFIL 259

Query: 281 RSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
           RS+T+  ++ G L +  YLEHG+++ I  L ++M  Q    IPE    T + + I  S+Y
Sbjct: 260 RSLTVYFVESGKLRELPYLEHGAHWGIGGLGIMMLAQLFHHIPEPVISTVALVFILSSLY 319

Query: 341 SSIK 344
           +SI+
Sbjct: 320 TSIR 323


>gi|116050493|ref|YP_790688.1| TerC family protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296389027|ref|ZP_06878502.1| TerC family protein [Pseudomonas aeruginosa PAb1]
 gi|313107452|ref|ZP_07793640.1| putative membrane protein, TerC family [Pseudomonas aeruginosa
           39016]
 gi|115585714|gb|ABJ11729.1| putative membrane protein, TerC family [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|310880142|gb|EFQ38736.1| putative membrane protein, TerC family [Pseudomonas aeruginosa
           39016]
          Length = 347

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 52/345 (15%), Positives = 108/345 (31%), Gaps = 69/345 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           + +     +      +      G   G  + + F  T +    T ++       E SLS 
Sbjct: 39  QRDHHEIGVRESLLLSAGYFACGLAFGGWVWYAFGPTSAVEYYTGFLV------EQSLSM 92

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A           +Q + L WGIL A   +R I   +   +V             
Sbjct: 93  DNVFVMAMIFSFFGIPRRYQHQVLFWGILGA-IVLRAIMIGLGAALV------------- 138

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                      +    I    G FL+   +   FN   +                     
Sbjct: 139 -----------KEFDWIMYVFGAFLLFSGVKMLFNKHEEE-------------------- 167

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         L  N +  F+          +  +F   +  + S   V +      
Sbjct: 168 ------------PDLEHNPVLRFLRKHMRVTKELHEHHFFVRLPDA-SGKLVRYATPLFF 214

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + +E+ D   ++D V + FAIT++ FI+        + +R++        +++++ YL
Sbjct: 215 ALVLIELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRAL--YFSLAAMIHRFVYL 272

Query: 300 EHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
           ++     +  +   + L  ++  IP   +   +  L+   I  S+
Sbjct: 273 KYALALVLVFIGAKIMLHGVIGKIPAGLSLGVTFGLLAGGILLSL 317


>gi|294669744|ref|ZP_06734810.1| hypothetical protein NEIELOOT_01644 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308310|gb|EFE49553.1| hypothetical protein NEIELOOT_01644 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 330

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 107/350 (30%), Gaps = 70/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYI----CIILAVVEI 57
           K+ +   S      W+ +           + W+ +   +   +             V+E 
Sbjct: 38  KTGAHKVSTKEALLWSAIWIAVSCAFAGWLYWEISSNPAYGHNIAKTKVIEYFTGYVLEK 97

Query: 58  SLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +           S +Q R L +G+  A+  +R I   +   +VS        
Sbjct: 98  SLAVDNLFVFLMIFSYFKVPSQYQHRVLLYGVFGAII-LRTIMIFIGAVLVSRFE----- 151

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                               I    G FL+   +       ++                 
Sbjct: 152 -------------------WILYIFGAFLLYTGIKMVKQGGDEE---------------- 176

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  N++  ++           G  F          N      
Sbjct: 177 ---------------GEDLSQNKILQWLQKHIRVGKSLNGEKFFTV------ENGKRVAS 215

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   + ++
Sbjct: 216 PLLMVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNIFAILGLRAM--YFLLADMADR 273

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L +G  + +  + + M +   + IP   +       +  SI +S+  
Sbjct: 274 FVFLNYGLAFVLSFIGIKMLIIHWIPIPVTISLAVVFGALGASILTSLAY 323


>gi|26989161|ref|NP_744586.1| hypothetical protein PP_2438 [Pseudomonas putida KT2440]
 gi|24983998|gb|AAN68050.1|AE016437_7 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 354

 Score =  166 bits (421), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 54/327 (16%), Positives = 107/327 (32%), Gaps = 68/327 (20%)

Query: 20  VTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--SSI 77
               G L G G+ +Q     +    T ++       E SLS +N  + A           
Sbjct: 57  YFSVGVLFGAGVWYQLGAQSALEFYTGFLV------EQSLSMDNVFVMAMIFSYFAIPRR 110

Query: 78  WQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPIS 137
           +Q R L WGIL  VF +R I   +   +V                        Q    + 
Sbjct: 111 YQHRVLFWGILGVVF-LRAIMIGVGAALV------------------------QNFAWVL 145

Query: 138 GFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN 197
              G FL+   +    + ++                                    L  N
Sbjct: 146 YIFGAFLLFTGVKMALSKEDS--------------------------------RPDLANN 173

Query: 198 EMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVI 257
            +  FV          +G +F      +  S  + +        + +E+ D   ++D V 
Sbjct: 174 PILKFVRRHMRVTDQIHGSHFFVRHTPAGHSKALRYATPLFLALVLIELADLVFAVDSVP 233

Query: 258 SSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ 317
           + FAIT++ FI+        + +RS+        +++++ YL++     +  +   +F  
Sbjct: 234 AIFAITQDPFIVYTSNIFAILGLRSL--YFALAALMHRFVYLKYALALVLIFIGCKIFYH 291

Query: 318 TIV-DIPEIFTGTSSTILIFLSIYSSI 343
            +V  +P + +   +  L+   +  S+
Sbjct: 292 GMVGKVPALLSLGVTFGLLLGGVVISL 318


>gi|134100191|ref|YP_001105852.1| integral membrane protein TerC [Saccharopolyspora erythraea NRRL
           2338]
 gi|291006588|ref|ZP_06564561.1| integral membrane protein TerC [Saccharopolyspora erythraea NRRL
           2338]
 gi|133912814|emb|CAM02927.1| integral membrane protein TerC [Saccharopolyspora erythraea NRRL
           2338]
          Length = 310

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 51/342 (14%), Positives = 104/342 (30%), Gaps = 74/342 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   S+     W+ +    G   G+ +      T  G     Y+       E SL+ +
Sbjct: 29  RRAHVVSIREALGWSSIWLSLGLGFGVVVWLSQGGTAGGEYFAAYLV------EKSLAVD 82

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G+L A+  MR  F                      
Sbjct: 83  NVFVFALLFSYFAVPPQYQHRVLFYGVLGAL-VMRAGFIAAGA----------------- 124

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                  ++ +    I    G  L++  +    + + ++H                    
Sbjct: 125 -------VLLERFHWIIYVFGALLLLTGIKMARHREFEVHP------------------- 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N M             ++G  F                   L +
Sbjct: 159 --------------DRNPMVRLTRRLVPMTTEYHGQRFWIR------QAGRWLATPLLVV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   ++D + + FA+T + F++        + +R++    L  G ++++ YL 
Sbjct: 199 LVAVETTDLVFAVDSIPAVFAVTSDPFLVFTSNAFAILGLRAL--YFLLAGAMHRFTYLR 256

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           +G    +  +   M L  +  IP   + +    LI  +I +S
Sbjct: 257 YGLAAILVFVGAKMLLTDLYKIPIWISLSVIIALIGGAIAAS 298


>gi|170722233|ref|YP_001749921.1| integral membrane protein TerC [Pseudomonas putida W619]
 gi|169760236|gb|ACA73552.1| Integral membrane protein TerC [Pseudomonas putida W619]
          Length = 354

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 54/344 (15%), Positives = 108/344 (31%), Gaps = 68/344 (19%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                  +             G L G  + +Q     +    T ++       E SLS +
Sbjct: 40  RKEREIEMRESLLLYSGYFSVGVLFGAWVWYQLGAQSALEFYTGFLV------EQSLSMD 93

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L WGIL  VF +R I   +   +V              
Sbjct: 94  NVFVMAMIFGFFAIPRRYQHRVLFWGILGVVF-LRAIMIGVGATLV-------------- 138

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     Q    +    G FL+   +   F+ ++                       
Sbjct: 139 ----------QNFEWVLYIFGAFLLFTGVKMAFSKEDSH--------------------- 167

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                        L  N +  FV          +G +F   +     S  + +       
Sbjct: 168 -----------PDLANNPVLKFVRRHMRVTDQIHGSHFFVRLTPPGESKALRYATPLFLA 216

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E+ D   ++D V + FAIT++ FI+        + +RS+        +++++ YL+
Sbjct: 217 LVLIELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRSL--YFALSALMHRFVYLK 274

Query: 301 HGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
           +     +  +   +F   +V  +P + +   +  L+   +  S+
Sbjct: 275 YALALVLIFIGCKIFYHGMVGKVPALLSLGVTFGLLLGGVVVSL 318


>gi|262202127|ref|YP_003273335.1| integral membrane protein TerC [Gordonia bronchialis DSM 43247]
 gi|262085474|gb|ACY21442.1| Integral membrane protein TerC [Gordonia bronchialis DSM 43247]
          Length = 350

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 52/353 (14%), Positives = 113/353 (32%), Gaps = 84/353 (23%)

Query: 6   LYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAI 65
              SL     W+ +      + G  + WQ+  T  G     Y+       E +LS +N  
Sbjct: 31  HAPSLKESGAWSAVYITIALIFGGFVWWQWGGTYGGEYFAGYVT------EKALSVDNLF 84

Query: 66  LNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQ 123
           +    + K      +Q++ L  GI++A+  MR  F  +    ++                
Sbjct: 85  VFVIIMAKFAVPREYQQKVLLLGIVMAL-VMRGAFIAVGAAAIN---------------- 127

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV 183
                   A+  +    G FL+  ++     S + +                        
Sbjct: 128 --------AYSWVFYLFGAFLIFTAVKLLRESDDPV------------------------ 155

Query: 184 LSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLY 243
                        + +  FV     +   + G      V      N        L + + 
Sbjct: 156 ------THEEERESRLERFVKRYLRSHDQYDGDRLFTKV------NGKRLATPMLMVLIV 203

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           +   D   +LD + + + +T+  +++        + +R +    L  G+L++  YL  G 
Sbjct: 204 IGFTDVLFALDSIPAIYGLTQEPYLVFTANAFALMGLRQL--FFLLSGLLDRLVYLSFGL 261

Query: 304 YYSIFVLSVIMFLQTIVD-------------IPEIFTGTSSTILIFLSIYSSI 343
            + +  + V + L  + +             +PEI T  S  ++I   + +++
Sbjct: 262 SFILAFIGVKLVLHALHENTLPFINGGEHVSVPEISTPLSLGVIIGTLVITTV 314


>gi|298715265|emb|CBJ27914.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 421

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 47/329 (14%), Positives = 94/329 (28%), Gaps = 72/329 (21%)

Query: 21  TVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--SSIW 78
                  GL                 Y+       E SLS +N  +              
Sbjct: 123 IALSCGFGLATMLFRGRQSGLEFFAGYLV------EQSLSVDNLFVFLMTFDYFQVPLEH 176

Query: 79  QKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISG 138
           Q R LTWGI+ A+  MR +     V  V                        +    I+ 
Sbjct: 177 QGRVLTWGIVGAIL-MRGVMIAFGVAAV------------------------KRFQWITV 211

Query: 139 FGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNE 198
                L++ S      S+ + H                                 L  N 
Sbjct: 212 VFAAILLVSSYKLLVESEEEDH--------------------------------DLSQNT 239

Query: 199 MYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVIS 258
           +         A+  + G  F   +         T     L   + +E+ D   ++D + +
Sbjct: 240 LVRMSKRLVGAVDEYDGDRFFTRL----GGKGKTVATPLLLCLVCIELSDFVFAVDSIPA 295

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
              I+++ F++        + +RS+   ++    +++  YL+      +  +   M L+ 
Sbjct: 296 VLGISQDPFVVFTSNLFAIMGLRSI--YVIIAQAVSQLPYLKPAVALVLGFVGCKMLLEY 353

Query: 319 IV-DIPEIFTGTSSTILIFLSIYSSIKNK 346
           +  +I   ++      LI   +  S+  +
Sbjct: 354 VHINISTGWSLFVVLSLILGGVGLSLLAR 382


>gi|290962847|ref|YP_003494029.1| integral membrane protein [Streptomyces scabiei 87.22]
 gi|260652373|emb|CBG75506.1| putative integral membrane protein [Streptomyces scabiei 87.22]
          Length = 334

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 52/352 (14%), Positives = 112/352 (31%), Gaps = 78/352 (22%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+     W+ +        GLG+        +G     ++       E SLS
Sbjct: 21  IGRKPHDVSVKEAGIWSAVWIALAVAFGLGVLAFGGGGPAGEFFAGFVT------EKSLS 74

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + K    S +Q+R L  G+L+A+  +R +F      I+S           
Sbjct: 75  VDNLFVFVLIMAKFSVPSQYQQRVLMVGVLMAL-VLRAVFIAAGAAIIS----------- 122

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                        +   +    G FL+  +     +++   H                  
Sbjct: 123 -------------SFSWVFYLFGAFLVYTAWKLVQDARKSGH------------------ 151

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N++   V         ++G             N        L
Sbjct: 152 ------------EEEYEENKLLKAVEKRFGVADRYHGTRLWV------EENGRRVMTPML 193

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +   D   +LD + + + +T++ +I+        + +R +    L  G+L K  +
Sbjct: 194 VVMLAIGSTDVLFALDSIPAIYGLTQDPYIVFTANAFALMGLRQL--YFLIGGLLKKLVH 251

Query: 299 LEHGSYYSIFVLSVIMFLQTIV----DIPEI---FTGTSSTILIFLSIYSSI 343
           L +G    +  + V + L  +      +PEI   F+     +++ ++  +S+
Sbjct: 252 LSYGLSIILGFIGVKLVLHALHESGVHVPEITIPFSLGFIVLVLAVTTATSL 303


>gi|284034062|ref|YP_003383993.1| Integral membrane protein TerC [Kribbella flavida DSM 17836]
 gi|283813355|gb|ADB35194.1| Integral membrane protein TerC [Kribbella flavida DSM 17836]
          Length = 418

 Score =  165 bits (418), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 42/359 (11%), Positives = 99/359 (27%), Gaps = 90/359 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +    L     W+ +      L G+G        +       Y+       E +LS +
Sbjct: 28  RRAHVPQLREAAIWSSVYVGLALLFGVGTLIFGGGAMGSEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ ++   R  F ++   +++             
Sbjct: 82  NLFVFLIIMTSFRVPREDQQKVLLFGIMFSLVA-RTGFILLGSALIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G  L++ +         + H                    
Sbjct: 128 -----------TFAWVFYLFGLVLLITAGNMLRPQTEEAHS------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +             + G             N        L +
Sbjct: 158 --------------AQNVVVRLSRRLFRTTDNYDGDKLFTV------QNGRRVMTPMLLV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+N F++        + +R +    L  G+L++  YL 
Sbjct: 198 MVAIAGTDLMFALDSIPAIFGLTQNVFVVFTATAFSLLGLRQL--YFLLDGLLDRLIYLS 255

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V + L  +                 +I    + T    ++ +++ +S+
Sbjct: 256 FGLAAILGFIGVKLVLHALHENNVPFINDGEHVEVAEISTGLSLTVILAVLVVTVLASL 314


>gi|255325185|ref|ZP_05366291.1| tellurium resistance membrane protein [Corynebacterium
           tuberculostearicum SK141]
 gi|311739657|ref|ZP_07713492.1| tellurium resistance protein [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|255297750|gb|EET77061.1| tellurium resistance membrane protein [Corynebacterium
           tuberculostearicum SK141]
 gi|311305473|gb|EFQ81541.1| tellurium resistance protein [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 373

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 50/360 (13%), Positives = 106/360 (29%), Gaps = 83/360 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +L     W +       L G G+   + H       T Y+       E +LS +
Sbjct: 28  RTPHEPTLKESGFWTLFYVGIALLFGAGVWAIWDHEHGIQFLTGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A  +        +Q++ L  GI+IA+   R++F ++   +++             
Sbjct: 82  NLFVFALIMGAFKIPRKYQQKVLLIGIVIAL-ACRLVFILLGAAVIA------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   I      FL+  ++    +                          
Sbjct: 128 -----------AWSDIFYLFAIFLIYTAIKLIVDEIRD---------------------- 154

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             +   +         ++G   L   L   S             
Sbjct: 155 --------APETDPNDMGIIKLIRKVVHVTPRYHGDK-LTHRLEDSSGKRKFAFTPLFIA 205

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + + +ID   + D + + + IT   F++        + +R M    L  G+L++  YL 
Sbjct: 206 LVSIGLIDVMFAFDSIPAIYGITSEAFLVFTTNAFSLMGLRQM--YFLLDGLLDRLVYLP 263

Query: 301 HGSYYSIFVLSVIMFLQTIVD--------------IPE---IFTGTSSTILIFLSIYSSI 343
           +G    +  + V +    + +              IPE   I +      ++ +++ +SI
Sbjct: 264 YGLGIILGFIGVKLMFHALHENNLPFVNGGENVESIPEFSTITSLIVIVGVLVITVIASI 323


>gi|326428700|gb|EGD74270.1| integral membrane protein TerC [Salpingoeca sp. ATCC 50818]
          Length = 814

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 43/359 (11%), Positives = 93/359 (25%), Gaps = 60/359 (16%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             S    L     W+ +      L    +        +    T Y+      +E  LS +
Sbjct: 363 GRSRSVVLFDALVWSAIWIALALLFSGFVFISRGRGPALVWLTSYL------LEKFLSVD 416

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +           S +Q + L+WGI  A   +R +F    V                 
Sbjct: 417 NLFVFLTIFAAFRTPSQYQHKVLSWGIAGA-IVLRAVFIFTGV----------------- 458

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFN---SQNKLHWIHFLEIAMSHLSKIKG 177
                  ++ +    +    G FL+   +           +     F   +  HL     
Sbjct: 459 -------LLVEKFSWLLALFGVFLVYTGVRAIAETCSQDEEESMFGFDAGSSDHLPAAAL 511

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH---- 233
                +  +   I      +    F             +       S   ++ +      
Sbjct: 512 KNNLALSIVGSVIPVSRRYDPKGRFFVREDGGDDASMTLPVSTRAASRFRAHWIAAKNCL 571

Query: 234 -----------------GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIG 276
                                  + + +E  D   + D + +  +IT++ F+        
Sbjct: 572 SAPFRVCVRVCGLSGFKATPLFAVLVIVETTDMVFAADSIPAVLSITQDPFVAYTSNIFA 631

Query: 277 AIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTIL 334
            + +R++         + K++YL  G    +  +   + L  + V +    T       
Sbjct: 632 VLGLRAL--YFALAAAMTKFRYLGPGLGIILLFIGAKLLLVMVDVHVSVEATLLVVLGT 688


>gi|306836326|ref|ZP_07469306.1| tellurium resistance protein [Corynebacterium accolens ATCC 49726]
 gi|304567797|gb|EFM43382.1| tellurium resistance protein [Corynebacterium accolens ATCC 49726]
          Length = 373

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 42/321 (13%), Positives = 95/321 (29%), Gaps = 66/321 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            +    +L     W +       + G  +   + H       T Y+       E +LS +
Sbjct: 28  RSPHEPTLKESGLWTLFYICVAVVFGGVVWAVWGHEHGIQFFTGYVT------EQALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A  +        +Q++ L  GI+IA+  +R++F ++   +++             
Sbjct: 82  NLFVFALIMGSFKIPRKYQQKVLLIGIIIAL-VLRLVFILLGAAVIA------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   I      FL+  ++    +                          
Sbjct: 128 -----------AWSDIFYLFAIFLLYTAIKLVIDEIRD---------------------- 154

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             +   V  +      ++G   L   +   S             
Sbjct: 155 --------APETNPNDMAIIKLVRKAVDVTPQYHGDK-LTHRVDDGSKKGKFAFTPLFVA 205

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + + +ID   + D + + + IT   F++        + +R M    L  G+L++  YL 
Sbjct: 206 LVSIGLIDVMFAFDSIPAIYGITSEAFLVFTTNAFALMGLRQM--YFLIDGLLDRLVYLP 263

Query: 301 HGSYYSIFVLSVIMFLQTIVD 321
           +G    +  + V +    + +
Sbjct: 264 YGLGIILGFIGVKLLFHALHE 284


>gi|83595009|ref|YP_428761.1| integral membrane protein TerC [Rhodospirillum rubrum ATCC 11170]
 gi|83577923|gb|ABC24474.1| Integral membrane protein TerC [Rhodospirillum rubrum ATCC 11170]
          Length = 330

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 52/345 (15%), Positives = 103/345 (29%), Gaps = 67/345 (19%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
              S   S+    R ++         G  + W    T      T Y+       E SLS 
Sbjct: 38  NRKSHDISIAQSLRLSVFYIAVALAYGGWVWWYLGETAGMDYLTGYVV------EKSLSL 91

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + +           +Q R L WGIL  V  +R I   +   ++S            
Sbjct: 92  DNIFVISLVFSYFAIPRAYQHRVLFWGILG-VIVLRGIMIGLGAALIS------------ 138

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                           I    G FL++  +    +                         
Sbjct: 139 ------------EFHWILYLFGAFLILTGVKMMVSRNEDD-------------------- 166

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                      +  L  N++  F+           G  F       ++  +V        
Sbjct: 167 -----------AASLADNKLIGFLRRHLRVTEELDGERFWVRRPHPETGKSVAWATPLFL 215

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + +E  D   ++D V + FAIT + FI+        + +R++        +++++ YL
Sbjct: 216 ALVVVEATDVLFAVDSVPAVFAITTDPFIVYTSNIFAILGLRAL--YFALAAMVHRFVYL 273

Query: 300 EHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
            +     +  +   +F    +  +P   +   +  L+ L +  S+
Sbjct: 274 HYALAAVLIFIGSKIFYAEFIGKMPASVSLGVTFALLALGVIVSL 318


>gi|309792505|ref|ZP_07686969.1| integral membrane protein TerC [Oscillochloris trichoides DG6]
 gi|308225493|gb|EFO79257.1| integral membrane protein TerC [Oscillochloris trichoides DG6]
          Length = 325

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 52/347 (14%), Positives = 107/347 (30%), Gaps = 72/347 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEIS 58
             S   S+     W+ +      +   GI + +      +               ++E S
Sbjct: 25  RKSHAVSVKEALTWSGVWIALAMVFNAGIYFFWDRMAPGSSYSNGDAALAFFTGYLIEKS 84

Query: 59  LSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMN 116
           LS +N  +           + +Q R L WG+L A+  MR I   +               
Sbjct: 85  LSVDNIFVFVLLFTYFAVPAAYQHRVLFWGVLGAL-VMRGILIFVGAA------------ 131

Query: 117 LAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
                       + +    I    G FL+   +   F+   ++H                
Sbjct: 132 ------------LLKEFHWIIWLFGGFLIFTGIKMGFSKDEEVHP--------------- 164

Query: 177 GIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH 236
                               N +  F          + G  F                  
Sbjct: 165 ------------------EKNPLIRFFRRVMPVTDHYEGDRFFVRR------AGTLMATP 200

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
              + L +E  D   ++D + + FA+T++ FI+        + +RS+    +  G+++K+
Sbjct: 201 LFLVLLMVESTDLVFAVDSIPAIFAVTQDPFIVYTSNVFAILGLRSL--YFVLAGVMDKF 258

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            YL+ G    +  + V M +  I  IP   +      ++ +++ +S+
Sbjct: 259 HYLKTGLAVVLTFVGVKMVMVDIYKIPTAVSLGVIVSILTIAVVASL 305


>gi|227503430|ref|ZP_03933479.1| possible tellurium resistance protein [Corynebacterium accolens
           ATCC 49725]
 gi|227075933|gb|EEI13896.1| possible tellurium resistance protein [Corynebacterium accolens
           ATCC 49725]
          Length = 373

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 42/321 (13%), Positives = 94/321 (29%), Gaps = 66/321 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            +    +L     W +       + G  +   + H       T Y+       E +LS +
Sbjct: 28  RSPHEPTLKESGLWTLFYICVAVVFGGVVWAVWGHEHGIQFFTGYVT------EQALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A  +        +Q++ L  GI+IA+   R++F ++   +++             
Sbjct: 82  NLFVFALIMGSFKIPRKYQQKVLLIGIIIAL-VFRLVFILLGAAVIA------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   I      FL+  ++    +                          
Sbjct: 128 -----------AWSDIFYLFAIFLLYTAIKLVIDEIRD---------------------- 154

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             +   V  +      ++G   L   +   S             
Sbjct: 155 --------APETNPNDMAIIKLVRKAVDVTPQYHGDK-LTHRVDDGSKKGKFAFTPLFVA 205

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + + +ID   + D + + + IT   F++        + +R M    L  G+L++  YL 
Sbjct: 206 LVSIGLIDVMFAFDSIPAIYGITSEAFLVFTTNAFALMGLRQM--YFLIDGLLDRLVYLP 263

Query: 301 HGSYYSIFVLSVIMFLQTIVD 321
           +G    +  + V +    + +
Sbjct: 264 YGLGIILGFIGVKLLFHALHE 284


>gi|313499477|gb|ADR60843.1| Integral membrane protein TerC [Pseudomonas putida BIRD-1]
          Length = 354

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 54/327 (16%), Positives = 107/327 (32%), Gaps = 68/327 (20%)

Query: 20  VTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--SSI 77
               G L G G+ +Q     +    T ++       E SLS +N  + A           
Sbjct: 57  YFSVGVLFGAGVWYQLGAQSALEFYTGFLV------EQSLSMDNVFVMAMIFSYFAIPRR 110

Query: 78  WQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPIS 137
           +Q R L WGIL  VF +R I   +   +V                        Q    + 
Sbjct: 111 YQHRVLFWGILGVVF-LRAIMIGVGAALV------------------------QNFAWVL 145

Query: 138 GFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTN 197
              G FL+   +    + ++                                    L  N
Sbjct: 146 YIFGAFLLFTGVKMALSKEDS--------------------------------RPDLANN 173

Query: 198 EMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVI 257
            +  FV          +G +F      +  S  + +        + +E+ D   ++D V 
Sbjct: 174 PILKFVRRHMRVTDQIHGSHFFVRHTPAGHSKALRYATPLFLALVLIELADLVFAVDSVP 233

Query: 258 SSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ 317
           + FAIT++ FI+        + +RS+        +++++ YL++     +  +   +F  
Sbjct: 234 AIFAITQDPFIVYTSNIFAILGLRSL--YFALAALMHRFVYLKYALALVLIFIGCKIFYH 291

Query: 318 TIV-DIPEIFTGTSSTILIFLSIYSSI 343
            +V  +P + +   +  L+   +  S+
Sbjct: 292 GMVGKVPALLSLGVTFGLLLGGVVISL 318


>gi|146307461|ref|YP_001187926.1| integral membrane protein TerC [Pseudomonas mendocina ymp]
 gi|145575662|gb|ABP85194.1| Integral membrane protein TerC [Pseudomonas mendocina ymp]
          Length = 329

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 112/345 (32%), Gaps = 66/345 (19%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +  +     +             G   G  I WQ   T +    T ++       E SLS
Sbjct: 38  LHRDQHEIEMRESLLLYSGYFSVGVAFGGWIWWQLGATKALEYYTGFLV------EQSLS 91

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A  L        +Q R L WGIL  V  +R I   +   +V            
Sbjct: 92  MDNVFVMAMILGYFNIPRRYQHRVLFWGILG-VIVLRAIMIGLGTALV------------ 138

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                       Q    I    G FL++       ++ ++ H                  
Sbjct: 139 ------------QQFDWILYLFGAFLLLSGFKMLRSNDHEAH------------------ 168

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +  FV          +G  FL  +    S   + +    L
Sbjct: 169 -------------PDLAQNPLLRFVRKHIRVTDELHGGQFLVRLQDQVSGKPLLYATPLL 215

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E+ D   ++D V +  AI+++ FI+        + +R++        +++++ Y
Sbjct: 216 LALILIELADLVFAVDSVPAVLAISQDPFIVYTSNIFAILGLRAL--YFALAALMHRFIY 273

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L++     +  +   +FL  +V +P + +   +  L+   +  S+
Sbjct: 274 LKYALALVLMYIGGKIFLHDLVKVPALLSLGVTLGLLAGGVVLSL 318


>gi|296117696|ref|ZP_06836280.1| protein Alx [Corynebacterium ammoniagenes DSM 20306]
 gi|295969427|gb|EFG82668.1| protein Alx [Corynebacterium ammoniagenes DSM 20306]
          Length = 374

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 43/356 (12%), Positives = 105/356 (29%), Gaps = 82/356 (23%)

Query: 6   LYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAI 65
              +L     W         L GL +   +    +    T Y+       E +LS +N  
Sbjct: 31  HEPTLKESGTWTAFYVAIALLFGLLVWGLWDQEHALQYYTGYVT------EKALSVDNLF 84

Query: 66  LNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQ 123
           + A  +        +Q++ L  GI++A+   R++F ++   +++                
Sbjct: 85  VFALIMGAFKIPRKYQQKVLLIGIVLALI-FRLVFILLGAAVIA---------------- 127

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV 183
                   A   +      FL+  ++    +                             
Sbjct: 128 --------AWSDVFYLFAIFLLFTAVKLVIDEIRD------------------------- 154

Query: 184 LSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLY 243
                          +  ++         ++    L     S                + 
Sbjct: 155 -----AEETDPNDMLIIKWLRKVIHVTPRYHSDK-LTHREESGPQKGKLALTPLFIALVA 208

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           + +ID   + D + + + IT   F++        + +R M    L  G+L++  YL +G 
Sbjct: 209 IGLIDIMFAFDSIPAIYGITSEAFLVFTTNAFSLMGLRQM--YFLLDGLLDRLVYLSYGL 266

Query: 304 YYSIFVLSVIMFLQTIVD-------------IPE---IFTGTSSTILIFLSIYSSI 343
              +  + V + L  + +             +PE   + +      ++ +++ +S+
Sbjct: 267 GIILGFIGVKLLLHALHENNLPFINGGENVSVPEVGTVASLLVIVGVLVITVVASV 322


>gi|226227032|ref|YP_002761138.1| putative tellurium resistance protein TerC [Gemmatimonas aurantiaca
           T-27]
 gi|226090223|dbj|BAH38668.1| putative tellurium resistance protein TerC [Gemmatimonas aurantiaca
           T-27]
          Length = 311

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 48/344 (13%), Positives = 100/344 (29%), Gaps = 68/344 (19%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
              +   S+     W+++        GL IG +            Y+       E +LS 
Sbjct: 26  NRKAHAVSVKEALGWSVVWISLAISFGLWIGHEMGRQSMLEFYAGYLV------EQALSV 79

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  +           +  Q R L WGIL A+  MR         +++            
Sbjct: 80  DNLFVFILIFGYFRIPAELQHRVLFWGILGALL-MRGAMIGAGAVLIAQ----------- 127

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                           +    G FL++  +        ++                    
Sbjct: 128 -------------FHWVIYIFGAFLVITGIRMAMGGNEEIEP------------------ 156

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                            N +   V         F+G +F      +              
Sbjct: 157 ---------------EANPVIRLVRRIIPITTRFHGEHFFVRESLTPGGAVRLMATPLFV 201

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
           + + +E  D   ++D + + F +T+N F++        + +RSM    +   ++ K+  L
Sbjct: 202 VLVLVETTDVVFAVDSIPAIFGVTRNPFLVYTSNVFAILGLRSM--YFVLANVITKFHLL 259

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           ++G    +  + V M +  I  I    +      ++  S+  S+
Sbjct: 260 KYGLSVVLVFVGVKMLVSEIRPIGIGVSLGVVAAVLIGSVLLSL 303


>gi|298370437|ref|ZP_06981753.1| hypothetical protein HMPREF9016_01775 [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281897|gb|EFI23386.1| hypothetical protein HMPREF9016_01775 [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 326

 Score =  163 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 46/349 (13%), Positives = 105/349 (30%), Gaps = 69/349 (19%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTIST---VYICIILAVVEIS 58
           KS +   S+     W+ +           + ++     +        V       ++E S
Sbjct: 33  KSGAHKISVKEALAWSCIWIAVSCGFAGWLYFELAGNPAYGAVAKEKVLEFFTGYILEKS 92

Query: 59  LSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMN 116
           L+ +N  +             +Q R L +G+  A   +R +   +   +V          
Sbjct: 93  LAVDNIFVFLMIFGYFKVPQQYQHRVLLYGVFGA-IALRALMIFVGAVLV---------- 141

Query: 117 LAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
                         Q    I    G FL+   +       +                   
Sbjct: 142 --------------QQFEWILYLFGAFLLYTGIHMIKAGGDDED---------------- 171

Query: 177 GIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH 236
                            L  N++  ++        +  G  F          N       
Sbjct: 172 ---------------EDLSKNKLLGWLQKHIPVSRVLNGEKFFT------LENGKRIATP 210

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
            L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   + +++
Sbjct: 211 LLLVLVMIELSDVIFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVADRF 268

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            +L++G  + +  + V M     + IP   + +     +  S+  S+  
Sbjct: 269 VFLKYGLAFVLSFIGVKMLAMHWIHIPISISLSVVFGALGASVLISLIY 317


>gi|330503246|ref|YP_004380115.1| integral membrane protein TerC [Pseudomonas mendocina NK-01]
 gi|328917532|gb|AEB58363.1| integral membrane protein TerC [Pseudomonas mendocina NK-01]
          Length = 329

 Score =  162 bits (410), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 52/333 (15%), Positives = 104/333 (31%), Gaps = 65/333 (19%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +  +     +             G   G  I WQ   T +    T ++       E SLS
Sbjct: 38  LHRDQHEIEMRESLLLYSGYFSVGVAFGGWIWWQLGGTKAMEYYTGFLV------EQSLS 91

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A  L        +Q R L WGIL  V  +R I   +   +V            
Sbjct: 92  MDNVFVMAMILGYFNIPRKYQHRVLFWGILG-VIVLRAIMIGLGTALV------------ 138

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                       Q    I    G FL+   +    +  ++                    
Sbjct: 139 ------------QQFDWILYIFGAFLLFSGIKMLRSGGDEE------------------- 167

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +  FV          +   FL  +    S   + +    L
Sbjct: 168 -----------SHPDLAQNPVIRFVRKHIRVTDDLHEGKFLVRLKDKVSGKPLLYATPLL 216

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E+ D   ++D V +  AI+++ FI+        + +R++        +++++ Y
Sbjct: 217 LALVLIELADLVFAVDSVPAVLAISQDPFIVYTSNIFAILGLRAL--YFALAALMHRFIY 274

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSS 331
           L++     +  +   +FL  ++ +P + +   +
Sbjct: 275 LKYALALVLMYIGSKIFLHDLIKVPALLSLGVT 307


>gi|37523978|ref|NP_927355.1| hypothetical protein glr4409 [Gloeobacter violaceus PCC 7421]
 gi|35214984|dbj|BAC92350.1| glr4409 [Gloeobacter violaceus PCC 7421]
          Length = 337

 Score =  162 bits (409), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 50/329 (15%), Positives = 93/329 (28%), Gaps = 74/329 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             S   S      W+ +      +  +G+ +      +    T Y+       E SLS +
Sbjct: 44  RKSHAVSFKEALTWSGVWIALAMVFNVGLYFWMGPEPALEFFTGYLI------EKSLSVD 97

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +           +I+Q R L WG+L A+  MR I                       
Sbjct: 98  NIFVFVLIFSAFSVPAIYQHRVLFWGVLGAL-VMRGILIFAGAA---------------- 140

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    I    G FL+   +   F  + +                      
Sbjct: 141 --------LLKEFHWIIYIFGAFLVFTGIKMAFPEKEEKD-------------------- 172

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                        +  N +   V         +    F                     +
Sbjct: 173 -------------ITQNPVLKLVRRLIPVSDNYVEDRFFIRR------AGRWVATPLFLV 213

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +E  D   ++D + + FA+T + FI+        + +RS+    +  G++ K+ YL+
Sbjct: 214 LLLVETTDLIFAVDSIPAIFAVTTDPFIVYTSNVFAILGLRSL--YFVLAGVVGKFHYLK 271

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGT 329
                 +  +   M L  I  IP   +  
Sbjct: 272 LALSVILTFVGTKMLLIDIFKIPIAVSLL 300


>gi|238060164|ref|ZP_04604873.1| integral membrane protein terC [Micromonospora sp. ATCC 39149]
 gi|237881975|gb|EEP70803.1| integral membrane protein terC [Micromonospora sp. ATCC 39149]
          Length = 340

 Score =  162 bits (409), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 48/362 (13%), Positives = 105/362 (29%), Gaps = 90/362 (24%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+     W         L G G+       ++G   T ++       E SLS
Sbjct: 34  IGRRPHEPSVRESSLWVAFYVGLALLFGAGLWIFSGPGVAGEFYTGWLT------EYSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + +      +Q+R L  GI++A+  MR  F      ++S  +        
Sbjct: 88  VDNLFVFVIIMARFGVPRQYQQRVLLIGIVLALI-MRGGFIAAGAALISQFS-------- 138

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL+  ++      +                      
Sbjct: 139 ----------------WVFYIFGAFLVYTAVNLARQGEPDED------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N +  +   +      + G      VL              +
Sbjct: 165 --------------EFSENLLIRWSRKALPISKDYDGAKMTTHVL------GRRLFTPMM 204

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + +   D   +LD + + F IT+  +++        + +R +    L  G+L++  Y
Sbjct: 205 IVMIAIGTTDLIFALDSIPAIFGITQEPYLVFTANVFALMGLRQL--YFLLGGLLDRLIY 262

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYS 341
           L +G    +  + V + L+ +                   IP   + T     + ++  +
Sbjct: 263 LSYGLAVVLGFIGVKLVLEALADNHLPFVNGGEPVGWAPHIPIWLSLTVILGTLSVATVA 322

Query: 342 SI 343
           S+
Sbjct: 323 SL 324


>gi|213964766|ref|ZP_03392966.1| tellurium resistance membrane protein [Corynebacterium amycolatum
           SK46]
 gi|213952959|gb|EEB64341.1| tellurium resistance membrane protein [Corynebacterium amycolatum
           SK46]
          Length = 387

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 37/321 (11%), Positives = 91/321 (28%), Gaps = 71/321 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 ++     W     V   + G  + W + H       + YI       E +LS +
Sbjct: 38  RTPHNPTMKEAGTWTAFYVVLALIFGGMVWWLWDHHRGIEFLSGYIT------EKALSVD 91

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A  +        +Q++ L +GI +A+   R +F      +++             
Sbjct: 92  NLFVFALIIGAFKIPRQYQQKVLLFGIAMAL-VFRGLFIWAGAAVIAK------------ 138

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +      FL+  ++   ++                          
Sbjct: 139 ------------WSDVFYLFAIFLIYTAIKTVYDE------------------------- 161

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                 +          ++  ++         +               N   +       
Sbjct: 162 -----AVDKPEPDPSDMKLIQWLRRIVPISDHYNRDKLTV------KENGKRYLTPLAIA 210

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +  ID   + D + + + +T   +I+     +  + +R M    L  G+L++  YL 
Sbjct: 211 LVSIGFIDVMFAFDSIPAIYGLTDEAYIVFTANALALMGLRQM--YFLLDGLLDRLVYLA 268

Query: 301 HGSYYSIFVLSVIMFLQTIVD 321
           +G    +  + V + L  + +
Sbjct: 269 YGLGVILAFIGVKLLLHALHE 289


>gi|302518409|ref|ZP_07270751.1| integral membrane export protein [Streptomyces sp. SPB78]
 gi|302427304|gb|EFK99119.1| integral membrane export protein [Streptomyces sp. SPB78]
          Length = 357

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 48/352 (13%), Positives = 104/352 (29%), Gaps = 77/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       SL     W ++      L G+G+               +I       E SLS
Sbjct: 25  IGRKPHEVSLKEAGIWTVVWIALACLFGVGLLVFAGGKQGSEFFAGFIT------EKSLS 78

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + K    + +Q+R L  G+LIA+  +R +F +                  
Sbjct: 79  VDNLFVFVLIMAKFAVPAKFQQRVLLVGVLIAL-VLRTLFILAGAA-------------- 123

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                     + +    I    G FL+  +                              
Sbjct: 124 ----------MIENFSWIFYIFGAFLLYTAWKLIK------------------------- 148

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N++   + +       ++G             +        L
Sbjct: 149 ----EAREDDETEEEFEENKLLKSLETRFGVADRYHGTKLFVR------QHGKRIMTPML 198

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +   D   +LD + + F +T++ +I+        + +R +    L  G+L K  +
Sbjct: 199 VVILAIGTTDVLFALDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLIGGLLKKLVH 256

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-------DIPEIFTGTSSTILIFLSIYSSI 343
           L +G    +  + V + L  +        +IP   +      ++ ++  +S+
Sbjct: 257 LSYGLSVILGFIGVKLVLHALHESGVHVPEIPTTVSLGVIVAVLAITTVTSL 308


>gi|182413257|ref|YP_001818323.1| integral membrane protein TerC [Opitutus terrae PB90-1]
 gi|177840471|gb|ACB74723.1| Integral membrane protein TerC [Opitutus terrae PB90-1]
          Length = 329

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 58/344 (16%), Positives = 108/344 (31%), Gaps = 75/344 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   SL     W+ +  V   +  LGI        +    T Y      V+E SLS +
Sbjct: 28  RKAHVVSLKEALSWSAVWIVLALVFNLGIWHYAGAPKALEFFTGY------VIEKSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A         + +Q + L WG+L A+  MR I       +++  +          
Sbjct: 82  NVFVFALLFSYFAVPAKYQHKVLFWGVLGALL-MRAIMIAAGAALIARFS---------- 130

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          I    G FL++  +        ++H                    
Sbjct: 131 --------------WIIYVFGAFLILTGVKMIVKRAEEIHP------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +             + G +F            V        +
Sbjct: 158 --------------ERNPIVRGFKRLMPVTADYRGDSFFVR------ERGVLMATPLFVV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +E  D   ++D + + FA+T + FI+        + +RS+       G+++K+ YL+
Sbjct: 198 LLLVEFSDLIFAVDSIPAIFAVTSDPFIVYTSNVFAILGLRSL--YFALAGVMDKFHYLK 255

Query: 301 HGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V M L  T   I  +       +++ +SI  S+
Sbjct: 256 IGLGVVLGFVGVKMILGHTGWKIDTLVALGVILLILVVSIVWSL 299


>gi|108760724|ref|YP_631673.1| TerC family membrane protein [Myxococcus xanthus DK 1622]
 gi|6226358|sp|P96554|Y319_MYXXA RecName: Full=Uncharacterized membrane protein STKORF319
 gi|1732028|gb|AAB46351.1| unknown [Myxococcus xanthus]
 gi|108464604|gb|ABF89789.1| membrane protein, TerC family [Myxococcus xanthus DK 1622]
          Length = 319

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 58/343 (16%), Positives = 107/343 (31%), Gaps = 74/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ L      + G G+ W+F         T Y+       E SLS +
Sbjct: 33  RKAHVVKFKEALGWSALWVSLALVFGAGVWWKFGPEPGLQFITGYLI------EKSLSVD 86

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +       +   +++Q R L WGIL A+  +R I     V +++             
Sbjct: 87  NIFVFVVIFSALRIPALYQHRVLFWGILSAL-ALRAIMIFAGVAMLAR------------ 133

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL++  +  F     + +                    
Sbjct: 134 ------------FHWLIYVFGGFLIITGVKLFLQRNKEDNP------------------- 162

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             +      +  +   F G +F          N        L  
Sbjct: 163 --------------EEGALMRLARRTIPSTPNFDGHHFFTV------ENGRKLATPLLMA 202

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +E  D   +LD + + FA+T + FI+        + +RSM    +  G + K+ YL+
Sbjct: 203 LLLVEASDILFALDSIPAIFAVTTDPFIVFTSNIFAILGLRSM--FFMLAGAVEKFSYLK 260

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            G    +  +   M +   V +P   + +    L+  SI +S+
Sbjct: 261 VGLSAVLVFVGTKMAIIDFVKMPPEVSLSVIAGLLGASIVASL 303


>gi|239978858|ref|ZP_04701382.1| integral membrane export protein [Streptomyces albus J1074]
          Length = 321

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 52/354 (14%), Positives = 105/354 (29%), Gaps = 78/354 (22%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+     W I+  V   L G+G+        +G     YI       E SLS
Sbjct: 9   IGRKPHDVSIKEAGIWTIVWIVLAALFGVGLLLFGGGQQAGEFFAGYIT------EKSLS 62

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + K    S +Q+R L  G+LIA+                           
Sbjct: 63  VDNLFVFVLIMAKFSVPSQYQQRVLLIGVLIALVLR------------------------ 98

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                     I      +    G FL+  +      +++      + E  +   ++    
Sbjct: 99  -AIFIAAGAAIIANFSWVFYIFGAFLIYTAWKLIQEARSGDDDEDWEENRLLKAAE---- 153

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                                             ++G             N        L
Sbjct: 154 --------------------------RRFGVADRYHGTKLFI------EKNGKKIMTPML 181

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +   D   +LD + + F +T++ +I+        + +R +    L  G+L K  +
Sbjct: 182 VVMLAIGTTDLLFALDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLLGGLLRKLVH 239

Query: 299 LEHGSYYSIFVLSVIMFLQTIV----DIPEI---FTGTSSTILIFLSIYSSIKN 345
           L +G    +  + V + L  +      +PEI    +      ++ ++  +S+  
Sbjct: 240 LSYGLSVILGFIGVKLVLHALHESGVHVPEISIPVSLGVICAVLVVTTITSLYA 293


>gi|221632116|ref|YP_002521337.1| putative integral membrane export protein [Thermomicrobium roseum
           DSM 5159]
 gi|221155779|gb|ACM04906.1| putative integral membrane export protein [Thermomicrobium roseum
           DSM 5159]
          Length = 318

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 55/343 (16%), Positives = 108/343 (31%), Gaps = 73/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +    +     W         L G+ + W   H       T Y+       E+SLS +
Sbjct: 29  RKAHVVEMKEAGLWVAFWVSLSLLFGVFLWWWDGHEAGLQYFTGYLI------ELSLSAD 82

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +           + +Q R L +GIL A+  MR +  +    ++S             
Sbjct: 83  NMFVFVLIFTAFAVPAQYQHRVLYYGILGALI-MRGLMILGGAWLISQ------------ 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          I    G FL+   +      +                        
Sbjct: 130 ------------FHWILYIFGAFLVFTGIRMLLEKEE----------------------- 154

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                        +  N     VS     +  +Y   F   +      +   +    + +
Sbjct: 155 ---------REVDVENNIAIRLVSRFAPIVPRYYEQRFFVRI------DGKRYATPLIVV 199

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +EI D   ++D + + FA+T++ FI+        + +RSM    L  G++ +  YL 
Sbjct: 200 LVLVEITDLMFAIDSIPAIFAVTRDPFIVFSSNVFAILGLRSM--YFLLAGLVRRLAYLR 257

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +G  + +  + V M +Q    IP   +     + + +S+  S+
Sbjct: 258 YGLAFILSYIGVKMLIQDFYKIPTALSLGIVIVTLAISVIVSL 300


>gi|325277485|ref|ZP_08143088.1| integral membrane protein TerC [Pseudomonas sp. TJI-51]
 gi|324097372|gb|EGB95615.1| integral membrane protein TerC [Pseudomonas sp. TJI-51]
          Length = 346

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 52/346 (15%), Positives = 106/346 (30%), Gaps = 68/346 (19%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +  +     +             G L G  + +Q     +    T ++       E SLS
Sbjct: 38  LHRHEREIGMRESLLLYSGYFSIGVLFGGWVWFQLGAQSALEFYTGFLV------EQSLS 91

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A           +Q R L WGIL  V  +R I   +   +V            
Sbjct: 92  MDNVFVMAMIFSYFAIPRRYQHRVLFWGILG-VVILRAIMIGVGAALV------------ 138

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                       Q    +    G FL+   +      ++                     
Sbjct: 139 ------------QNFAWVLYLFGAFLLFTGVKMALAKEDSH------------------- 167

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +  FV          +G +F         +  + H     
Sbjct: 168 -------------PDLANNPILKFVRRHLRVTDEIHGSHFFVRQTPPGQNKALRHATPLF 214

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E+ D   ++D V + FAIT++ FI+        + +RS+        +++++ Y
Sbjct: 215 LALVLIELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRSL--YFALSALMHRFVY 272

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
           L++     +  +   +F   +V  +P + +   +  L+   +  S+
Sbjct: 273 LKYALALVLIFIGCKIFYHGMVGKVPALLSLGVTFGLLLGGVVISL 318


>gi|318056347|ref|ZP_07975070.1| putative integral membrane export protein [Streptomyces sp.
           SA3_actG]
 gi|318075152|ref|ZP_07982484.1| putative integral membrane export protein [Streptomyces sp.
           SA3_actF]
          Length = 357

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 48/352 (13%), Positives = 104/352 (29%), Gaps = 77/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       SL     W ++      L G+G+               +I       E SLS
Sbjct: 25  IGRKPHEVSLKEAGIWTVVWIALACLFGVGLLVFAGGKQGSEFFAGFIT------EKSLS 78

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + K    + +Q+R L  G+LIA+  +R +F +                  
Sbjct: 79  VDNLFVFVLIMAKFAVPAKFQQRVLLVGVLIAL-VLRTLFILAGAA-------------- 123

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                     + +    I    G FL+  +                              
Sbjct: 124 ----------MIENFSWIFYIFGAFLLYTAWKLIK------------------------- 148

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N++   + +       ++G             +        L
Sbjct: 149 ----EAREDDETEEEFEENKLLKSLETRFGVADRYHGTKLFVR------QHGKRIMTPML 198

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +   D   +LD + + F +T++ +I+        + +R +    L  G+L K  +
Sbjct: 199 VVILAIGTTDVLFALDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLIGGLLKKLVH 256

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-------DIPEIFTGTSSTILIFLSIYSSI 343
           L +G    +  + V + L  +        +IP   +      ++ ++  +S+
Sbjct: 257 LSYGLSVILGFIGVKLVLHALHESGVHVPEIPTTVSLGVIVAVLAITTVTSL 308


>gi|182437288|ref|YP_001825007.1| putative integral membrane export protein [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|178465804|dbj|BAG20324.1| putative integral membrane export protein [Streptomyces griseus
           subsp. griseus NBRC 13350]
          Length = 373

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 47/353 (13%), Positives = 102/353 (28%), Gaps = 82/353 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ L      + G  +      T     +T ++      +E SLS +
Sbjct: 76  RKAHVIGFREAGLWSALWVGLALVFGAVVFLTLGSTAGTEYTTAWL------LEKSLSVD 129

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G++ A+   R +F  + V +V+             
Sbjct: 130 NLFVFALIFTYFKVPREYQHRVLFFGVVGAL-VFRAVFLTLGVAVVNRFTF--------- 179

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +       L   S       +                        
Sbjct: 180 ---------------VLFLFAAILFYSSYKILSGQEENFDPGKSF--------------- 209

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                                 +         + G +F+                  L +
Sbjct: 210 ------------------AVRMLRKVMPVQDHYSGTHFVVR------EEGRRVATPLLAV 245

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
              +E  D   ++D V +  A++ + FI+        + +R++    L  G+L+++ YL 
Sbjct: 246 VAAIEAADLIFAVDSVPAVLAVSDDLFIVYTSNAFAILGLRAL--YFLLAGLLDRFHYLS 303

Query: 301 HGSYYSIFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSIKN 345
           HG    +  ++V + LQ           +IP   +     +++ +S+  S++ 
Sbjct: 304 HGLAVILAFIAVKLVLQACHKMISTSIPEIPSPVSLAVIVVILAVSVTLSLRR 356


>gi|158313888|ref|YP_001506396.1| integral membrane protein TerC [Frankia sp. EAN1pec]
 gi|158109293|gb|ABW11490.1| Integral membrane protein TerC [Frankia sp. EAN1pec]
          Length = 373

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 97/343 (28%), Gaps = 74/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W++     G      I        +G            ++E SLS +
Sbjct: 27  RRAHVIGFREAAWWSVGWVSLGVAFAFVIWAWQGPGAAG------EYAAAYLLEKSLSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G+L A+  +R +F    +                 
Sbjct: 81  NLFVFALIFSYFKVPREYQHRVLFYGVLGAL-VLRFLFIAAGIA---------------- 123

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    +    G FL+  +     +    +                     
Sbjct: 124 --------LLENFSFVIYIFGAFLLYTAFKMVRDDGVDMDPG------------------ 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +     +         + G +F+                  L +
Sbjct: 158 ---------------QSRAVRLLRRVIPVTDTYQGQHFILRR------AGKLIATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   + D V ++  +T   F++     +  + +RS+    L  G++ K+ +L 
Sbjct: 197 LVAVETADVLFAFDSVPAALGVTNETFLVYTANALAILGLRSL--FFLLSGLMEKFHHLA 254

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V M L  +  +P   +     +++  SI  S+
Sbjct: 255 TGLAVILAFIGVKMLLTDVWHMPIWLSLAVIAVVLAGSIVWSL 297


>gi|25028415|ref|NP_738469.1| putative integral membrane export protein [Corynebacterium
           efficiens YS-314]
 gi|259507472|ref|ZP_05750372.1| tellurium resistance protein [Corynebacterium efficiens YS-314]
 gi|23493700|dbj|BAC18669.1| putative integral membrane export protein [Corynebacterium
           efficiens YS-314]
 gi|259164960|gb|EEW49514.1| tellurium resistance protein [Corynebacterium efficiens YS-314]
          Length = 385

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 43/364 (11%), Positives = 110/364 (30%), Gaps = 92/364 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT-----HTLSGTISTVYICIILAVVEI 57
                 S+     W++       + G+ + + +      H       T Y+       E 
Sbjct: 28  RTPHEPSMKESAWWSLFYVALACVFGVFLWFTWGEPGNPHQHGIEFFTGYVT------EK 81

Query: 58  SLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           +LS +N  + A  +        +Q++ L  GI +A+   R++F ++   ++         
Sbjct: 82  ALSVDNLFIFALIMSSFKIPRKYQQKVLLIGIAMALI-FRLVFILLGAAVI--------- 131

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +A   +      +L+  ++   ++   +                 
Sbjct: 132 ---------------EAWSDVFYIFSIWLIYTAVKLLWDEIRET---------------- 160

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                  +   +         ++G      V             
Sbjct: 161 --------------PDTDPNDMLIIKMLRKVIPVTSGYHGDKLTHRV------GGKLSLT 200

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
                 + + ++D   +LD + + + IT   +I+        + +R M    L  G+L++
Sbjct: 201 PLFVAIVSIGMVDLMFALDSIPAIYGITTEPYIVFTTNAFALLGLRQM--YFLLDGLLDR 258

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVD-------------IPEI---FTGTSSTILIFLSI 339
             YL +G    +  + V + L  + +             +PE+   F+      ++ +++
Sbjct: 259 LVYLPYGLGLILAFIGVKLGLHALHENNLPFINGGENVAVPEVATTFSLVFIMGVLVITV 318

Query: 340 YSSI 343
            +SI
Sbjct: 319 VASI 322


>gi|86158438|ref|YP_465223.1| integral membrane protein TerC [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774949|gb|ABC81786.1| Integral membrane protein TerC [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 320

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 48/334 (14%), Positives = 100/334 (29%), Gaps = 74/334 (22%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
               W  +      +    + W+F    +    T Y+       E SLS +N  +     
Sbjct: 46  EALGWTAVWAALAAVFAGFVWWRFGANKAIEFVTGYLI------EQSLSVDNLFVFVLVF 99

Query: 72  QKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
                    Q R L WGI  A F +R++  +    +++                      
Sbjct: 100 ATFAIPPKLQHRVLFWGITTA-FVLRLVMIVGGTALLTR--------------------- 137

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
                 +    G FL++  +  FF+ + + H                             
Sbjct: 138 ---FHWLIYVFGAFLVVTGIRIFFHEEQEHHP---------------------------- 166

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
                  +  +  +     +     G +F          N              +E+ D 
Sbjct: 167 -----EKSVAFRVLRRLVPSTSRMEGHHFFLV------ENGRRVATPLFLALCMIEVSDV 215

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
             +LD V + F IT + FI+        + +RS+        +L +++YL+ G    +  
Sbjct: 216 VFALDSVPAIFGITLDPFIVFTSNIFAIMGLRSL--YFAVAQLLRRFEYLKAGLALVLVF 273

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + + M + + V +    +      L+  ++  S+
Sbjct: 274 IGLKMVVSSWVHVNAFASLGVVVALLGGAMGYSL 307


>gi|227504849|ref|ZP_03934898.1| tellurium resistance protein [Corynebacterium striatum ATCC 6940]
 gi|227198540|gb|EEI78588.1| tellurium resistance protein [Corynebacterium striatum ATCC 6940]
          Length = 372

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 44/360 (12%), Positives = 104/360 (28%), Gaps = 83/360 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            +    S+     W +       + G  +   + H  +    T ++       E +LS +
Sbjct: 28  RSPHEPSIKESGSWTLFYMGLAVIFGGIVWVLWDHEHAIQFYTGWVT------EQALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A  +        +Q++ L  GI++A+   R+IF ++   I+              
Sbjct: 82  NLFVFALIMGSFKIPRRFQQKVLLIGIVLALL-FRLIFIMLGAAII-------------- 126

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     QA   +      FL+  ++    +                          
Sbjct: 127 ----------QAWSDVFYLFAIFLIYTAVKLIIDEIRD---------------------- 154

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             +  ++         ++G   L     S               
Sbjct: 155 --------AEETDPNDMLVIKWLRKVVHVTPRYHGDK-LTHREESGPKKGKLALTPLFVA 205

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
              + +ID   + D + + + IT   F++        + +R M    L  G+L +  YL 
Sbjct: 206 LTAIGLIDVMFAFDSIPAIYGITSEPFLVFTTNAFALMGLRQM--FFLIDGLLERLVYLP 263

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V +    +                  +IP + +      ++ +++ +S+
Sbjct: 264 YGLGIILGFIGVKLLFHALHENNLPFVNGGENVGGIPEIPTLMSLLVIVGVLAVTVAASV 323


>gi|319951210|ref|ZP_08025049.1| Integral membrane protein TerC [Dietzia cinnamea P4]
 gi|319435132|gb|EFV90413.1| Integral membrane protein TerC [Dietzia cinnamea P4]
          Length = 350

 Score =  160 bits (405), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 47/346 (13%), Positives = 100/346 (28%), Gaps = 75/346 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +    +     W+ +    G   G+ +   +           Y+       E SL+ +
Sbjct: 27  RKAHVIGVKEAAAWSAVWIALGVGFGVIVWAVWGADFGQQYFAGYLI------EKSLAVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L  G+L A+   R IF                      
Sbjct: 81  NVFVWAIIFAHFAVPPQFQHRVLFLGVLGAL-VFRGIFIAGGA----------------- 122

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                  ++ Q    I      FL+             L+                    
Sbjct: 123 -------LLIQNFSWILYIFAAFLLYTGFRMIRQRDEHLNP------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           + +             F+G   L           +      L +
Sbjct: 157 --------------DRSRVLGAFRRLVPMSDTFHGQRLLVR------KGGLIMATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   ++D + + FA+T   F++        + +R+M    L   +++++ YL+
Sbjct: 197 LVLVETTDVVFAVDSIPAIFAVTDEVFLVFTANAFAILGLRAM--YFLLADLVHRFVYLK 254

Query: 301 HGSYYSIFVLSVIMFLQT-IVDIPEIFTGTSSTILIFLSIYSSIKN 345
            G    +  + V M L+  +  IP   +      ++ +S+ +S++ 
Sbjct: 255 IGLALVLMWVGVKMLLKIDVYYIPTPLSLAVIATILTVSVVASLRA 300


>gi|297626042|ref|YP_003687805.1| Hypothetical membrane protein [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
 gi|296921807|emb|CBL56367.1| Hypothetical membrane protein [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
          Length = 418

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 40/359 (11%), Positives = 100/359 (27%), Gaps = 88/359 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   SL     W+ +        G+ +       +       YI       E +LS +
Sbjct: 27  RKAHSPSLREAAVWSAVYIGIAIAFGIVVMIVGGTEMGSEYFAGYIT------EKALSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L  GI+ ++   R  F  +   +++  +          
Sbjct: 81  NLFVFLLIISSFAVPRKDQQKVLLVGIVFSIIA-RTGFIFLGAALINRFS---------- 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G  L++ +         + H                    
Sbjct: 130 --------------WVFYLFGLILLITAGHTVKPDNEESHGSE----------------- 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N M             +        V      +        L +
Sbjct: 159 --------------ADNLMIRLARKLLRTSDQYDDDKLFTVV------DGKRMMTPMLLV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T++ +I+    T   + +R +    L  G+L++  YL 
Sbjct: 199 MVAIGGTDILFALDSIPAIFGLTQSTYIVFTATTFSLMGLRQL--FFLIDGLLDRLIYLS 256

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + + + L  +                 +I    + +    ++ +++ +S+
Sbjct: 257 YGLGAILSFIGIKLILHALHENTVPFINDGESVPVIEITTGISLSVIIGVLVITVVTSL 315


>gi|326501392|dbj|BAK02485.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 417

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 48/330 (14%), Positives = 100/330 (30%), Gaps = 75/330 (22%)

Query: 18  ILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--S 75
            LV +A  L G+ I  +     +      Y+      +E SLS +N  +     +     
Sbjct: 151 ALVVIAAVLFGVSIALKDGVEKASEYFAGYL------LEQSLSVDNLFVFILVFKYFKVP 204

Query: 76  SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVP 135
             +Q R L++GI  AV    ++  + +  I                         Q+   
Sbjct: 205 LEYQNRVLSYGIAGAVIFRAVLIILGVATI-------------------------QSFEA 239

Query: 136 ISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILP 195
           ++ F    L+  S   F     +                                   L 
Sbjct: 240 VNLFFAAILLFSSYKLFAGDDEESD---------------------------------LT 266

Query: 196 TNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDG 255
            N +             + G  FL       + + +      L     +E+ D + ++D 
Sbjct: 267 DNFIVKTCQKFIPVTDFYDGDRFLT------NQDGIWKATPLLLTLAVIELSDIAFAVDS 320

Query: 256 VISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF 315
           + + F +T++  II+         +RS+   +L    +++ +YL+      +  +   M 
Sbjct: 321 IPAIFGVTRDPLIILSSNIFAISGLRSL--YVLISESMSELEYLQPAVGIVLGFIGAKMI 378

Query: 316 LQTI-VDIPEIFTGTSSTILIFLSIYSSIK 344
                  IP   +    T  +   +  S++
Sbjct: 379 FDFFGYHIPTEASLAVVTTCLSGGVILSLR 408


>gi|254671261|emb|CBA08546.1| putative transport protein [Neisseria meningitidis alpha153]
          Length = 324

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 107/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGVKEALAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +       ++                 
Sbjct: 143 ---------------QQFEWILYLFGAFLLYTGIHMMKPEGDE----------------- 170

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 171 ---------------KEDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  S+ +S+  
Sbjct: 268 FVFLKYGLAFVLGFIGVKMLIMHWVHIPISVSLSVVFGALGASVLTSLVY 317


>gi|326489013|dbj|BAK01490.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 402

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 48/330 (14%), Positives = 100/330 (30%), Gaps = 75/330 (22%)

Query: 18  ILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--S 75
            LV +A  L G+ I  +     +      Y+      +E SLS +N  +     +     
Sbjct: 136 ALVVIAAVLFGVSIALKDGVEKASEYFAGYL------LEQSLSVDNLFVFILVFKYFKVP 189

Query: 76  SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVP 135
             +Q R L++GI  AV    ++  + +  I                         Q+   
Sbjct: 190 LEYQNRVLSYGIAGAVIFRAVLIILGVATI-------------------------QSFEA 224

Query: 136 ISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILP 195
           ++ F    L+  S   F     +                                   L 
Sbjct: 225 VNLFFAAILLFSSYKLFAGDDEESD---------------------------------LT 251

Query: 196 TNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDG 255
            N +             + G  FL       + + +      L     +E+ D + ++D 
Sbjct: 252 DNFIVKTCQKFIPVTDFYDGDRFLT------NQDGIWKATPLLLTLAVIELSDIAFAVDS 305

Query: 256 VISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMF 315
           + + F +T++  II+         +RS+   +L    +++ +YL+      +  +   M 
Sbjct: 306 IPAIFGVTRDPLIILSSNIFAISGLRSL--YVLISESMSELEYLQPAVGIVLGFIGAKMI 363

Query: 316 LQTI-VDIPEIFTGTSSTILIFLSIYSSIK 344
                  IP   +    T  +   +  S++
Sbjct: 364 FDFFGYHIPTEASLAVVTTCLSGGVILSLR 393


>gi|152965863|ref|YP_001361647.1| integral membrane protein TerC [Kineococcus radiotolerans SRS30216]
 gi|151360380|gb|ABS03383.1| Integral membrane protein TerC [Kineococcus radiotolerans SRS30216]
          Length = 339

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 48/353 (13%), Positives = 102/353 (28%), Gaps = 82/353 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ +      + G  I W +        +T ++      +E SLS +
Sbjct: 31  RGAHVIQFKEAAIWSGVWVTMALIFGGIIFWAYGAEAGTAYTTAWL------LEKSLSVD 84

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L  G+L A+   R IF  + V +V              
Sbjct: 85  NLFVFALIFAYFKVPREYQHRVLFLGVLGALL-FRGIFLGVGVAVV-------------- 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +    +    G  L+  +     +    +                     
Sbjct: 130 ----------ERFTAVLFVFGAILLWSAWKMLKDDDQDMDPGK----------------- 162

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N     +         ++G  F              +G   L +
Sbjct: 163 ----------------NIGVRMIKKIIPLKDEYHGTKFFI------KEAGKRYGTPLLAV 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
              +E  D   ++D V +  A++ + FI+        + +R++    +  G+L ++  L 
Sbjct: 201 VAAIEAADLIFAVDSVPAVLAVSDDMFIVYSSNAFAILGLRAL--YFMLSGLLERFHLLS 258

Query: 301 HGSYYSIFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSIKN 345
               + +  + V +F Q            IP   + +   + + L+I  S++ 
Sbjct: 259 KALAFILAFIGVKLFFQAGHEVISPSIPHIPTWISLSVIVVSLTLAIVLSLRR 311


>gi|325203146|gb|ADY98599.1| protein Alx [Neisseria meningitidis M01-240355]
          Length = 324

 Score =  160 bits (404), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 108/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K++S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNSSHKVGVKEALAWSGLWVAVSCLFAGWLYFKLAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +       ++                 
Sbjct: 143 ---------------QQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------GDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  S+ +S+  
Sbjct: 268 FVFLKYGLAFVLGFIGVKMLIMHWVHIPISVSLSVVFGALGASVLTSLVY 317


>gi|269796280|ref|YP_003315735.1| membrane protein TerC [Sanguibacter keddieii DSM 10542]
 gi|269098465|gb|ACZ22901.1| membrane protein TerC, possibly involved in tellurium resistance
           [Sanguibacter keddieii DSM 10542]
          Length = 400

 Score =  160 bits (404), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 44/360 (12%), Positives = 102/360 (28%), Gaps = 89/360 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   +L     W+ +      L G+G+       +       YI       E +LS +
Sbjct: 28  RKAHIPTLREAAIWSSIYVGLALLFGVGVLVFGGSQMGSEYFAGYIT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ ++   R  F  + V +++  +          
Sbjct: 82  NLFVFLIIMASFKVPRADQQKVLLFGIVFSLIA-RTAFIFVGVALINRFS---------- 130

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+  ++                               
Sbjct: 131 --------------ALFYLFGLFLIFTAVKLLKPEGEGE--------------------- 155

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +             + G             N        L +
Sbjct: 156 -----------GDEANNFIIRLAKRLFHTTDEYDGDKLFT------IHNGKRALTPMLLV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+N FI+        + +R +    L  G+L++  YL 
Sbjct: 199 MVAIGGTDILFALDSIPAIFGLTQNTFIVFTATAFSLMGLRQL--YFLVDGLLDRLIYLS 256

Query: 301 HGSYYSIFVLSVIMFLQTI----------------VDIPEIFTGTSSTILIFLSIYSSIK 344
           +G    +  + V + L  +                 ++    + T    ++ +++ +S+ 
Sbjct: 257 YGLAAILGFIGVKLVLHALHENNLPFINGGEHVDVFEVSTPLSLTVIVGVLAVTVVASLM 316


>gi|19553171|ref|NP_601173.1| membrane protein TerC [Corynebacterium glutamicum ATCC 13032]
 gi|62390807|ref|YP_226209.1| tellurium resistance membrane protein [Corynebacterium glutamicum
           ATCC 13032]
 gi|21324737|dbj|BAB99360.1| Membrane protein TerC, possibly involved in tellurium resistance
           [Corynebacterium glutamicum ATCC 13032]
 gi|41326145|emb|CAF20308.1| TELLURIUM RESISTANCE MEMBRANE PROTEIN [Corynebacterium glutamicum
           ATCC 13032]
          Length = 369

 Score =  160 bits (404), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 39/364 (10%), Positives = 104/364 (28%), Gaps = 92/364 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT-----HTLSGTISTVYICIILAVVEI 57
                 ++     W++       + G+ + + +      H       T Y+       E 
Sbjct: 28  RTPHEPTIKESAWWSLFYVALACVFGVFLWFAWGEPGNPHQHGIEFFTGYVT------EK 81

Query: 58  SLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           +LS +N  + A  +        +Q++ L  GI +A+   R+ F +    ++         
Sbjct: 82  ALSVDNLFIFALIMGSFKIPRKYQQKVLLIGIALAL-VFRLAFILAGAAVI--------- 131

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +A   +      +L+  ++   ++                     
Sbjct: 132 ---------------EAWSDVFYIFSIWLIYTAVKLLWDEVRDT---------------- 160

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                  +   +         ++G                 H  
Sbjct: 161 --------------PETDPNDMFIIKALRKVIPVTEGYHGDKLTHRF------GGKLHLT 200

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
                 + + ++D   +LD + + + IT   +I+        + +R M    L  G+L++
Sbjct: 201 PLFVALVSIGMVDLMFALDSIPAIYGITTEPYIVFTTNAFALLGLRQM--YFLLDGLLDR 258

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSI 339
             YL +G    +  +   + L  +                 ++  +F+      ++ +++
Sbjct: 259 LVYLPYGLGLILLFIGAKLGLHALHENNLPFINGGENVSVPEVSTVFSLVFIIGVLTITV 318

Query: 340 YSSI 343
            +SI
Sbjct: 319 IASI 322


>gi|300313214|ref|YP_003777306.1| transport protein [Herbaspirillum seropedicae SmR1]
 gi|300075999|gb|ADJ65398.1| transport protein [Herbaspirillum seropedicae SmR1]
          Length = 314

 Score =  159 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 49/345 (14%), Positives = 111/345 (32%), Gaps = 70/345 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLS 60
            N+   S      W+ +     F+    + W     +    +       L+  ++E +LS
Sbjct: 23  RNAHRVSPREALGWSAVWVSLAFVFAGLMWWYLDAHVGREFANQKGAEFLSGYLIEKALS 82

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +              Q+R L +G++ A   MR +  ++   +++  +        
Sbjct: 83  VDNIFVFLMIFSYFAVPPEMQRRVLLYGVVGA-IVMRAVMILLGAWMIAQFS-------- 133

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            I    G FL+   +     +  +                    
Sbjct: 134 ----------------WILYVFGAFLVFTGVKMLIFADKEAD------------------ 159

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +  ++         + G  F   V      N V +    +
Sbjct: 160 ---------------LGDNPLLRWLRGHLKISNDYDGEKFTTRV------NGVRYFTPLM 198

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +EI D   ++D + + FAITK+ FI+        + +R++    L      ++  
Sbjct: 199 LVLLLIEISDVIFAVDSIPAIFAITKDPFIVFTSNMFAIMGLRAL--YFLLADSAERFHL 256

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L++G    +  +   M       +P +++ +    ++ +SI +S+
Sbjct: 257 LKYGLALVLLFVGFKMLASYWFHVPVVWSLSIVGAILVVSIIASL 301


>gi|260222035|emb|CBA31197.1| Inner membrane protein alx [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 363

 Score =  159 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 53/348 (15%), Positives = 109/348 (31%), Gaps = 71/348 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQF-THTLSGTISTVYICIILA--VVEIS 58
           K  +    +     W+++     FL      W     T S  I+       L   ++E S
Sbjct: 74  KQGAHDIGVKEALNWSLIWIALSFLFNGLFWWAVKDTTGSTEIANTKSLEFLTGYLIEKS 133

Query: 59  LSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMN 116
           L+ +N  +           + +QKR L  GI+ A   +R I  ++   +++         
Sbjct: 134 LAVDNIFVFLLIFTYFAVPTHYQKRVLMIGIIGA-IVLRTIMILVGGWLLA--------- 183

Query: 117 LAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
                              I    G FL++  +  ++ +  +                  
Sbjct: 184 ---------------EFHWILYVFGAFLILTGVKMWWAAGQE------------------ 210

Query: 177 GIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH 236
                            L  N     +         + G NF          N       
Sbjct: 211 ---------------PSLDDNPALKLLRKILPVSKNYDGENFWTV------ENGKKIATP 249

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
              +   + + D   ++D + + FAIT + FI++       + +R+M    L   + NK+
Sbjct: 250 LFMVICLVALTDVIFAVDSIPAIFAITSDPFIVLTSNVFAILGLRAM--YFLLAAVANKF 307

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
             L +G    +  +   M L  I  IP   +      ++ ++++ S++
Sbjct: 308 HLLNYGLAVILVFIGTKMCLIDIYKIPVGASLGVVVGILAVTMWLSVR 355


>gi|59802230|ref|YP_208942.1| hypothetical protein NGO1917 [Neisseria gonorrhoeae FA 1090]
 gi|194099826|ref|YP_002002961.1| Transmembrane transport protein [Neisseria gonorrhoeae NCCP11945]
 gi|239999998|ref|ZP_04719922.1| Transmembrane transport protein [Neisseria gonorrhoeae 35/02]
 gi|240013054|ref|ZP_04719967.1| Transmembrane transport protein [Neisseria gonorrhoeae DGI18]
 gi|240017623|ref|ZP_04724163.1| Transmembrane transport protein [Neisseria gonorrhoeae FA6140]
 gi|240081896|ref|ZP_04726439.1| Transmembrane transport protein [Neisseria gonorrhoeae FA19]
 gi|240114175|ref|ZP_04728665.1| Transmembrane transport protein [Neisseria gonorrhoeae MS11]
 gi|240119041|ref|ZP_04733103.1| Transmembrane transport protein [Neisseria gonorrhoeae PID1]
 gi|240122244|ref|ZP_04735206.1| Transmembrane transport protein [Neisseria gonorrhoeae PID24-1]
 gi|240122421|ref|ZP_04735377.1| Transmembrane transport protein [Neisseria gonorrhoeae PID332]
 gi|240126730|ref|ZP_04739616.1| Transmembrane transport protein [Neisseria gonorrhoeae SK-92-679]
 gi|240127134|ref|ZP_04739795.1| Transmembrane transport protein [Neisseria gonorrhoeae SK-93-1035]
 gi|254493433|ref|ZP_05106604.1| transmembrane transporter [Neisseria gonorrhoeae 1291]
 gi|260441606|ref|ZP_05795422.1| Transmembrane transport protein [Neisseria gonorrhoeae DGI2]
 gi|268595805|ref|ZP_06129972.1| transmembrane transporter [Neisseria gonorrhoeae 35/02]
 gi|268597994|ref|ZP_06132161.1| transmembrane transporter [Neisseria gonorrhoeae FA19]
 gi|268600249|ref|ZP_06134416.1| transmembrane transporter [Neisseria gonorrhoeae MS11]
 gi|268604757|ref|ZP_06138924.1| transmembrane transporter [Neisseria gonorrhoeae PID1]
 gi|268681008|ref|ZP_06147870.1| transmembrane transporter [Neisseria gonorrhoeae PID332]
 gi|268685310|ref|ZP_06152172.1| transmembrane transporter [Neisseria gonorrhoeae SK-92-679]
 gi|268685490|ref|ZP_06152352.1| transmembrane transporter [Neisseria gonorrhoeae SK-93-1035]
 gi|291044977|ref|ZP_06570686.1| transmembrane transporter [Neisseria gonorrhoeae DGI2]
 gi|293398047|ref|ZP_06642253.1| tellurite resistance protein TerC [Neisseria gonorrhoeae F62]
 gi|59719125|gb|AAW90530.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193935116|gb|ACF30940.1| Transmembrane transport protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512473|gb|EEH61818.1| transmembrane transporter [Neisseria gonorrhoeae 1291]
 gi|268549194|gb|EEZ44612.1| transmembrane transporter [Neisseria gonorrhoeae 35/02]
 gi|268551782|gb|EEZ46801.1| transmembrane transporter [Neisseria gonorrhoeae FA19]
 gi|268584380|gb|EEZ49056.1| transmembrane transporter [Neisseria gonorrhoeae MS11]
 gi|268588888|gb|EEZ53564.1| transmembrane transporter [Neisseria gonorrhoeae PID1]
 gi|268621292|gb|EEZ53692.1| transmembrane transporter [Neisseria gonorrhoeae PID332]
 gi|268625594|gb|EEZ57994.1| transmembrane transporter [Neisseria gonorrhoeae SK-92-679]
 gi|268625774|gb|EEZ58174.1| transmembrane transporter [Neisseria gonorrhoeae SK-93-1035]
 gi|291011871|gb|EFE03867.1| transmembrane transporter [Neisseria gonorrhoeae DGI2]
 gi|291611993|gb|EFF41062.1| tellurite resistance protein TerC [Neisseria gonorrhoeae F62]
 gi|317165295|gb|ADV08836.1| hypothetical protein NGTW08_1881 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 324

 Score =  159 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 107/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGIKETLAWSGLWVAVSCLFAGWLYFELAGNPGYGAAAAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------EDLANSRLLNAVKKVVPVGTAFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLIMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLGFIGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIY 317


>gi|261391571|emb|CAX49004.1| Alx protein [Neisseria meningitidis 8013]
          Length = 324

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 107/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGIKEALAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +       ++                 
Sbjct: 143 ---------------QQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------GDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  S+ +S+  
Sbjct: 268 FVFLKYGLAFVLGFIGVKMLIMHWVHIPISVSLSVVFGALGASVLTSLVY 317


>gi|304388812|ref|ZP_07370867.1| tellurium resistance protein TerC family protein [Neisseria
           meningitidis ATCC 13091]
 gi|304337216|gb|EFM03395.1| tellurium resistance protein TerC family protein [Neisseria
           meningitidis ATCC 13091]
          Length = 324

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 107/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGVKEALAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGSALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +       ++                 
Sbjct: 143 ---------------QQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------EDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  S+ +S+  
Sbjct: 268 FVFLKYGLAFVLSFIGVKMLVMHWVHIPISVSLSVVFGALGASVLTSLVY 317


>gi|159038903|ref|YP_001538156.1| integral membrane protein TerC [Salinispora arenicola CNS-205]
 gi|157917738|gb|ABV99165.1| Integral membrane protein TerC [Salinispora arenicola CNS-205]
          Length = 332

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 47/360 (13%), Positives = 101/360 (28%), Gaps = 90/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     W         + G GI      + +G   T ++       E SLS +
Sbjct: 28  RRPHEPSVRESSLWVGFYVALALIFGAGIWLVSGPSPAGQFYTGWLT------EYSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + +      +Q++ L  GI++A+  MR  F      ++S  +          
Sbjct: 82  NLFVFVIIMARFGVPRAYQQKVLLIGIVLAL-VMRGGFIAAGAALISQFS---------- 130

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+  +                                
Sbjct: 131 --------------WVFYIFGAFLLYTAFNLVRQGDPDED-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +  +   +      + G             +        L +
Sbjct: 157 ------------DFSENVLIRWSRRALPISRDYDGAKLTT------YEHGRRLFTPMLIV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F IT+  +++        + +R +    L  G+L++  YL 
Sbjct: 199 MIAIGTTDLIFALDSIPAIFGITQEAYLVFTANVFALMGLRQL--YFLLGGLLDRLIYLS 256

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L+ +                   IP   + T     + L+  +S+
Sbjct: 257 YGLAVVLGFIGVKLVLEALADNNLPFVNGGEHVAWAPHIPIWLSLTVILGTLILATVASL 316


>gi|161869031|ref|YP_001598197.1| transmembrane transport protein [Neisseria meningitidis 053442]
 gi|161594584|gb|ABX72244.1| transmembrane transport protein [Neisseria meningitidis 053442]
          Length = 324

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 49/350 (14%), Positives = 108/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K++S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNSSHKVGVKEALAWSGLWVAVSCLFAGWLYFKLAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +       ++                 
Sbjct: 143 ---------------QQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------GDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLGFIGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIY 317


>gi|298252100|ref|ZP_06975903.1| Integral membrane protein TerC [Ktedonobacter racemifer DSM 44963]
 gi|297546692|gb|EFH80560.1| Integral membrane protein TerC [Ktedonobacter racemifer DSM 44963]
          Length = 321

 Score =  159 bits (402), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 53/343 (15%), Positives = 101/343 (29%), Gaps = 74/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             S   S      W+ +         LG+       L+    T Y+       E SLS +
Sbjct: 30  RRSHTVSTREALIWSAVWIGLALAFNLGLYIFQGPDLALQFLTGYLI------EKSLSVD 83

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +          +   Q R L WG+L A+    ++                       
Sbjct: 84  NIFVFVLLFTYFAVAPRHQHRILFWGVLGALIMRGLLI---------------------- 121

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                  ++ +    I    G FL+   +         +H                    
Sbjct: 122 ---GVGTVLLETFHWIIYLFGAFLIFTGIRMGLQKDEAVHP------------------- 159

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   +         +    F          N        L +
Sbjct: 160 --------------ERNPVLKLLRRILPVSQDYDEGRFFTR------HNGRLLATPLLLV 199

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   ++D + + FA+T + FI+        + +RS+    +   +++K+ YL+
Sbjct: 200 LIVVETTDLVFAVDSIPAIFAVTNDPFIVYTSNVFAILGLRSL--YFVFANVIHKFYYLK 257

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V M L  I  IP   +     I++ L+I +S+
Sbjct: 258 AGLAVILTYVGVKMLLADIFHIPTALSLLVIAIVLALAIVASV 300


>gi|15889162|ref|NP_354843.1| transporter [Agrobacterium tumefaciens str. C58]
 gi|15156978|gb|AAK87628.1| transporter [Agrobacterium tumefaciens str. C58]
          Length = 327

 Score =  159 bits (402), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 54/346 (15%), Positives = 106/346 (30%), Gaps = 70/346 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            NS    +      +      G   G  I +Q     +    T ++       E SL+ +
Sbjct: 36  KNSKEIGIRESLLMSGFYIAIGLAFGGWIWYQSGQQSAMEYVTGFVV------EKSLAMD 89

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L WGIL  V  +R I       IV              
Sbjct: 90  NIFIIAMIFSYFAIPRQYQHRVLLWGILG-VIVLRGIMIAGGAAIV-------------- 134

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +    +      FL+   L   F+S +  + I                  
Sbjct: 135 ----------ENFHWVLYLFAAFLVFTGLKMLFSSDHDENDIG----------------- 167

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +  F+ S        +G  F      + +    T        
Sbjct: 168 ---------------NNRILKFLRSRLPVTEKPHGEKFFVKETDATTGKLKTFVTPLFLA 212

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +EI D   ++D + + FAIT + FI+        + +R++        +++++ YL+
Sbjct: 213 LIMVEIADLIFAVDSIPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAALIHRFAYLK 270

Query: 301 HGSYYSIFVLSVIMFLQTIV---DIPEIFTGTSSTILIFLSIYSSI 343
           +     +  +   +F+  ++    IP   +   +  ++   I  S+
Sbjct: 271 YALAAVLVFVGSKIFVADMLGIAKIPPAVSLGVTVAILATGIIGSL 316


>gi|120603427|ref|YP_967827.1| integral membrane protein TerC [Desulfovibrio vulgaris DP4]
 gi|120563656|gb|ABM29400.1| Integral membrane protein TerC [Desulfovibrio vulgaris DP4]
          Length = 359

 Score =  159 bits (401), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 50/348 (14%), Positives = 101/348 (29%), Gaps = 77/348 (22%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+      ++   V   L G GI             T Y+       E SLS
Sbjct: 25  LHRKDRDMSVAEALWMSLAYFVLAMLFGGGIFMFMGEQKGLEFLTGYLI------EKSLS 78

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +              Q R L WGIL A+     +                     
Sbjct: 79  VDNIFVFVLVFTHFSVPRHLQYRVLFWGILGALVMRAGLIVA------------------ 120

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                     I +A   +    G FL +  +     + ++                    
Sbjct: 121 -------GAAILEAFHWVIYVFGAFLAVTGVKMLLAADSEPD------------------ 155

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N +             + G +F+             +    L
Sbjct: 156 ---------------MAGNVVTRTFRRLFPMTEGYDGNHFMVRR------AGKLYATPLL 194

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            +   +E  D   +LD + + FA++++ FI+        + +R++       GI+++++Y
Sbjct: 195 MVLTIIEFTDLVFALDSIPAIFAVSRDPFIVYTSNVFAILGLRAL--YFALAGIIHRFRY 252

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD---IPEIFTGTSSTILIFLSIYSSI 343
           L++G    +  +   M +        IP       + ++I  S+  S+
Sbjct: 253 LKYGLSLVLVFIGAKMIINAWFAAKIIPTDVALLVTALIIGGSMVVSV 300


>gi|313669328|ref|YP_004049612.1| transmembrane transport protein [Neisseria lactamica ST-640]
 gi|313006790|emb|CBN88260.1| putative transmembrane transport protein [Neisseria lactamica
           020-06]
          Length = 326

 Score =  159 bits (401), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 46/350 (13%), Positives = 107/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGIKEALAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------EDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + + M +   V IP   + +     +  S+ +S+  
Sbjct: 268 FIFLKYGLAFVLSFIGLKMLVMHWVHIPISVSLSVVFGALGASVLTSLVY 317


>gi|325137430|gb|EGC60018.1| Integral membrane protein TerC family protein [Neisseria
           meningitidis ES14902]
          Length = 302

 Score =  159 bits (401), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 49/350 (14%), Positives = 108/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++    L    +             ++E 
Sbjct: 11  KNGSHKVGVKEALAWSGLWVAVSCLFAGWLYFELAGNLGYGAAVAKEKVLEFFTGYILEK 70

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 71  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 120

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 121 ---------------RQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 149

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 150 ----------------EDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 187

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 188 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 245

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 246 FIFLKYGLAFVLGFIGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIY 295


>gi|163800548|ref|ZP_02194449.1| putative transmembrane transport protein [Vibrio sp. AND4]
 gi|159175991|gb|EDP60785.1| putative transmembrane transport protein [Vibrio sp. AND4]
          Length = 339

 Score =  159 bits (401), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 44/350 (12%), Positives = 117/350 (33%), Gaps = 74/350 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEI 57
           ++     ++     W+I   +  F+    I + +     H++          +   ++E 
Sbjct: 40  QTRGGVITMKKAIGWSIFWFLLAFVFAGSIYFLWDYYVPHSVYTPEKATLSFLTGYLLEK 99

Query: 58  SLSFENAILNAKNLQK--MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SLS +N  + A    +  +    + R L WG++ A+  +R I   +   +++        
Sbjct: 100 SLSVDNLFVFAIIFAQYKVPEDLRPRALLWGVIGAL-VLRAIMIAVGAQLLAQ------- 151

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                            +  +      FL+   +    +   +     + E         
Sbjct: 152 -----------------YHWVLYLFAAFLIWTGIKLARDKGEEEEVNPYPE--------- 185

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                     F+         + G + +                
Sbjct: 186 -------------------------QFIRKFLPVTDEYQGNHLV------LKQAGKWVAT 214

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L +   + ++D   +LD + + FA+T+  F+++       + +RS+    + Q +L+K
Sbjct: 215 PMLVVVGVIAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSL--YFVLQAMLDK 272

Query: 296 YKYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           + YL+      +  + + M L  +  +IP +++ T    ++  ++ +S++
Sbjct: 273 FVYLKPALSVIMIFIGIKMLLVGSQYEIPTVWSLTFLVTVMTTAVIASMR 322


>gi|325133340|gb|EGC56006.1| protein Alx [Neisseria meningitidis M13399]
          Length = 324

 Score =  159 bits (401), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 107/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGVKEALAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIHMMKPEGDE----------------- 170

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 171 ---------------KEDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLGFIGVKMLIMHWVHIPISVSLSVVFGALGASILTSLIY 317


>gi|154250846|ref|YP_001411670.1| integral membrane protein TerC [Parvibaculum lavamentivorans DS-1]
 gi|154154796|gb|ABS62013.1| Integral membrane protein TerC [Parvibaculum lavamentivorans DS-1]
          Length = 354

 Score =  159 bits (401), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 47/346 (13%), Positives = 100/346 (28%), Gaps = 71/346 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                  +    + +      G   G  + W           T +      V+E SL+ +
Sbjct: 55  RKQHAIGVSESLKLSAFYICLGLAFGGFVWWWMGPDSGLKYLTGF------VIEKSLAVD 108

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A     +     +Q R L WGIL  V  +R I   +   +V              
Sbjct: 109 NLFVIAMIFAHLAIPREYQHRVLFWGILG-VIVLRGIMIGLGATLV-------------- 153

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +    I  F   FL+       F  +                        
Sbjct: 154 ----------ERFEWILWFFAAFLVYSGFRMLFAGEAD---------------------- 181

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           + +  F+  +       +G  F     +      V         
Sbjct: 182 -----------QAEEEHAVIGFMRRNFRVTKRLHGDRFFVKRPADREGKTVLFITPLFLA 230

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E+ D   ++D V + FAIT + +I+        + +R++         + +++YL+
Sbjct: 231 LVVIEVADVIFAVDSVPAIFAITTDAYIVYTSNVFAILGLRAL--YFALAATIERFRYLK 288

Query: 301 HGSYYSIFVLSVIMFLQTIV---DIPEIFTGTSSTILIFLSIYSSI 343
           H     +  +   + +  ++    IP   +   + +L+   +  S+
Sbjct: 289 HAIALVLIFIGSKIVVADMLDIAKIPPAISLGVTAVLLAGGVAYSM 334


>gi|145295871|ref|YP_001138692.1| hypothetical protein cgR_1796 [Corynebacterium glutamicum R]
 gi|140845791|dbj|BAF54790.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 369

 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 37/364 (10%), Positives = 101/364 (27%), Gaps = 92/364 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT-----HTLSGTISTVYICIILAVVEI 57
                 +L     W++       + G+ + + +      H       T Y+       E 
Sbjct: 28  RTPHEPTLKESAWWSLFYVGLACVFGIFLWFVWGEPGNPHQHGIEFFTGYVT------EK 81

Query: 58  SLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           +LS +N  + A  +        +Q++ L  GI +A                         
Sbjct: 82  ALSVDNLFIFALIMTAFKIPRKYQQKVLLIGIALA------------------------- 116

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
            +           + +A   +      +L+  ++   ++                     
Sbjct: 117 LIFRLLFILLGAAVIEAWSDVFYIFSIWLIYTAVKLLWDEVRDT---------------- 160

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                  +   +         ++G         +  +    H  
Sbjct: 161 --------------PETDPNDMFIIKALRKVIPVTEGYHGDKL------THRAGGKLHLT 200

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
                 + + ++D   +LD + + + IT   +I+        + +R M    L  G+L++
Sbjct: 201 PLFVALVSIGMVDLMFALDSIPAIYGITTEPYIVFTTNAFALLGLRQM--YFLLDGLLDR 258

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSI 339
             YL +G    +  +   + L  +                 ++  +F+      ++ +++
Sbjct: 259 LVYLPYGLGLILLFIGAKLGLHALHENNLPFINGGENVSVPEVSTVFSLVFIIGVLTITV 318

Query: 340 YSSI 343
            +S+
Sbjct: 319 IASV 322


>gi|145595650|ref|YP_001159947.1| integral membrane protein TerC [Salinispora tropica CNB-440]
 gi|145304987|gb|ABP55569.1| Integral membrane protein TerC [Salinispora tropica CNB-440]
          Length = 332

 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 47/360 (13%), Positives = 103/360 (28%), Gaps = 90/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     W         + G GI      + +G   T ++       E SLS +
Sbjct: 28  RRPHEPSVRESSLWVGFYVALALVFGAGIWLLSGPSAAGQFYTGWLT------EYSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + +      +Q++ L  GI++A+  MR  F      ++S  +          
Sbjct: 82  NLFVFVIIMARFGVPRAYQQKVLLIGIVLALL-MRGGFIAAGAALISQFS---------- 130

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+  ++       +                       
Sbjct: 131 --------------WVFYIFGAFLIYTAINLVRQGDSDED-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +  +   +      + G             +        L +
Sbjct: 157 ------------DFSENLLIRWSRRALPISRDYDGAKLTT------YEHGRRLFTPMLVV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F IT+  +++        + +R +    L  G+L++  YL 
Sbjct: 199 MIAIGTTDLIFALDSIPAIFGITQEAYLVFTANVFALMGLRQL--YFLLGGLLDRLIYLS 256

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L+ +                   IP   + T     + L+  +S+
Sbjct: 257 YGLAVVLGFIGVKLVLEALADNSLPFVNGGEHVGWAPHIPIWLSLTVILGTLTLATVASL 316


>gi|297807259|ref|XP_002871513.1| PDE149 [Arabidopsis lyrata subsp. lyrata]
 gi|297317350|gb|EFH47772.1| PDE149 [Arabidopsis lyrata subsp. lyrata]
          Length = 374

 Score =  158 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 45/349 (12%), Positives = 100/349 (28%), Gaps = 75/349 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       +    F+   L        G+GIG +     +      YI      +E SLS
Sbjct: 94  LNDYQQEETYKTSFKTVALCVGTAVAFGIGIGLKEGVGKASEFFAGYI------LEQSLS 147

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +     +      ++Q + LT+GI  A    R    ++    +     +  +  A
Sbjct: 148 VDNLFVFVLVFKYFKVPPMYQNKVLTYGIAGA-IVFRFTLILLGTATLQKFEAVNLLLAA 206

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
           +                            S   F + ++                     
Sbjct: 207 VLL------------------------YSSFKLFASEEDDTD------------------ 224

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +             + G  F          + +      L
Sbjct: 225 ---------------LSDNFIVKTCQRFIPVTSSYDGNRFFT------KHDGILKATPLL 263

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
                +E+ D + ++D + + F +T++ FI++       + +RS+    L    +++ +Y
Sbjct: 264 LTVAVIELSDIAFAVDSIPAVFGVTRDPFIVLTSNLFAILGLRSL--YTLISEGMDELEY 321

Query: 299 LEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+      +  +   M L      +    +     + +   +  S+ NK
Sbjct: 322 LQPSIAVVLGFIGFKMILDFFGFHVSTEASLGVVALSLGTGVVLSLTNK 370


>gi|256376167|ref|YP_003099827.1| integral membrane protein TerC [Actinosynnema mirum DSM 43827]
 gi|255920470|gb|ACU35981.1| Integral membrane protein TerC [Actinosynnema mirum DSM 43827]
          Length = 334

 Score =  158 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 46/328 (14%), Positives = 97/328 (29%), Gaps = 74/328 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   S+     W+ +    G   G  + W +    +      Y      V+E SL+ +
Sbjct: 27  RRAHVVSVREAAVWSAVWITLGLAFGGVVWWVWGADPAAQYFAGY------VIEKSLAVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A            Q R L +G+L A+   R +F      +++             
Sbjct: 81  NVFVFAIIFGYFAVPREHQHRVLFYGVLGAL-VFRAVFIAAGSVLIA------------- 126

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      +   I    G FL++  +         +                     
Sbjct: 127 -----------SFSWILYLFGAFLVLTGVKMARQKDEVVDP------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           + +              +G  FL                  L +
Sbjct: 157 --------------ERSAVLRLFRRFVPMTDRQHGHRFLVR------EGGKWVATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E+ D   ++D + + FA+T+  F++        + +R+M    L   +++++ YL+
Sbjct: 197 LVLVEVTDIVFAVDSIPAIFAVTQEPFLVFTSNAFAILGLRAM--YFLLADLMHRFTYLK 254

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTG 328
            G    +  + V M L  +  IP   + 
Sbjct: 255 LGLALVLVWVGVKMLLLDVYKIPTAASL 282


>gi|197122268|ref|YP_002134219.1| integral membrane protein TerC [Anaeromyxobacter sp. K]
 gi|196172117|gb|ACG73090.1| Integral membrane protein TerC [Anaeromyxobacter sp. K]
          Length = 320

 Score =  158 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 48/334 (14%), Positives = 96/334 (28%), Gaps = 74/334 (22%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
               W  +           + W+F    +    T Y+       E SLS +N  +     
Sbjct: 46  EALGWTAVWASLAAAFAGFVWWRFGANKAIEFVTGYLI------EQSLSVDNLFVFVLVF 99

Query: 72  QKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
                    Q R L WGI  A F +R++  +                            +
Sbjct: 100 ASFAIPPKLQHRVLFWGITTA-FFLRLVMIVGGTA------------------------L 134

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
                 +    G FL++  +  FF+ + + H                             
Sbjct: 135 LSRFHWLIYVFGGFLVVTGIRIFFHEEQEHHP---------------------------- 166

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
                  +  +  +     +     G +F          +              +EI D 
Sbjct: 167 -----EKSVAFRVLRRLVPSTSRMEGHHFFLV------EDGRRVATPLFLALCMIEISDV 215

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
             +LD V + F IT + FI+        + +RS+        +L +++YL+ G    +  
Sbjct: 216 VFALDSVPAIFGITLDPFIVFTSNIFAIMGLRSL--YFAVAQLLRRFEYLKAGLALVLVF 273

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + + M   + V +    +      L+  ++  S+
Sbjct: 274 IGLKMVASSWVHVNAFASLGVVVTLLGGAMAYSL 307


>gi|240116813|ref|ZP_04730875.1| Transmembrane transport protein [Neisseria gonorrhoeae PID18]
 gi|268602489|ref|ZP_06136656.1| transmembrane transporter [Neisseria gonorrhoeae PID18]
 gi|268586620|gb|EEZ51296.1| transmembrane transporter [Neisseria gonorrhoeae PID18]
          Length = 324

 Score =  158 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 49/350 (14%), Positives = 108/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGIKETLAWSGLWVAVSCLFAGWLYFELAGNPGYGAAAAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+  S+       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTSIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------EDLANSRLLNAVKKVVPVGTAFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLIMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLGFIGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIY 317


>gi|325293261|ref|YP_004279125.1| transmembrane transport protein [Agrobacterium sp. H13-3]
 gi|325061114|gb|ADY64805.1| putative transmembrane transport protein [Agrobacterium sp. H13-3]
          Length = 327

 Score =  158 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 54/346 (15%), Positives = 106/346 (30%), Gaps = 70/346 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            NS    +      +      G   G  I +Q     +    T ++       E SL+ +
Sbjct: 36  KNSKEIGIRESLLMSGFYIAIGLAFGGWIWYQSGEQPAMEYVTGFVV------EKSLAMD 89

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L WGIL  V  +R I       IV              
Sbjct: 90  NIFIIAMIFSYFAIPRQYQHRVLLWGILG-VIVLRGIMIAGGAAIV-------------- 134

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +    +      FL+   L   F+S +  + I                  
Sbjct: 135 ----------ENFHWVLYLFAAFLVFTGLKMLFSSDHDENDIG----------------- 167

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +  F+ S        +G  F      + +    T        
Sbjct: 168 ---------------NNRILKFLRSRLPVTEKLHGEKFFVKETDAATGKLKTFVTPLFLA 212

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +EI D   ++D + + FAIT + FI+        + +R++        +++++ YL+
Sbjct: 213 LIMVEIADLIFAVDSIPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAALIHRFAYLK 270

Query: 301 HGSYYSIFVLSVIMFLQTIV---DIPEIFTGTSSTILIFLSIYSSI 343
           +     +  +   +F+  ++    IP   +   +  ++   I  S+
Sbjct: 271 YALAAVLVFVGSKIFVADMLGIAKIPPAVSLGVTVAILATGIIGSL 316


>gi|326328950|ref|ZP_08195280.1| putative tellurium resistance protein [Nocardioidaceae bacterium
           Broad-1]
 gi|325953209|gb|EGD45219.1| putative tellurium resistance protein [Nocardioidaceae bacterium
           Broad-1]
          Length = 408

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 43/362 (11%), Positives = 103/362 (28%), Gaps = 92/362 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   +L     W+ +      L G+G+      T+ G     YI       E +LS +
Sbjct: 28  RKAHTPTLKEAATWSAIYVAIALLFGIGVLVFGGGTMGGEYFAGYIT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI  ++   R  F  +   +++             
Sbjct: 82  NLFVFLIIMTSFRVPREDQQKVLLFGITFSLIA-RTGFIFVGAALIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G  L+M +        +                       
Sbjct: 128 -----------TFAWVFYLFGLILLMTAGNMLKPDDDSH--------------------- 155

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +             + G             +        L +
Sbjct: 156 --------------GENFVVRLARRLFHVSEHYDGDKLFTV------EDGKRILTPMLLV 195

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+N +++        + +R +    L  G+L++  +L 
Sbjct: 196 MVAIGGTDILFALDSIPAIFGLTQNVYLVFTATAFSLLGLRQL--YFLLDGLLDRLIFLS 253

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSIK 344
           +G    +  + V + L  +                 +I    + +    ++ ++I +S+ 
Sbjct: 254 YGLAAILAFIGVKLILHALHENNIPFVNDGDPVHVVEISTGLSLSVILGVLVVTIVASLF 313

Query: 345 NK 346
           +K
Sbjct: 314 SK 315


>gi|295839533|ref|ZP_06826466.1| TerC family membrane protein [Streptomyces sp. SPB74]
 gi|197696888|gb|EDY43821.1| TerC family membrane protein [Streptomyces sp. SPB74]
          Length = 357

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 51/352 (14%), Positives = 108/352 (30%), Gaps = 77/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       SL     W ++  V   L G+G+      T        +I       E SLS
Sbjct: 25  IGRKPHEVSLKEAGIWTVVWIVLACLFGVGLLVFAGGTQGSEFFAGFIT------EKSLS 78

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + K    + +Q+R L  G+LIA+  +R +F +                  
Sbjct: 79  VDNLFVFVLIMAKFAVPTKFQQRVLLVGVLIAL-ALRTVFILAGAA-------------- 123

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                     + +    I    G FL+  +                              
Sbjct: 124 ----------MIENFSWIFYLFGAFLLYTAWKLIK------------------------- 148

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                     G  +    N++   + +       ++G             +        L
Sbjct: 149 ----EAREEDGEEDEFEENKLLKSLETRFGVADRYHGTKLFVR------QHGKRIMTPML 198

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +   D   +LD + + F +T++ +I+        + +R +    L  G+L K  +
Sbjct: 199 VVILAIGTTDVLFALDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLIGGLLKKLVH 256

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-------DIPEIFTGTSSTILIFLSIYSSI 343
           L +G    +  + V + L  +        +IP   +      ++ ++  +S+
Sbjct: 257 LSYGLSVILGFIGVKLVLHALHESGVHVPEIPTTVSLGVIVAVLAVTTVTSL 308


>gi|319639582|ref|ZP_07994329.1| transmembrane transporter [Neisseria mucosa C102]
 gi|317399153|gb|EFV79827.1| transmembrane transporter [Neisseria mucosa C102]
          Length = 324

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 104/350 (29%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+     S+     W+ +           + ++     +   +             V+E 
Sbjct: 33  KNGVHKVSIKEALAWSGIWVAVSCAFAGWLYFELAGNPAYGAAVAKEKVLEFFTGYVLEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+  A   +R I   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVEPKFQHRVLLYGVFGA-IVLRAIMIFIGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +        +                 
Sbjct: 143 ---------------QQFEWILYLFGAFLLYTGIHMMKPESEEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  N++ + +         F G  F          N      
Sbjct: 172 ----------------EDLSQNKILTLLKKVIPTSPQFDGEKFFT------IENGKRIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L      +
Sbjct: 210 PLLLVLIMIELSDVIFAVDSIPAIFAVTTDPFIVLTSNIFAILGLRAM--YFLLADFAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + + M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLSFIGIKMLIMHWVHIPISISLSVVFGALGASILTSLVY 317


>gi|296123600|ref|YP_003631378.1| integral membrane protein TerC [Planctomyces limnophilus DSM 3776]
 gi|296015940|gb|ADG69179.1| Integral membrane protein TerC [Planctomyces limnophilus DSM 3776]
          Length = 440

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 46/309 (14%), Positives = 95/309 (30%), Gaps = 74/309 (23%)

Query: 36  THTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFG 93
               +    T Y+       E SLS +N  + A  L      + +Q R L WGI+ A+  
Sbjct: 185 GSEAAIMYFTGYLV------EQSLSMDNIFVIALILSFFQVPAAYQHRVLFWGIIGAL-V 237

Query: 94  MRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFF 153
           MR +   +   I+                        Q    +    G  L+  ++   F
Sbjct: 238 MRGVMIALGAAII------------------------QRFDWVIYIFGALLIYTAVKMLF 273

Query: 154 NSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIF 213
               +L                                  L  N +  F+         F
Sbjct: 274 AHDEELD---------------------------------LEQNRLVKFIRRIIPVYPGF 300

Query: 214 YGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGL 273
            G +F   +      +            + +E  D   ++D + + F IT++ F++    
Sbjct: 301 VGDHFFTKL------DGKLAVTPLFVALMMVESTDLLFAVDSIPAVFGITQDPFLVFSSN 354

Query: 274 TIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTI 333
               + +RS+        +L+++++L++     +F +   M     +      +     +
Sbjct: 355 VFAILGLRSL--YFALVDLLDRFRFLKYSLVAILFFVGSKMLAHHYIVFSPFVSLFVIAV 412

Query: 334 LIFLSIYSS 342
            + L I +S
Sbjct: 413 FLGLGIGAS 421


>gi|156977126|ref|YP_001448032.1| hypothetical protein VIBHAR_05912 [Vibrio harveyi ATCC BAA-1116]
 gi|156528720|gb|ABU73805.1| hypothetical protein VIBHAR_05912 [Vibrio harveyi ATCC BAA-1116]
          Length = 343

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 46/350 (13%), Positives = 116/350 (33%), Gaps = 74/350 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEI 57
           ++     ++     W++   +  F+    I + +     H++          +   ++E 
Sbjct: 44  QTRGGVITMKKAIGWSVFWFLLAFVFAGSIYFFWDYYAPHSVYTHEKATISFLTGYLLEK 103

Query: 58  SLSFENAILNAKNLQK--MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SLS +N  + A    +  +    + R L WG++ A+  +R I   +   +++        
Sbjct: 104 SLSVDNLFVFAIIFAQYKVPEHLRPRALLWGVIGAL-VLRAIMIAVGAQLLAQ------- 155

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                            +  +      FL+   +    +   +     + E         
Sbjct: 156 -----------------YHWVLYLFAAFLIWTGIKLARDKGEEEEVNPYPE--------- 189

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                     F+         + G + +                
Sbjct: 190 -------------------------QFIRKFLPVTDEYQGNHLI------LKQAGKWVAT 218

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L +   + ++D   +LD + + FA+T+  F+++       + +RS+    + Q +L+K
Sbjct: 219 PMLIVVGVIAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSL--YFVLQAMLDK 276

Query: 296 YKYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           + YL+      +  + V M L  T  +IP +++ T    ++  ++ +SI 
Sbjct: 277 FVYLKPALSVIMMFIGVKMLLVGTQYEIPTVWSLTFLVTVMTTAVIASIY 326


>gi|153835412|ref|ZP_01988079.1| membrane protein TerC [Vibrio harveyi HY01]
 gi|148868052|gb|EDL67229.1| membrane protein TerC [Vibrio harveyi HY01]
          Length = 339

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 46/350 (13%), Positives = 116/350 (33%), Gaps = 74/350 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEI 57
           ++     ++     W++   +  F+    I + +     H++          +   ++E 
Sbjct: 40  QTRGGVITMKKAIGWSVFWFLLAFVFAGSIYFFWDYYAPHSVYTHEKATISFLTGYLLEK 99

Query: 58  SLSFENAILNAKNLQK--MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SLS +N  + A    +  +    + R L WG++ A+  +R I   +   +++        
Sbjct: 100 SLSVDNLFVFAIIFAQYKVPEHLRPRALLWGVIGAL-VLRAIMIAVGAQLLAQ------- 151

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                            +  +      FL+   +    +   +     + E         
Sbjct: 152 -----------------YHWVLYLFAAFLIWTGIKLARDKGEEEEVNPYPE--------- 185

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                     F+         + G + +                
Sbjct: 186 -------------------------QFIRKFLPVTDEYQGNHLI------LKQAGKWVAT 214

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L +   + ++D   +LD + + FA+T+  F+++       + +RS+    + Q +L+K
Sbjct: 215 PMLIVVGVIAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSL--YFVLQAMLDK 272

Query: 296 YKYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           + YL+      +  + V M L  T  +IP +++ T    ++  ++ +SI 
Sbjct: 273 FVYLKPALSVIMMFIGVKMLLVGTQYEIPTVWSLTFLVTVMTTAVIASIY 322


>gi|15675960|ref|NP_273078.1| hypothetical protein NMB0012 [Neisseria meningitidis MC58]
 gi|7225237|gb|AAF40491.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|316984538|gb|EFV63504.1| integral membrane TerC family protein [Neisseria meningitidis
           H44/76]
 gi|325139482|gb|EGC62022.1| protein Alx [Neisseria meningitidis CU385]
 gi|325199247|gb|ADY94702.1| protein Alx [Neisseria meningitidis H44/76]
          Length = 323

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 107/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGVKEALAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +       ++                 
Sbjct: 143 ---------------QQFEWILYLFGAFLLYTGIHMMKPEGDE----------------- 170

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 171 ---------------KEDLANSRLLNTVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  S+ +S+  
Sbjct: 268 FIFLKYGLAFVLGFIGVKMLVMHWVHIPISVSLSVVFGALGASVLTSLVY 317


>gi|220917051|ref|YP_002492355.1| Integral membrane protein TerC [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219954905|gb|ACL65289.1| Integral membrane protein TerC [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 320

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 49/334 (14%), Positives = 96/334 (28%), Gaps = 74/334 (22%)

Query: 12  HHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNL 71
               W  +           + W+F    +    T Y+       E SLS +N  +     
Sbjct: 46  EALGWTAVWASLAAAFAGLVWWRFGANKAIEFVTGYLI------EQSLSVDNLFVFVLVF 99

Query: 72  QKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKII 129
                    Q R L WGI  A F +R++  +                            +
Sbjct: 100 ASFAIPPKLQHRVLFWGITTA-FFLRLVMIVGGTA------------------------L 134

Query: 130 SQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFG 189
                 +    G FL++  +  FF+ + + H                             
Sbjct: 135 LSRFHWLIYVFGGFLVVTGIRIFFHEEQEHHP---------------------------- 166

Query: 190 ISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDA 249
                  +  +  +     +     G +F          N              +EI D 
Sbjct: 167 -----EKSVAFRVLRRLVPSTSRMEGHHFFLV------ENGRRLATPLFLALCMIEISDV 215

Query: 250 SLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFV 309
             +LD V + F IT + FI+        + +RS+        +L +++YL+ G    +  
Sbjct: 216 VFALDSVPAIFGITLDPFIVFTSNIFAIMGLRSL--YFAVAQLLRRFEYLKAGLALVLVF 273

Query: 310 LSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + + M   + V +    +      L+  ++  S+
Sbjct: 274 IGLKMVASSWVHVNAFASLGVVVTLLGGAMAYSL 307


>gi|225163754|ref|ZP_03726054.1| putative transmembrane transport protein [Opitutaceae bacterium
           TAV2]
 gi|224801624|gb|EEG19920.1| putative transmembrane transport protein [Opitutaceae bacterium
           TAV2]
          Length = 312

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 50/345 (14%), Positives = 105/345 (30%), Gaps = 73/345 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   SL     W+ +      +    I W    T +    T Y+      +E +LS +
Sbjct: 29  RKAHEVSLKEALGWSAVWISLALVFNGLIWWWHGSTPALEFLTGYL------LEKALSVD 82

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +           +I Q R L WGIL A+  MR +F    + +++             
Sbjct: 83  NLFVFLLLFGYFRIPTILQHRVLFWGILGAL-VMRAVFIAAGITLINR------------ 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          I    G FL+       F    +      L               
Sbjct: 130 ------------FHWIIYVLGAFLIYTGFKMAFCKSEEPDPSKGL--------------- 162

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             ++   +          G +F         +  V        +
Sbjct: 163 ------------------VFRLANKFWRITPDLKGQHFF-----WRDAKGVLWCTPLFLV 199

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   +LD + +  A+T++ F++        + +R++       G++  + +L 
Sbjct: 200 LVLVETTDVVFALDSIPAILAVTRDPFLVYTSNIFAILGLRAL--YFALSGVMKMFHHLH 257

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           +   + +  + V M +     +P   +     + + ++I +SI N
Sbjct: 258 YALAFILAFVGVKMVISGFFHVPVWISLIVIAVSLTVAIVTSIMN 302


>gi|257056569|ref|YP_003134401.1| tellurium resistance membrane protein TerC [Saccharomonospora
           viridis DSM 43017]
 gi|256586441|gb|ACU97574.1| membrane protein TerC, possibly involved in tellurium resistance
           [Saccharomonospora viridis DSM 43017]
          Length = 336

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 50/354 (14%), Positives = 103/354 (29%), Gaps = 83/354 (23%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       +     RW I       L G+G+     H       T YI       E SLS
Sbjct: 26  VDRKPHQVTAGEAARWVIFYVSCAVLFGVGVWILGGHDPGVEFFTGYIT------EYSLS 79

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    +      +I Q R L  GIL+A+  MR  F  +   +++           
Sbjct: 80  IDNLFIFMVIMASFRVPAIHQHRVLLIGILLAL-VMRAAFIAVGAVLIAK---------- 128

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                          V I    G FL+  ++    +                        
Sbjct: 129 --------------FVWIFFLFGAFLVWTAVNMVRSKDEDEE------------------ 156

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N +  +V         + G   +         +   H     
Sbjct: 157 ---------------YQENAVTRWVRRFFPVTQDYVGHKMIV------KQDGKRHLTPMF 195

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + +   D   ++D + + F IT++ +++        + +R +    L  G++ K  Y
Sbjct: 196 VVIVAIGSADLLFAVDSIPAIFGITQDAYLVFTANAFALMGLRQL--YFLLGGLVAKLVY 253

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD---------IPEIFTGTSSTILIFLSIYSSI 343
           L +G    +  +   + L  + +         I    +      ++ ++  +S+
Sbjct: 254 LSYGLAVILGFIGAKLVLHALHEYEVTPSWLVINNWTSLGVIAAVLTITTVASL 307


>gi|170780988|ref|YP_001709320.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169155556|emb|CAQ00672.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 377

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 46/360 (12%), Positives = 97/360 (26%), Gaps = 92/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 ++    RW++       + G+GIG        G     Y+       E +LS +
Sbjct: 63  RKPHEPTIGESARWSVFYIGLALIFGVGIGITNGWGFGGEYFAGYLT------EKALSID 116

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI+IA+  MR  F  +                   
Sbjct: 117 NLFVFLLIMTGFAVPRKYQQKVLMIGIVIALI-MRAGFIALGAA---------------- 159

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    +    G  L +++                                
Sbjct: 160 --------LIENFSWVFYIFGALLFVLAYQQLKGDH------------------------ 187

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N               F G  F   +      +        L  
Sbjct: 188 ----------GGNAADNMFVRIARRILPVHDEFVGDRFTTKI------DGKRFVTPLLLC 231

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +  +D   +LD + + + +T   +I+        + +R +    L  G+L +  YL 
Sbjct: 232 VIAIGFVDLVFALDSIPAIYGLTNEAYIVFTANAFALMGLRQL--YFLIGGLLERLVYLS 289

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + + + L  +                  +IP  F+       I ++  +S+
Sbjct: 290 QGLAVILAFIGLKLVLHAMHVNELPFINGGEPMLWAPEIPIWFSLLFIGATITVATVASL 349


>gi|297561961|ref|YP_003680935.1| integral membrane protein TerC [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296846409|gb|ADH68429.1| Integral membrane protein TerC [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 343

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 45/343 (13%), Positives = 104/343 (30%), Gaps = 77/343 (22%)

Query: 10  LIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAK 69
           +     WA        + G G+ +             ++       E SLS +N  +   
Sbjct: 41  MKQAAWWAAFYIGIAIIFGFGVWYFGGGGAGAEYFAGFVT------EKSLSIDNLFVFYL 94

Query: 70  NLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLK 127
            +        +Q   L  GI+IA+  MR IF ++   +++                    
Sbjct: 95  LMGSFAVPKKYQHEVLLVGIVIAL-VMRGIFIVLGAQVIN-------------------- 133

Query: 128 IISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSII 187
               A   +    G FL+        +                                 
Sbjct: 134 ----AWSEVFYLFGAFLIYTGYKIVRDHMKGDEEEK------------------------ 165

Query: 188 FGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEII 247
                      +   +         ++G +    +      +   H    L + + + +I
Sbjct: 166 -----DFTQTPVVRLLKRFWPVTDDYHGAHLTVKL------DGRRHITPMLLVIVAIGMI 214

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           D   ++D + + F +T++ +I+        + +R +    L  G++++  Y+  G    +
Sbjct: 215 DLVFAVDSIPAIFGLTQDAYIVFTANAFALLGLRQL--YFLLAGLMDRLAYISWGLSAIM 272

Query: 308 FVLSVIMFLQTIV----DIPEI---FTGTSSTILIFLSIYSSI 343
             + V M L  +      +PE+    + T    ++ ++I  S+
Sbjct: 273 VFIGVKMILHALHENGVHVPEVGIGLSLTVILGIMTITIVGSL 315


>gi|184200840|ref|YP_001855047.1| TerC family integral membrane protein [Kocuria rhizophila DC2201]
 gi|183581070|dbj|BAG29541.1| TerC family integral membrane protein [Kocuria rhizophila DC2201]
          Length = 404

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 42/359 (11%), Positives = 98/359 (27%), Gaps = 87/359 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 ++     W  L      L GL + +      +      ++       E +LS +
Sbjct: 28  RKPHEPTVKEAAMWTSLYVSLALLFGLIVLFWDGPGFAAEYYAGFVT------EQALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI++A+   R +F  +    ++             
Sbjct: 82  NLFVFLIIMASFKVPRADQQKVLLFGIVVALIA-RTLFIFVGAAAINR------------ 128

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+  +                                
Sbjct: 129 ------------WSALFYVFGLFLIYTAGNLVKGEVTDAD-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N M             + G      V      +        L +
Sbjct: 157 ----------EEDEANNVMVRLAKRFLKTTDEYDGDKLFTEV------DGKRMMTPMLLV 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + + + D   +LD + + F +T+  +I+        + +R +    L  G+L++  YL 
Sbjct: 201 MVAIGLTDIMFALDSIPAIFGLTQETYIVFTATAFSLMGLRQL--YFLIDGLLDRLIYLS 258

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V + L  +                 ++   F+      ++ L++ +S+
Sbjct: 259 WGLAIILGFIGVKLILHALHENTLSFINDGQSVHVVEVSTGFSLAVIVGVLVLTVVASL 317


>gi|254804032|ref|YP_003082253.1| putative transport protein TerC [Neisseria meningitidis alpha14]
 gi|254667574|emb|CBA03308.1| putative transport protein TerC [Neisseria meningitidis alpha14]
          Length = 324

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 107/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGIKEALAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------GDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLSDVEER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLSFIGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIY 317


>gi|325962341|ref|YP_004240247.1| membrane protein TerC, possibly involved in tellurium resistance
           [Arthrobacter phenanthrenivorans Sphe3]
 gi|323468428|gb|ADX72113.1| membrane protein TerC, possibly involved in tellurium resistance
           [Arthrobacter phenanthrenivorans Sphe3]
          Length = 399

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 43/359 (11%), Positives = 102/359 (28%), Gaps = 91/359 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   SL     W+ +        GLG+      T+       YI       E +LS +
Sbjct: 28  RKAHTPSLKEAALWSAIYVGIAVAFGLGVLVFGGTTMGTEYFAGYIT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ ++   R  F ++   +++             
Sbjct: 82  NLFVFLIIMASFRVPRADQQKVLLFGIVFSLIA-RTGFILLGAALIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      +   +    G  L++ +        +                       
Sbjct: 128 -----------SFAWVFYIFGLILLITAGNLLKPDSHDDD-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             +         A   + G             N        L +
Sbjct: 157 --------------SEGLVVRLAKKFLPASEHYDGDKLFTV------ENGKRVLTPMLLV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+N FI+        + +R +    L  G+L++  +L 
Sbjct: 197 MVAIGGTDILFALDSIPAIFGLTQNVFIVFTATAFSLMGLRQL--YFLIDGLLDRLIFLS 254

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +                 ++    + +    ++ +++ +SI
Sbjct: 255 YGLAVILGFIGVKLILHALHENTLPFINDGQHVSVVEVSTGVSLSVILGVLVVTVLASI 313


>gi|325129283|gb|EGC52122.1| protein Alx [Neisseria meningitidis OX99.30304]
          Length = 323

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 47/350 (13%), Positives = 107/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGVKEALAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIHMMKPEGDE----------------- 170

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 171 ---------------KEDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  S+ +S+  
Sbjct: 268 FVFLKYGLAFVLGFIGVKMLIMHWVHIPISVSLSVVFGALGASVLTSLVY 317


>gi|239833506|ref|ZP_04681834.1| Integral membrane protein TerC [Ochrobactrum intermedium LMG 3301]
 gi|239821569|gb|EEQ93138.1| Integral membrane protein TerC [Ochrobactrum intermedium LMG 3301]
          Length = 370

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 51/347 (14%), Positives = 107/347 (30%), Gaps = 69/347 (19%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +  +                 +     G  + WQ          T Y+       E SL+
Sbjct: 69  LHRDEHEIEAKESLLLYGFYVLIALAFGGWVWWQRGAEAGLEFYTGYLI------EQSLA 122

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A     +    ++Q R L WGIL  V   R I   +   +V            
Sbjct: 123 MDNMFVIATIFGFLGIPRLYQHRVLFWGILG-VIAFRAILIGLGAALV------------ 169

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            I    G FL+      F +                        
Sbjct: 170 ------------HEFNWILFLFGAFLVFTGFKMFGHKDE--------------------- 196

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                       +  +  N ++ F+          +G NF        +   VT      
Sbjct: 197 ------------TPDIEQNAVFKFLRRRFNITSELHGRNFTVKQPHPKTGKMVTWLTPLA 244

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E +D   ++D V + FA+T++ FI+        + +R++         +N+++Y
Sbjct: 245 VALIMVETVDLIFAVDSVPAVFAVTQDTFIVYTSNIFAVLGLRAL--YFALAAAMNRFRY 302

Query: 299 LEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIK 344
           L+      + ++ + +FL  + V I  + +  ++ +++   +  S+ 
Sbjct: 303 LQVSLAIILVLIGIKIFLVPLGVHINTLLSLVATLVILASGVLYSLY 349


>gi|121635815|ref|YP_976060.1| putative transmembrane transport protein [Neisseria meningitidis
           FAM18]
 gi|120867521|emb|CAM11298.1| putative transmembrane transport protein [Neisseria meningitidis
           FAM18]
 gi|325131256|gb|EGC53968.1| protein Alx [Neisseria meningitidis M6190]
 gi|325143407|gb|EGC65736.1| protein Alx [Neisseria meningitidis 961-5945]
          Length = 324

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 49/350 (14%), Positives = 108/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++    L    +             ++E 
Sbjct: 33  KNGSHKVGVKEALAWSGLWVAVSCLFAGWLYFELAGNLGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------EDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLGFIGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIY 317


>gi|269963209|ref|ZP_06177543.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269832014|gb|EEZ86139.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 339

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 46/350 (13%), Positives = 116/350 (33%), Gaps = 74/350 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEI 57
           ++     ++     W++   +  F+    I + +     H++          +   ++E 
Sbjct: 40  QTRGGVITMKKAIGWSVFWFLLAFVFAGSIYFFWDYYAPHSVYTHEKATISFLTGYLLEK 99

Query: 58  SLSFENAILNAKNLQK--MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SLS +N  + A    +  +    + R L WG++ A+  +R I   +   +++        
Sbjct: 100 SLSVDNLFVFAIIFAQYKVPEHLRPRALLWGVIGAL-VLRAIMIAVGAQLLAQ------- 151

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                            +  +      FL+   +    +   +     + E         
Sbjct: 152 -----------------YHWVLYLFAAFLIWTGIKLARDKGEEEEVNPYPE--------- 185

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                     F+         + G + +                
Sbjct: 186 -------------------------QFIRKFLPVTEEYQGNHLI------LKQAGKWVAT 214

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L +   + ++D   +LD + + FA+T+  F+++       + +RS+    + Q +L+K
Sbjct: 215 PMLIVVGVIAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSL--YFVLQAMLDK 272

Query: 296 YKYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           + YL+      +  + V M L  T  +IP +++ T    ++  ++ +SI 
Sbjct: 273 FVYLKPALSVIMMFIGVKMLLVGTQYEIPTVWSLTFLVTVMTTAVIASIY 322


>gi|325197318|gb|ADY92774.1| protein Alx [Neisseria meningitidis G2136]
          Length = 324

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 107/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGIKEALAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------GDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLSDVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLSFIGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIY 317


>gi|262377819|ref|ZP_06071035.1| TerC family protein [Acinetobacter lwoffii SH145]
 gi|262307267|gb|EEY88414.1| TerC family protein [Acinetobacter lwoffii SH145]
          Length = 347

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 48/346 (13%), Positives = 108/346 (31%), Gaps = 71/346 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                  +      +      G L G  + W    T      T +      V+E SL+ +
Sbjct: 58  RKVREIGVKESLALSAFYITLGLLFGAWVWWYLGPTAGINYVTGF------VIEKSLAMD 111

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A          I+Q R L WGI+  +F +R I   +   +VS  +          
Sbjct: 112 NIFVIAMIFSYFSIPRIYQHRVLFWGIIGVIF-LRAIMIGVGATLVSQFS---------- 160

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +      FL+   +  + +   +                      
Sbjct: 161 --------------WVLYIFAAFLIFTGIKMWLSVDKEYE-------------------- 186

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                        +  + + +F+          +   F    +   ++            
Sbjct: 187 -------------VGNSPILNFIKKRFRVTEQLHAEKFWVKKIDPKTNQLTWFMTPLFLA 233

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E +D   ++D V + FAIT + FI+        + +R++        +++++ YL+
Sbjct: 234 LIMIEFVDLIFAIDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALSAMVDRFHYLK 291

Query: 301 HGSYYSIFVLSVIMFLQTIV---DIPEIFTGTSSTILIFLSIYSSI 343
           +     +  +   +F+   +    IP   + + + I++F  I  S+
Sbjct: 292 YALAVLLVFIGSKIFIADGLGIAKIPPPVSLSITFIILFTGILYSL 337


>gi|111022350|ref|YP_705322.1| tellerium resistance protein [Rhodococcus jostii RHA1]
 gi|110821880|gb|ABG97164.1| possible tellerium resistance protein [Rhodococcus jostii RHA1]
          Length = 396

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 43/362 (11%), Positives = 102/362 (28%), Gaps = 90/362 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            ++   +L     W+ +      L G+ +       +       Y+       E +LS +
Sbjct: 28  RHAHIPTLKEAAIWSSIYVGLALLFGVAVLIFGGVDMGSEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ ++F  R  F  +                   
Sbjct: 82  NLFVFLIIMSSFRVPREDQQKVLLFGIVFSIFA-RTAFIFLGAA---------------- 124

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   +  +   +  F G  L++ +           H                    
Sbjct: 125 --------LINSFAWVFYFFGLILLITAGNMLRPETEDSHS------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +             + G             N        L +
Sbjct: 158 --------------ADNFIIRIAKKFMHTTEHYDGDKLFT------IENGKRAMTPMLLV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+N F++        + +R +    L  G+L++  YL 
Sbjct: 198 MVAIGGTDILFALDSIPAIFGLTQNVFVVFTATVFSLMGLRQL--YFLLDGLLDRLIYLS 255

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSIK 344
           +G    +  + V + L  +                 +I    +      ++ +++ +S+ 
Sbjct: 256 YGLSAILAFIGVKLILHALHENNLPFVNDGEPVNVIEISTFASLAVIIGILVITVIASLT 315

Query: 345 NK 346
           +K
Sbjct: 316 SK 317


>gi|325207067|gb|ADZ02519.1| protein Alx [Neisseria meningitidis NZ-05/33]
          Length = 324

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 107/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGIKEALAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIHMMKPKGDE----------------- 170

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 171 ---------------KEDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLSFIGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIY 317


>gi|289705491|ref|ZP_06501883.1| integral membrane protein, TerC family [Micrococcus luteus SK58]
 gi|289557720|gb|EFD51019.1| integral membrane protein, TerC family [Micrococcus luteus SK58]
          Length = 347

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 39/360 (10%), Positives = 99/360 (27%), Gaps = 92/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     W         +    +               ++       E SLS +
Sbjct: 29  RRPHEPSMKEAGLWIGFYVALALVFAGLLFALGDAQHGTEFLAGWVT------EYSLSVD 82

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + K      +Q+  L  GI+IA+   R +F  +    +  +           
Sbjct: 83  NLFVFLIIMAKFQVPRRYQQEVLMVGIIIALIA-RAVFIAVGAVAIEHLT---------- 131

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+  +     +          +               
Sbjct: 132 --------------WVFYIFGAFLLWTAWQQLKDDGEDEESEPGVVAR------------ 165

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                                 ++        + G     +V      +        + +
Sbjct: 166 ----------------------LTRRLNVAPDYDGNRLRTTV------DGRRMFTPMVVV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+ + + D   ++D + + F +T+N+FI++       + +R +    L  G++++  +L+
Sbjct: 198 FITIGLTDVMFAVDSIPAIFGLTQNWFIVLTANIFALMGLRQL--YFLLGGLMDRLVFLK 255

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           HG  + +  + V +    +                  +I    +       + L+  +S+
Sbjct: 256 HGLAFILAFIGVKLVFHALHENELPFINGGHPVTAVPEISTFVSLGVILGTLVLATVASL 315


>gi|302868818|ref|YP_003837455.1| Integral membrane protein TerC [Micromonospora aurantiaca ATCC
           27029]
 gi|315504712|ref|YP_004083599.1| integral membrane protein terc [Micromonospora sp. L5]
 gi|302571677|gb|ADL47879.1| Integral membrane protein TerC [Micromonospora aurantiaca ATCC
           27029]
 gi|315411331|gb|ADU09448.1| Integral membrane protein TerC [Micromonospora sp. L5]
          Length = 332

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 45/362 (12%), Positives = 104/362 (28%), Gaps = 90/362 (24%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+     W         L G+ +       ++G   T ++       E SLS
Sbjct: 26  IGRRPHEPSVRESSLWVGFYVGLALLFGVVLWLTAGGRVAGEFYTGWLT------EYSLS 79

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + +      +Q++ L  GI++A+  MR  F      ++S  +        
Sbjct: 80  VDNLFVFVIIMARFGVPRQYQQKVLLVGIILALI-MRGGFIAAGAALISQFS-------- 130

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL+  ++      +                      
Sbjct: 131 ----------------WVFYIFGAFLIYTAVNLARQGEPDED------------------ 156

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N +  +   +      + G             +        L
Sbjct: 157 --------------EFSENLLIRWSRKALPLSRDYDGARMTTH------EHGRRLFTPML 196

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + +   D   +LD + + F IT+  +++        + +R +    L  G+L++  Y
Sbjct: 197 IVMIAIGTTDLIFALDSIPAIFGITQEPYLVFTANVFALMGLRQL--YFLLGGLLDRLIY 254

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYS 341
           L +G    +  + V + L+ +                   IP   + T     + ++  +
Sbjct: 255 LSYGLAVVLGFIGVKLVLEALAENNLPFINGGEHVAWAPHIPIWLSLTVILGTLAVATAA 314

Query: 342 SI 343
           S+
Sbjct: 315 SL 316


>gi|326777908|ref|ZP_08237173.1| integral membrane protein, TerC family [Streptomyces cf. griseus
           XylebKG-1]
 gi|326658241|gb|EGE43087.1| integral membrane protein, TerC family [Streptomyces cf. griseus
           XylebKG-1]
          Length = 373

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 47/353 (13%), Positives = 102/353 (28%), Gaps = 82/353 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ L      + G  +      T     +T ++      +E SLS +
Sbjct: 76  RKAHVIGFREAGLWSALWVGLALVFGAVVFLTLGSTAGTEYTTAWL------LEKSLSVD 129

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G++ A+   R +F  + V +V+             
Sbjct: 130 NLFVFALIFAYFKVPREYQHRVLFFGVVGAL-VFRAVFLTLGVAVVNRFTF--------- 179

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +       L   S       +                        
Sbjct: 180 ---------------VLFLFAAILFYSSYKILSGQEENFDPGKSF--------------- 209

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                                 +         + G +F+                  L +
Sbjct: 210 ------------------AVRMLRKVMPVQDHYSGTHFVVR------EEGRRVATPLLAV 245

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
              +E  D   ++D V +  A++ + FI+        + +R++    L  G+L+++ YL 
Sbjct: 246 VAAIEAADLIFAVDSVPAVLAVSDDLFIVYTSNAFAILGLRAL--YFLLAGLLDRFHYLS 303

Query: 301 HGSYYSIFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSIKN 345
           HG    +  ++V + LQ           +IP   +     +++ +S+  S++ 
Sbjct: 304 HGLAVILAFIAVKLVLQACHKMISTSIPEIPSPVSLAVIVVILAVSVTLSLRR 356


>gi|224068600|ref|XP_002326155.1| predicted protein [Populus trichocarpa]
 gi|222833348|gb|EEE71825.1| predicted protein [Populus trichocarpa]
          Length = 372

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 46/329 (13%), Positives = 94/329 (28%), Gaps = 75/329 (22%)

Query: 21  TVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--SSIW 78
                  G GIG +     +      YI      +E SLS +N  +     +      ++
Sbjct: 114 VCTAVAFGFGIGLKDGVGKASEFFAGYI------LEQSLSVDNLFVFVLIFKYFKVPLMY 167

Query: 79  QKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISG 138
           Q R L++GI  A+   R+   ++    +                        Q    ++ 
Sbjct: 168 QNRVLSYGIAGAII-FRLSLILLGTATL------------------------QRFEAVNL 202

Query: 139 FGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNE 198
           F  T L+  S   F   ++                                    L  N 
Sbjct: 203 FLATILLYSSFKLFATEEDDSD---------------------------------LSDNF 229

Query: 199 MYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVIS 258
           +             + G  F+         + +      L     +E+ D + ++D + +
Sbjct: 230 IVKTCQRFIPVTSNYDGNKFITR------EDGLWKATPLLLTVAVIELSDIAFAVDSIPA 283

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQ- 317
            F +T++ FI+        + +RS+    L    +   +YL+      +  +   M L  
Sbjct: 284 VFGVTRDPFIVFSSNLFAILGLRSL--YTLISEGMADLEYLQPSIAIVLGFIGCKMILDF 341

Query: 318 TIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
               I    +       +   +  S+  K
Sbjct: 342 MGFHISTEASLGFVATSLGAGVLLSLMKK 370


>gi|261401503|ref|ZP_05987628.1| protein Alx [Neisseria lactamica ATCC 23970]
 gi|269208406|gb|EEZ74861.1| protein Alx [Neisseria lactamica ATCC 23970]
          Length = 326

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 45/350 (12%), Positives = 106/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGIKETLAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G  L+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAVLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------EDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + + M +   V IP   + +     +  S+ +S+  
Sbjct: 268 FIFLKYGLAFVLSFIGLKMLVMHWVHIPISVSLSVVFGALGASVLTSLVY 317


>gi|309379847|emb|CBX21623.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 327

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 47/350 (13%), Positives = 108/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGIKEALAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIHMMKPEGDE----------------- 170

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V        +F+G  F          N      
Sbjct: 171 ---------------KEDLANSRLLNAVKKVVPVGTVFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  S+ +S+  
Sbjct: 268 FIFLKYGLAFVLSFIGVKMLVMHWVHIPISISLSVVFGALGASVLTSLVY 317


>gi|325205118|gb|ADZ00571.1| protein Alx [Neisseria meningitidis M04-240196]
          Length = 323

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 108/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K++S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNSSHKVGVKEALAWSGLWVAVSCLFAGWLYFKLAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +       ++                 
Sbjct: 143 ---------------QQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------GDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  S+ +S+  
Sbjct: 268 FVFLKYGLAFVLSFIGVKMLVMHWVHIPISVSLSVVFGALGASVLTSLVY 317


>gi|291450741|ref|ZP_06590131.1| integral membrane export protein [Streptomyces albus J1074]
 gi|291353690|gb|EFE80592.1| integral membrane export protein [Streptomyces albus J1074]
          Length = 333

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 53/354 (14%), Positives = 107/354 (30%), Gaps = 78/354 (22%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+     W I+  V   L G+G+        +G     YI       E SLS
Sbjct: 21  IGRKPHDVSIKEAGIWTIVWIVLAALFGVGLLLFGGGQQAGEFFAGYIT------EKSLS 74

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + K    S +Q+R L  G+LIA+    I        I +           
Sbjct: 75  VDNLFVFVLIMAKFSVPSQYQQRVLLIGVLIALVLRAIFIAAGAAIIAN----------- 123

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL+  +      +++      + E  +   ++    
Sbjct: 124 --------------FSWVFYIFGAFLIYTAWKLIQEARSGDDDEDWEENRLLKAAE---- 165

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                                             ++G             N        L
Sbjct: 166 --------------------------RRFGVADRYHGTKLFI------EKNGKKIMTPML 193

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +   D   +LD + + F +T++ +I+        + +R +    L  G+L K  +
Sbjct: 194 VVMLAIGTTDLLFALDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLLGGLLRKLVH 251

Query: 299 LEHGSYYSIFVLSVIMFLQTIV----DIPEI---FTGTSSTILIFLSIYSSIKN 345
           L +G    +  + V + L  +      +PEI    +      ++ ++  +S+  
Sbjct: 252 LSYGLSVILGFIGVKLVLHALHESGVHVPEISIPVSLGVICAVLVVTTITSLYA 305


>gi|257069374|ref|YP_003155629.1| tellurium resistance membrane protein TerC [Brachybacterium faecium
           DSM 4810]
 gi|256560192|gb|ACU86039.1| membrane protein TerC, possibly involved in tellurium resistance
           [Brachybacterium faecium DSM 4810]
          Length = 474

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 43/321 (13%), Positives = 88/321 (27%), Gaps = 68/321 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   ++     W  +      L G+ +      T+       +I       E++LS +
Sbjct: 37  RKAHIPTIGEAALWTGIYQGIALLFGISVFVFGGPTMGTEYFAGWIT------ELALSVD 90

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    L        +Q++ L +GI  A+     +  +  V I               
Sbjct: 91  NLFVFLVILGAFAVPREFQQKVLLFGIAFAIIARGSMIALGAVAI--------------- 135

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +       F G  L+  ++   ++                          
Sbjct: 136 ----------EHLSWTFYFFGAILLYTAIKMLWDE------------------------- 160

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
             V                   V     A   F G             N        L +
Sbjct: 161 --VHEDGDEDGEEEKDGLFVRVVRKFLPASEDFDGDRLFT------IENGKRVFTPMLLV 212

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+N +I+        + +R M    L  G+L++  YL 
Sbjct: 213 MIAIGGTDLLFALDSIPAIFGLTQNTYIVFTATAFSLLGLRQM--FFLIDGLLDRLVYLS 270

Query: 301 HGSYYSIFVLSVIMFLQTIVD 321
            G    +  + V +    + +
Sbjct: 271 FGLSIILAFIGVKLVFHALHE 291


>gi|289705489|ref|ZP_06501881.1| integral membrane protein, TerC family [Micrococcus luteus SK58]
 gi|289557718|gb|EFD51017.1| integral membrane protein, TerC family [Micrococcus luteus SK58]
          Length = 419

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 46/360 (12%), Positives = 108/360 (30%), Gaps = 85/360 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   ++     W+ +      + GL          +    T Y+      +E +LS +
Sbjct: 28  RKAHTPTIKEAAVWSGVYVGLALVFGLVFFAFGDTQHAVEYYTGYL------LEKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L +GI  A+   R +F ++   +++             
Sbjct: 82  NLFVFLVIMASFRVPREYQQKVLLFGITFALIS-RTLFILLGAAVIA------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   +    G FL++++        +        E              
Sbjct: 128 -----------AWSDVFYLFGLFLLIIAGGQLKGEMSGDAEGAQDE-------------- 162

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N M   V     A   F G     +V      +        L +
Sbjct: 163 --------------ADNVMVRLVKRFLPASDQFDGERLFTTV------DGKRLMTPMLLV 202

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   + D + + F +T+  +I+        + +R +    L  G+L++  YL 
Sbjct: 203 MIAIGATDILFAFDSIPAIFGVTQEAYIVFTATAFSLMGLRQL--YFLIDGLLDRLVYLA 260

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSIK 344
           +G    +  + V + L  +                 +IP   +     +++ +++  S+ 
Sbjct: 261 YGLSALLAFIGVKLILHALHENNLPFINGGENVPVAEIPTNLSLVVVVVILAITVLVSLY 320


>gi|148272296|ref|YP_001221857.1| TerC family membrane protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147830226|emb|CAN01159.1| conserved membrane protein, TerC family [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 367

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 50/360 (13%), Positives = 110/360 (30%), Gaps = 92/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   +L     W+++  V   + G+G+G     T  G     Y+       E +LS +
Sbjct: 28  RKAHEPTLKESATWSVVYIVIALVFGVGVGVFSNWTFGGEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI IA+  MR IF  M   I+              
Sbjct: 82  NLFVFLIIMSSFAVPRAFQQKVLLVGIAIAL-VMRGIFIAMGSAII-------------- 126

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G  L++++      + ++                      
Sbjct: 127 ----------DNFSWVFYLFGALLLVMAYKQMKETHDEDE-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +++   +         + G      V      +          +
Sbjct: 157 --------------SDSKLIRVLRRFIPTSDHYDGDKLTTRV------DGKKLFTPMFLV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L + + D   +LD + + F +T+  +I+        + +R +    L  G+L +  YL 
Sbjct: 197 MLAIGLTDVLFALDSIPAIFGLTQEAYIVFTANAFALLGLRQL--YFLISGLLERLIYLS 254

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  ++V + L  +                  +IP  F+ +   + I ++  +S+
Sbjct: 255 QGLAVILGFIAVKLVLHAMHVNEVPFINGGEPMLWAPEIPIWFSLSFILLTITVATVASL 314


>gi|254671831|emb|CBA03979.1| putative transport protein [Neisseria meningitidis alpha275]
          Length = 323

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 50/350 (14%), Positives = 108/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++    L    +             ++E 
Sbjct: 33  KNGSHKVGVKEALAWSGLWVAVSCLFAGWLYFELAGNLGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +       ++                 
Sbjct: 143 ---------------QQFEWILYLFGAFLLYTGIHMMKPEGDE----------------- 170

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 171 ---------------KEDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLGFIGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIY 317


>gi|18416778|ref|NP_568257.1| PDE149 (PIGMENT DEFECTIVE 149) [Arabidopsis thaliana]
 gi|332004383|gb|AED91766.1| TerC integral membrane domain-containing protein [Arabidopsis
           thaliana]
          Length = 384

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 48/349 (13%), Positives = 102/349 (29%), Gaps = 75/349 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +K      +    F+   L        G+GIG +     +      YI      +E SLS
Sbjct: 104 LKDYQQEETYKTSFKTVALCVGTAVAFGIGIGLKEGVGKASEFFAGYI------LEQSLS 157

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +     +      ++Q + LT+GI  A    R    ++    +     +  +  A
Sbjct: 158 VDNLFVFVLVFKYFKVPLMYQNKVLTYGIAGA-IVFRFTLILLGTATLQKFEAVNLLLAA 216

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
           +                            S   F + ++                     
Sbjct: 217 VLL------------------------YSSFKLFASEEDDTD------------------ 234

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +             + G  F          + +      L
Sbjct: 235 ---------------LSDNFIVKTCQRFIPVTSSYDGNRFFT------KHDGILKATPLL 273

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
                +E+ D + ++D + + F +T++ FI++       + +RS+    L    +++ +Y
Sbjct: 274 LTVAVIELSDIAFAVDSIPAVFGVTRDPFIVLTSNLFAILGLRSL--YTLISEGMDELEY 331

Query: 299 LEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+      +  + V M L      I    +     + +   +  S+ NK
Sbjct: 332 LQPSIAVVLGFIGVKMILDFFGFHISTEASLGVVALSLSTGVLLSLTNK 380


>gi|257093762|ref|YP_003167403.1| Integral membrane protein TerC [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257046286|gb|ACV35474.1| Integral membrane protein TerC [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 327

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 51/344 (14%), Positives = 109/344 (31%), Gaps = 70/344 (20%)

Query: 4   NSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLSF 61
            S   S+     W I            + W    TL   ++       LA  ++E SLS 
Sbjct: 36  KSHKVSVKEALAWVIAWVCLALAFAGLLWWYLNGTLGAEVAHKKTLEFLAGYLIEQSLSV 95

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  +              Q+R L +G+L A   MR    +  V +V+            
Sbjct: 96  DNMFVFVMIFGYFAVPPELQRRVLLYGVLGA-IVMRAGMILAGVWLVTQ----------- 143

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                           I    G FL++  +     ++ +                     
Sbjct: 144 -------------FAWILYVFGAFLVVTGIKMLIFAEAEPD------------------- 171

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         L  N +  ++         F+G +F          N +        
Sbjct: 172 --------------LERNPLLRWLRGHLRITPNFHGESFFVR------QNGILWATPMFL 211

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
           + + +E  D   ++D + + FA+T + FI+        + +R++    L   + ++++ L
Sbjct: 212 VLVLIEASDVVFAVDSIPAIFAVTTDPFIVFTSNIFAIMGLRAL--YFLLADMADRFRLL 269

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           ++G    +  +   M       +P  ++ +    +I +S+ +S+
Sbjct: 270 KYGLAIVLVFIGGKMLATPWFHMPIQWSLSIVGSIIAVSVVASL 313


>gi|325143574|gb|EGC65895.1| protein Alx [Neisseria meningitidis M01-240013]
          Length = 324

 Score =  156 bits (395), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 108/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K++S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNSSHKVGVKEALAWSGLWVAVSCLFAGWLYFKLAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------EDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLSFIGVKMLVMHWVHIPISVSLSIVFGALGASILTSLIY 317


>gi|300858681|ref|YP_003783664.1| hypothetical protein cpfrc_01264 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300686135|gb|ADK29057.1| putative membrane protein [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302206389|gb|ADL10731.1| Integral membrane protein TerC family [Corynebacterium
           pseudotuberculosis C231]
 gi|302330945|gb|ADL21139.1| Integral membrane protein TerC family [Corynebacterium
           pseudotuberculosis 1002]
 gi|308276632|gb|ADO26531.1| Integral membrane protein TerC family [Corynebacterium
           pseudotuberculosis I19]
          Length = 351

 Score =  156 bits (395), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 43/361 (11%), Positives = 106/361 (29%), Gaps = 92/361 (25%)

Query: 6   LYASLIHHFRWAILVTVAGFLCGLGIGWQFT-----HTLSGTISTVYICIILAVVEISLS 60
              +L     W++   V     G+ + + +      H       T Y+       E +LS
Sbjct: 39  HEPTLKESAGWSLFYVVLACAFGVFLWFAWGEPGNPHQHGIEFFTGYVT------EKALS 92

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A  +        +Q++ L  GI +A+   R+IF ++   ++            
Sbjct: 93  VDNLFVFALIMGTFKIPRKYQQKVLLIGIALALI-FRLIFILLGAAVI------------ 139

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                        A   +    G FL+  ++   ++                        
Sbjct: 140 ------------HAWSDVFYVFGIFLLYTAIKLIYDEATDQ------------------- 168

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                               +  ++         +   +                     
Sbjct: 169 -----------PETDPNDMRIIKWLRKVVHVTPTYEKDHLYIH------QKGKFALTPLF 211

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + + +ID   + D + + + ITK  +I+        + +R M    L  G+L +  Y
Sbjct: 212 IALVAVGMIDLMFAFDSIPAIYGITKEPYIVFTTNAFALLGLRQM--YFLLDGLLERLVY 269

Query: 299 LEHGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSS 342
           L +G    +  + V + L  +                 +I  +++  +   ++ +++ +S
Sbjct: 270 LPYGLGIILGFIGVKLVLHALHENKLPFINGGDSVPVPEIGTVWSLVAIVGILTVTVLAS 329

Query: 343 I 343
           +
Sbjct: 330 V 330


>gi|308388238|gb|ADO30558.1| putative transmembrane transport protein [Neisseria meningitidis
           alpha710]
 gi|325135395|gb|EGC58016.1| protein Alx [Neisseria meningitidis M0579]
 gi|325201210|gb|ADY96664.1| protein Alx [Neisseria meningitidis M01-240149]
          Length = 324

 Score =  156 bits (394), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 50/350 (14%), Positives = 108/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++    L    +             ++E 
Sbjct: 33  KNGSHKVGVKEALAWSGLWVAVSCLFAGWLYFELAGNLGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +       ++                 
Sbjct: 143 ---------------QQFEWILYLFGAFLLYTGIHMMKPEGDE----------------- 170

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 171 ---------------KEDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLSFIGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIY 317


>gi|77459481|ref|YP_348988.1| integral membrane protein TerC [Pseudomonas fluorescens Pf0-1]
 gi|77383484|gb|ABA74997.1| Integral membrane protein TerC [Pseudomonas fluorescens Pf0-1]
          Length = 325

 Score =  156 bits (394), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 52/345 (15%), Positives = 102/345 (29%), Gaps = 70/345 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLS 60
             +   S+     W     +        + W         I+ V     L   ++E SLS
Sbjct: 33  RKAHRVSVREASSWVFAWCMLAMAFAGLLWWYLNGEFGPEIAKVKTLEFLTGYLIEQSLS 92

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +              Q+R L +G+L A   MR       V +VS           
Sbjct: 93  IDNMFVFVMIFSYFAVPPELQRRVLLYGVLGA-IVMRAAMIFAGVWLVSQFT-------- 143

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL++  +     ++ +                    
Sbjct: 144 ----------------WLLYVFGVFLIITGIKMLVFAEQQPD------------------ 169

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +  +V         F+G  F          N V       
Sbjct: 170 ---------------LDNNPLLRWVRGHLRITNGFHGERFFV------LQNGVRWATPMF 208

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + +E  D   ++D + + FA+T + FII        + +R++    L   + +++  
Sbjct: 209 LVLVLIEASDLMFAVDSIPAIFAVTTDPFIIFTSNIFAIMGLRAL--YFLLADMADRFHL 266

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L++G    +  +   M +     +P  ++      LI  S+  S+
Sbjct: 267 LKYGLALVLVFIGGKMTVMPWFHMPVEWSLAIVGGLILASVVLSL 311


>gi|72162424|ref|YP_290081.1| transporter membrane protein [Thermobifida fusca YX]
 gi|71916156|gb|AAZ56058.1| putative transporter membrane protein [Thermobifida fusca YX]
          Length = 337

 Score =  156 bits (394), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 44/351 (12%), Positives = 110/351 (31%), Gaps = 76/351 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           K      SL     W+        + G+GI +      +G     Y+       E SLS 
Sbjct: 33  KREPKEFSLKEASWWSAFYIALAIVFGIGIWYFAGWEKAGEYFAGYVT------EKSLSV 86

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  +    L        +Q   L  GI++A+  MR +F  +    V+            
Sbjct: 87  DNLFVFYLILTSFAVPKKYQHEVLLVGIMLAL-VMRGVFIAVGAQAVN------------ 133

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                       A   +    G FL+  ++    ++                        
Sbjct: 134 ------------AWSEVFYLFGAFLIYTAIKIVRDN------------------------ 157

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
               ++           +     +         ++G      +      +   H      
Sbjct: 158 ----VAGSEEEETNYTDSFAVRMLRKVWPVTDSYHGPRLTVKL------DGRRHITPMFM 207

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
           + + + + D   ++D + + F +T++ +++        + +R +    L  G++++  Y+
Sbjct: 208 VIVAVGVTDLIFAVDSIPAIFGLTQDAYLVFTANAFALLGLRVL--YFLLAGLMDRLAYI 265

Query: 300 EHGSYYSIFVLSVIMFLQTIVD----IPEI---FTGTSSTILIFLSIYSSI 343
             G    +  + + M L  + +    +PE+    +      ++ +++ +S+
Sbjct: 266 SWGLAAIMVFIGIKMLLHALHENGVDVPEVGTSLSLGVILGVMTITVIASV 316


>gi|188580074|ref|YP_001923519.1| integral hypothetical protein TerC [Methylobacterium populi BJ001]
 gi|179343572|gb|ACB78984.1| Integral membrane protein TerC [Methylobacterium populi BJ001]
          Length = 353

 Score =  156 bits (394), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 47/347 (13%), Positives = 100/347 (28%), Gaps = 70/347 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           +  +    +             G   G  + W      +    T        V+E SLS 
Sbjct: 50  RDKNHEIGVKESLLLTAFYFTLGLAFGGWVWWMLGFDPAQEYVTGL------VIEKSLSM 103

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A  L  +      Q R L WGIL A   +R +   +   +V             
Sbjct: 104 DNVFVIAVILTSLGVPRAAQHRVLVWGIL-AAVLLRGLMIGLGSALV------------- 149

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                      Q    +      FL+ V +    + +                       
Sbjct: 150 -----------QQAHWVLSVFAAFLIYVGIKMLVSKEEDE-------------------- 178

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         +  +     +           G +F+       +   V        
Sbjct: 179 ------------QDVKNSASMRLLKKWVRITEKPEGQHFVVRKPDPKTGKPVRWLTPLAV 226

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + + I D   ++D V + FAIT + FI+        + +R++        +++++ YL
Sbjct: 227 ALVLVNIADVIFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAAMVDRFAYL 284

Query: 300 EHGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSIYSSI 343
           +      +  +   + +     +V +P   +   + +L+ L +  S+
Sbjct: 285 KTALALILLFIGTKIVVADTLELVHLPPWVSLVVTLVLLTLGVVYSL 331


>gi|255327548|ref|ZP_05368615.1| TerC family integral membrane protein [Rothia mucilaginosa ATCC
           25296]
 gi|255295442|gb|EET74792.1| TerC family integral membrane protein [Rothia mucilaginosa ATCC
           25296]
          Length = 401

 Score =  156 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 45/359 (12%), Positives = 101/359 (28%), Gaps = 87/359 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   S+     W+ +      L GL I      + +      YI       E +LS +
Sbjct: 28  RKAHEPSVKEAAIWSSIYIGIALLFGLYIFVTNGPSAATEFYAGYIT------EEALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +     +   Q++ L +GI+ A+   R  F      I++             
Sbjct: 82  NLFVFMIIMGTFRVARENQQKVLLFGIVFAILA-RGSFIFAGAAIIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      +   +    G  L+M +     +   +                      
Sbjct: 128 -----------SFAWVFYIFGLVLLMTAGNLLKDEITEGDGD------------------ 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N M             F G             N        + +
Sbjct: 159 ------------DEADNIMVRLAKKYLKTSDHFDGDKLFT------IENGKRVMTPMMLV 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T++ +I+        + +R +    L  G+L++  YL 
Sbjct: 201 MVAIAGSDLLFALDSIPAIFGLTQSVYIVFTATAFSLMGLRQL--YFLIDGLLDRLVYLS 258

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +                 +I    +      ++ +++ +S+
Sbjct: 259 YGLATILAFIGVKLILHAMHENNLPFINHGEPVHVVEISTEMSLMVIVGVLIITVLASL 317


>gi|37676404|ref|NP_936800.1| putative transmembrane transport protein [Vibrio vulnificus YJ016]
 gi|37200946|dbj|BAC96770.1| putative transmembrane transport protein [Vibrio vulnificus YJ016]
          Length = 394

 Score =  156 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 47/351 (13%), Positives = 115/351 (32%), Gaps = 78/351 (22%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGF-----LCGLGIGWQFTHTLS-GTISTVYICIILAVV 55
           ++     S+     W++   +  F     +      +      +    +T +I   L  +
Sbjct: 89  QTRGGAISMKKAVGWSLFWFLLAFLFAATIFHFWDFYAPDSLYTHQEATTAFITGYL--L 146

Query: 56  EISLSFENAILNAKNLQK--MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIE 113
           E SLS +N  + A    +  +    + R L WG++ A+  +R +   +   +++      
Sbjct: 147 EKSLSVDNLFVFAIIFAQYKVPESLRPRALLWGVIGAL-VLRALMIAVGAQLLAQ----- 200

Query: 114 AMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLS 173
                              +  I      FL+   +    + + +       E       
Sbjct: 201 -------------------YHWILYLFAAFLIWTGIQLARDKEEEEELSPMPEK------ 235

Query: 174 KIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH 233
                                        +         ++G             N    
Sbjct: 236 ----------------------------LIRRFFNVTNDYHGNAVFTR------ENGQWW 261

Query: 234 GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
               L +   + ++D   +LD + + FA+T+  F+++       + +RS+    + Q ++
Sbjct: 262 ATPMLIVIGVIAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSL--YFVLQAMI 319

Query: 294 NKYKYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +K+ YL+      +  + V M L  T  +IP I++ +   I++  ++ +S+
Sbjct: 320 DKFIYLKPALAVIMMFIGVKMLLVGTAYEIPTIWSLSFLLIVMTTAVVASV 370


>gi|269218448|ref|ZP_06162302.1| protein Alx [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269211559|gb|EEZ77899.1| protein Alx [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 409

 Score =  156 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 45/352 (12%), Positives = 104/352 (29%), Gaps = 75/352 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 ++    RW +       + G+   ++ +   +      Y        E SLS +
Sbjct: 42  RKPHEPTIKECTRWLVFYVSLAVVFGVYTLFRHSSKFAFEYFAAYFT------EYSLSID 95

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L WGI+ A+  +R++F ++                   
Sbjct: 96  NIFIFIIIIGSFRVPRKYQQKVLLWGIVTALI-LRLVFILLGAT---------------- 138

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + ++   +      FL+  +                                
Sbjct: 139 --------LLESFSWLFFIFAAFLLWTAWNQLHEGVE----------------------- 167

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                      ++   N +             F G   L         N+ T        
Sbjct: 168 --DRKDPDHDDDVYKPNAVVRGARKVFMVTDGFVGDKMLVRR------NHKTFVTPFFLC 219

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + +SF +T   FII        + +R +    L +G+L +  YL 
Sbjct: 220 IISIGSADLMFALDSIPASFGLTAQPFIIFAANAFALMGLRQL--FFLVEGLLERLVYLH 277

Query: 301 HGSYYSIFVLSVIMFLQTIV---------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  +   + ++            DI  + +     +++ L++ +S+
Sbjct: 278 YGLAAILAFIGFKLLVEACHGQGWLEIVPDIHPLVSLAVILVILVLTVVTSL 329


>gi|218767281|ref|YP_002341793.1| putative transmembrane transport protein [Neisseria meningitidis
           Z2491]
 gi|121051289|emb|CAM07565.1| putative transmembrane transport protein [Neisseria meningitidis
           Z2491]
 gi|319409546|emb|CBY89833.1| Alx protein [Neisseria meningitidis WUE 2594]
          Length = 324

 Score =  156 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 49/350 (14%), Positives = 108/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++    L    +             ++E 
Sbjct: 33  KNGSHKVGVKEALAWSGLWVAVSCLFAGWLYFELAGNLGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIHMMKPEGDE----------------- 170

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 171 ---------------KEDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLSFIGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIY 317


>gi|184200841|ref|YP_001855048.1| TerC family integral membrane protein [Kocuria rhizophila DC2201]
 gi|183581071|dbj|BAG29542.1| TerC family integral membrane protein [Kocuria rhizophila DC2201]
          Length = 435

 Score =  156 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 40/321 (12%), Positives = 85/321 (26%), Gaps = 72/321 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 ++     W+ +      L GL I      TL       Y+       E +LS +
Sbjct: 28  RTPHEPTVREAAVWSAVYVGIALLFGLVILVLDGPTLMAEYYGGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ A+   R  F  +    ++             
Sbjct: 82  NLFVFLIIMGSFAVPRADQQKVLLFGIVFALVA-RTAFIFVGAAAIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   +    G  L+  +                                
Sbjct: 128 -----------AFAWVFYLFGLILVFTAGNLIKGE------------------------- 151

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                 +         N +             + G             +        L +
Sbjct: 152 ------LAQDKEDDANNIVVRLARRLFHTTEHYDGDKLFTV------HHGKRALTPMLLV 199

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+  +I+        + +R +    L  G+L++  YL 
Sbjct: 200 MVAIGGTDILFALDSIPAIFGLTQEPYIVFTATAFSLMGLRQL--YFLIDGLLDRLIYLS 257

Query: 301 HGSYYSIFVLSVIMFLQTIVD 321
            G    +  + V + L  + +
Sbjct: 258 WGLSVILAFIGVKLILHALHE 278


>gi|172040545|ref|YP_001800259.1| hypothetical protein cur_0865 [Corynebacterium urealyticum DSM
           7109]
 gi|171851849|emb|CAQ04825.1| putative membrane protein [Corynebacterium urealyticum DSM 7109]
          Length = 371

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 48/326 (14%), Positives = 106/326 (32%), Gaps = 61/326 (18%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT-----HTLSGTISTVYICIILAVVEI 57
                 +L     W+        + G+ + + +      H         YI       E 
Sbjct: 28  RTPHEPTLKESALWSAFYVGLAMVFGVFLWFTWGEPGNPHQHGLEFFAGYIT------EK 81

Query: 58  SLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           +LS +N  + +  L        +Q++ L  GIL+A+F +R IF  +    ++        
Sbjct: 82  ALSIDNLFIFSLILTTFKIPRKYQQKVLLAGILMALF-LRGIFIWLGAAAIAR------- 133

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                               +    G FL+  +    ++           E+  +  + +
Sbjct: 134 -----------------WSDVFYLFGIFLLWTAAKLAYD-----------EVTGADETDL 165

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
             +KI  +L     +++ + ++ ++          +   G           S        
Sbjct: 166 NDMKIIRILRKAVPVTDKVDSDRLF----------VRKDGATGAVDGKKKSSGKGRLVVT 215

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
                 L +  ID   +LD + + + IT   +I+     +  + +R +    L  G+L K
Sbjct: 216 PLFVALLAIGFIDVLFALDSIPAIYGITSEPYIVFTANALALMGLRQL--FFLLDGLLEK 273

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVD 321
             YL +G    +  + V + L  + +
Sbjct: 274 LVYLSYGLSIILAFIGVKLVLHALHE 299


>gi|226364901|ref|YP_002782683.1| TerC family integral membrane protein [Rhodococcus opacus B4]
 gi|226243390|dbj|BAH53738.1| putative TerC family integral membrane protein [Rhodococcus opacus
           B4]
          Length = 396

 Score =  155 bits (392), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 44/362 (12%), Positives = 104/362 (28%), Gaps = 90/362 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            ++   +L     W+ +      L G+ +       +       Y+       E +LS +
Sbjct: 28  RHAHIPTLKEAAIWSSIYIGLALLFGVAVLIFGGVDMGTEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ ++F  R  F  +   +++             
Sbjct: 82  NLFVFLIIMSSFRVPREDQQKVLLFGIVFSIFA-RTAFIFLGAALIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      +   I  F G  L++ +         + H                    
Sbjct: 128 -----------SFAWIFYFFGLILLITAGNLLRPETEESHS------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +             + G             N        L +
Sbjct: 158 --------------ADNFIIRIAKKFMHTTEHYDGDKLFTV------ENGKRAMTPMLLV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+N F++        + +R +    L  G+L++  YL 
Sbjct: 198 MVAIGGTDILFALDSIPAIFGLTQNVFVVFTATVFSLMGLRQL--YFLLDGLLDRLIYLS 255

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSIK 344
            G    +  + V + L  +                 +I    +      ++ +++ +S+ 
Sbjct: 256 FGLAAILAFIGVKLILHALHENNLPFVNDGEPVNVIEISTFVSLGVIIGILVITVIASLT 315

Query: 345 NK 346
           +K
Sbjct: 316 SK 317


>gi|296314850|ref|ZP_06864791.1| protein Alx [Neisseria polysaccharea ATCC 43768]
 gi|296838291|gb|EFH22229.1| protein Alx [Neisseria polysaccharea ATCC 43768]
          Length = 324

 Score =  155 bits (392), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 107/350 (30%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    + ++         +             ++E 
Sbjct: 33  KNGSHKVGVKEALAWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +       ++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIHMMKPEGDEE---------------- 171

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  + + + V         F+G  F          N      
Sbjct: 172 ----------------GDLANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 210 PLFLVLVMIELSDVVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + V M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLSFIGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIY 317


>gi|269968492|ref|ZP_06182501.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269826894|gb|EEZ81219.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 361

 Score =  155 bits (392), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 43/349 (12%), Positives = 112/349 (32%), Gaps = 74/349 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEI 57
           ++     ++     W++   +  F+    I   +     H+           +   ++E 
Sbjct: 62  QTRGGAITMKKAIVWSVFWFLLAFVFAGSIYLFWDFYAPHSAYTNDKATISFLTGYLLEK 121

Query: 58  SLSFENAILNAKNLQK--MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SLS +N  + A    +  +    + R L WG++ A+  +R +   +   +++        
Sbjct: 122 SLSVDNLFVFAIIFAQYSVPEHLRPRALLWGVIGAL-VLRAVMIAVGAQLLAQ------- 173

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                            +  +      FL+   +    +         + E         
Sbjct: 174 -----------------YHWVLYLFAAFLIWTGVKLARDKGEAEEVNPYPE--------- 207

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                      +         + G + +                
Sbjct: 208 -------------------------QLIRKVLPVTDDYQGNHLI------LKQAGKWVAT 236

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L +   + ++D   +LD + + FA+T+  F+++       + +RS+    + Q +L+K
Sbjct: 237 PMLIVVGVIAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSL--YFVLQAMLDK 294

Query: 296 YKYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + YL+      +  + V M L  T  +IP  ++ T   +++  ++ +S+
Sbjct: 295 FVYLKPALSVIMMFIGVKMLLVGTEYEIPTAWSLTFLVVVMTSAVVASL 343


>gi|108800194|ref|YP_640391.1| integral membrane protein TerC [Mycobacterium sp. MCS]
 gi|119869322|ref|YP_939274.1| integral membrane protein TerC [Mycobacterium sp. KMS]
 gi|126435817|ref|YP_001071508.1| integral membrane protein TerC [Mycobacterium sp. JLS]
 gi|108770613|gb|ABG09335.1| Integral membrane protein TerC [Mycobacterium sp. MCS]
 gi|119695411|gb|ABL92484.1| Integral membrane protein TerC [Mycobacterium sp. KMS]
 gi|126235617|gb|ABN99017.1| Integral membrane protein TerC [Mycobacterium sp. JLS]
          Length = 399

 Score =  155 bits (392), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 40/359 (11%), Positives = 93/359 (25%), Gaps = 91/359 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   +L     W+        L GLG+               Y+       E +LS +
Sbjct: 28  RKAHIPTLREAAVWSAFYVGIAILFGLGVLVFGGTKPGLEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ A+     +  +                    
Sbjct: 82  NLFVFLVIIGSFAVPRADQQKVLLFGIVFALIARTGLIFV-------------------- 121

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   +  A   +       L++ +        +                       
Sbjct: 122 -----GAALINAFAWVFYLFALILLLTAGQLIKPDDDDRG-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +             + G             N        L +
Sbjct: 157 --------------ADNLVIRLARRFLRTTDDYDGDKLFTV------ENGKRMLTPMLLV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T++ +I+        + +R +    L  G+L++  YL 
Sbjct: 197 MVAIGGTDLLFALDSIPAIFGLTQDVYIVFTATAFSLLGLRQL--YFLIDGLLDRLIYLH 254

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V +FL  +                 ++    +      L+ ++  +S+
Sbjct: 255 FGLAAILAFIGVKLFLHALHENNVPFINDGEPVNVVEVSTPVSLGVIITLLLVTTVASL 313


>gi|110637772|ref|YP_677979.1| TerC family integral membrane protein [Cytophaga hutchinsonii ATCC
           33406]
 gi|110280453|gb|ABG58639.1| probable integral membrane protein, TerC family [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 311

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 104/343 (30%), Gaps = 73/343 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
              +   +     +W+           + + +      +    T YI       E SLS 
Sbjct: 27  NKGNKVVTTKSALQWSAFWVGLAMAFNIFVYYWKGREAAELFFTGYII------EESLSV 80

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  +           S +Q++ L WGI+ A+  +R +F ++ +                
Sbjct: 81  DNLFVFMLIFSYFRVPSEYQRKVLFWGIIGAL-VLRALFIVVGI---------------- 123

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                    + +    +    G FL+   +   F+S +                      
Sbjct: 124 --------ELIEHFDWLLYILGIFLVYTGVKMLFSSDDDE-------------------- 155

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                            N +    +        + G  F            + +      
Sbjct: 156 ------------IDPENNIILKLTNKFIRVTKTYEGDKFFVR------KEGILYATPLFI 197

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
           + L +E  D   ++D + +   IT + FI+        + +RS+        ++  + Y+
Sbjct: 198 VVLIVESTDVVFAVDSIPTILGITTDTFIVYTSNVFALLGLRSL--YFALSSVMKLFHYI 255

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
            +G    +  + V + + +  +IP  +  +   + + LS+ +S
Sbjct: 256 NYGLAVILSFVGVKLLIHSWYEIPHKYALSFVVLSLGLSVLAS 298


>gi|39995961|ref|NP_951912.1| TerC family membrane protein [Geobacter sulfurreducens PCA]
 gi|39982726|gb|AAR34185.1| membrane protein, TerC family [Geobacter sulfurreducens PCA]
 gi|298504974|gb|ADI83697.1| membrane protein, TerC family [Geobacter sulfurreducens KN400]
          Length = 311

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 51/344 (14%), Positives = 102/344 (29%), Gaps = 74/344 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
              S          W ++           I ++   T +    T Y+       E SLS 
Sbjct: 27  NRKSHEIKFREALTWTLVWVSLALSFNAWIYFEMGPTKAMEFFTGYLI------EQSLSV 80

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  +          + + Q + L WGI+ A+  +R IF +  +                
Sbjct: 81  DNLFVFIMIFTYFHITKVHQPKILKWGIIGAL-VLRAIFILAGI---------------- 123

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                    + +    +    G  L++      F  + K+                    
Sbjct: 124 --------ELIERFHWMIYVFGGILVVTGFKMAFGGEEKIEP------------------ 157

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                            N +   V              F            V        
Sbjct: 158 ---------------EKNPIVRLVRKLVPITKRIRDDRFFI------KKGGVRAATPLFL 196

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + +E  D   ++D + +  A++++ FI+        + +RS+    L   ++  + YL
Sbjct: 197 ALVMVESSDLIFAVDSIPAVLAVSRDPFIVYTSNVFAIMGLRSL--YYLLANVMEMFVYL 254

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + G    +  + V M L  I  IP IF+  +   ++ +SI +S+
Sbjct: 255 KLGVSVILAYVGVKMLLVDIYHIPIIFSLGTIVGVLAISILTSV 298


>gi|23011842|ref|ZP_00052083.1| COG0861: Membrane protein TerC, possibly involved in tellurium
           resistance [Magnetospirillum magnetotacticum MS-1]
          Length = 349

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 49/347 (14%), Positives = 100/347 (28%), Gaps = 70/347 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           +       +             G + G  I W      +    T        V+E SLS 
Sbjct: 46  RDKDHEIGVKESLLLTAFYFSLGLVFGGWIWWMLGPDPAQEYVTGL------VIEKSLSM 99

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A  L  +      Q R L WGIL A   +R +   +   +VS            
Sbjct: 100 DNVFVIAVILTSLGVPRAAQHRVLVWGIL-AAVLLRGLMIGLGSALVSQ----------- 147

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                           +      FL+ V +    +                         
Sbjct: 148 -------------AHWVLSLFAVFLLYVGIKMLVSKDEGE-------------------- 174

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         +  +     +           G +F+       +   V        
Sbjct: 175 ------------QDIQNSASMRLLKKWVRVTDKPEGQHFIVRKPDPKTGKTVRWLTPLAV 222

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + + I D   ++D V + FAIT + FI+        + +R++        +++++ YL
Sbjct: 223 ALVLVNIADVIFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAAMVDRFAYL 280

Query: 300 EHGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSIYSSI 343
           +    + +  +   + +     +V +P   +   + +L+ L I  S+
Sbjct: 281 KTALAFILLFIGAKIVVADTLELVHLPPWVSLVVTLVLLTLGIVYSL 327


>gi|54026346|ref|YP_120588.1| putative transporter [Nocardia farcinica IFM 10152]
 gi|54017854|dbj|BAD59224.1| putative transporter [Nocardia farcinica IFM 10152]
          Length = 404

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 42/359 (11%), Positives = 97/359 (27%), Gaps = 90/359 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   +L     W+ L      L GL +       +       YI       E +LS +
Sbjct: 28  RKAHTPTLREAAVWSALYIGIAVLFGLAVLVFGGSAMGVEYFAGYIT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ ++F    +  +                    
Sbjct: 82  NLFVFLIIMTSFAVPRADQQKVLLFGIVFSIFARTALILV-------------------- 121

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   +      +    G  L++ +           H                    
Sbjct: 122 -----GATLINRFAWVFYLFGLILLLTAGNMLRPEGQDSHSG------------------ 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +             + G             N        L +
Sbjct: 159 ---------------DNIVVRLARRFLRTSPHYDGDKLFTV------ENGRRVLTPMLLV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T++ +I+        + +R +    L  G+L++  YL 
Sbjct: 198 MVAIGGTDILFALDSIPAIFGLTQSTYIVFTATVFSLLGLRQL--YFLLDGLLDRLIYLS 255

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +                 +I    + +    ++ L++ +S+
Sbjct: 256 YGLAAILGFIGVKLILHALHENNVPFVNEGEPVPVVEISTGLSLSVIVGVLILTVVASL 314


>gi|148272519|ref|YP_001222080.1| TerC family integral membrane export protein [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
 gi|147830449|emb|CAN01384.1| putative integral membrane export protein, TerC family [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
          Length = 356

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 47/360 (13%), Positives = 109/360 (30%), Gaps = 92/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S      W         +  + + +      +G     ++       E SLS +
Sbjct: 40  RRPHVPSTKESALWVAFYVGLALVFAVIMLFVAGGEHAGQFLAGWLT------EYSLSID 93

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + +      +Q+  L  GI+IA+  +R IF ++                   
Sbjct: 94  NLFVFVIIMSRFSVPRKYQQEVLMVGIIIAL-VLRGIFILLGA----------------- 135

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +++  I    G FL+  ++      +++                      
Sbjct: 136 -------ELIESYSWIFYIFGAFLLYTAVKQAVGDEDEES-------------------- 168

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +    F+         F G      +      +        + +
Sbjct: 169 --------------EDSLFIRFLRRRLKIAPDFDGSKVRTVI------DGRKVLTPMVIV 208

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+ +   D   +LD + + F IT++ FI+        + +R +    L  G+L++  YL+
Sbjct: 209 FVSIGTTDLIFALDSIPAIFGITESPFIVFTANIFALMGLRQL--YFLLGGLLDRLVYLK 266

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G  + +F + V + L  +                  +IP I +       + ++  +S+
Sbjct: 267 YGIAFILFFIGVKLVLHAMHENTLPFVNGGEGIEWAPEIPTIVSLVVILASMVVATVASL 326


>gi|261379196|ref|ZP_05983769.1| protein Alx [Neisseria cinerea ATCC 14685]
 gi|269144316|gb|EEZ70734.1| protein Alx [Neisseria cinerea ATCC 14685]
          Length = 323

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 108/350 (30%), Gaps = 72/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ S    +     W+ L      L    +  +         +             ++E 
Sbjct: 33  KNGSHKVGIKEALAWSGLWVAVSCLFAGWLYIELAGNPVYGAAVAKEKVLEFFTGYILEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+L A+  +R +   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVAPKYQHRVLLYGVLGAL-VLRAVMIFIGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +    I    G FL+   +    + +++                 
Sbjct: 143 ---------------RQFEWILYLFGAFLLYTGIRMMKSEEDEED--------------- 172

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  N +   V         F+G  F          N      
Sbjct: 173 ------------------LSGNRLLGVVKKIIPVGSEFHGDKFFT------IENGKKIAT 208

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  +
Sbjct: 209 PLFLVLIMIELSDVIFAVDSIPAVFAVTTDPFIVLTSNIFAVLGLRAM--YFLLADVAER 266

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + + M +  +V IP   + +     +  SI +S+  
Sbjct: 267 FVFLKYGLAFVLSFIGLKMLMMHLVHIPISISLSVVFGALGASILTSLIY 316


>gi|295395311|ref|ZP_06805515.1| tellurium resistance protein TerC family protein [Brevibacterium
           mcbrellneri ATCC 49030]
 gi|294971862|gb|EFG47733.1| tellurium resistance protein TerC family protein [Brevibacterium
           mcbrellneri ATCC 49030]
          Length = 330

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 50/351 (14%), Positives = 102/351 (29%), Gaps = 83/351 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     W +       +    +               ++       E SLS +
Sbjct: 30  KRPHIPSMKEATGWVVFYVTLALIFAGLMFAIGDTDHGVEFLAGWLT------EYSLSID 83

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    L K      +Q+  L  GI++A+   R  F +    I+              
Sbjct: 84  NLFVFVIILSKFSVPKKYQQEVLMVGIIVALI-FRGAFILAGAWII-------------- 128

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +  V +    G FL+  +    F  + +                      
Sbjct: 129 ----------EMFVGVFYIFGIFLLYTAFKQAFGDEEESD-------------------- 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                                F+         + G     +V      + V H    L +
Sbjct: 159 --------------EDTGFVKFLKKRINYTDEYDGNKLRTTV------DGVKHWTPMLLV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FL +   D   +LD + + F ITK+ FI+        + +R +    L  G+L++ +YL+
Sbjct: 199 FLAIGTTDIMFALDSIPAIFGITKSPFIVFTANLFALMGLRQL--YFLLGGLLDRLEYLK 256

Query: 301 HGSYYSIFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +         +I    +       + ++  +S+
Sbjct: 257 YGIAAILAFIGVKLILHAMHETWFPGVPEINTWVSLGFIVCAMLIATIASL 307


>gi|116669483|ref|YP_830416.1| integral membrane protein TerC [Arthrobacter sp. FB24]
 gi|116609592|gb|ABK02316.1| Integral membrane protein TerC [Arthrobacter sp. FB24]
          Length = 398

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 41/360 (11%), Positives = 100/360 (27%), Gaps = 91/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +    L     W+ +      + G+G+      T+       Y+       E +LS +
Sbjct: 28  RKAHSPKLKESATWSAIYVGLALVFGIGVLVFGGPTMGTEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ ++   R  F  +   +++             
Sbjct: 82  NLFVFLIIMASFKVPRADQQKVLLFGIVFSLIA-RTGFIFLGAALIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      +   +    G  L++ +        +                       
Sbjct: 128 -----------SFAWVFYIFGLILLITAGNLLKPDSHDDD-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             +         A   + G             N        L +
Sbjct: 157 --------------SEGLVVRLARKFLPASQHYDGDKLFTV------ENGKRVLTPMLLV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+N F++        + +R +    L   +L++  YL 
Sbjct: 197 MVAIGGTDILFALDSIPAIFGLTQNVFVVFTATAFSLMGLRQL--FFLIDELLDRLIYLS 254

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSIK 344
           +G    +  + V + L  +                 +I    + T    ++ +++ +SI 
Sbjct: 255 YGLAAILGFIGVKLILHALHENNLPFINGGEHVTVVEISTGLSLTVIIGVLVVTVLASIY 314


>gi|21592518|gb|AAM64468.1| transmembrane transport protein-like protein [Arabidopsis thaliana]
          Length = 384

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 48/349 (13%), Positives = 101/349 (28%), Gaps = 75/349 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +K      +    F+   L        G+GIG +     +      YI      +E SLS
Sbjct: 104 LKDYQQEETYKTSFKTVALCVGTAVAFGIGIGLKEGVGKASEFFAGYI------LEQSLS 157

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +     +      ++Q + LT+GI  A    R    ++    +     +  +  A
Sbjct: 158 VDNLFVFVLVFKYFKVPLMYQNKVLTYGIAGA-IVFRFTLILLGTATLQKFEAVNLLLAA 216

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
           +                            S   F + ++                     
Sbjct: 217 VLL------------------------YSSFKLFASEEDDTD------------------ 234

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +             + G  F          + +      L
Sbjct: 235 ---------------LSDNFIVKTCQRFIPVTSSYDGNRFFT------KHDGILKATPLL 273

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
                +E+ D + ++D + + F +T++ FI +       + +RS+    L    +++ +Y
Sbjct: 274 LTVAVIELSDIAFAVDSIPAVFGVTRDPFIGLTSNLFAILGLRSL--YTLISEGMDELEY 331

Query: 299 LEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+      +  + V M L      I    +     + +   +  S+ NK
Sbjct: 332 LQPSIAVVLGFIGVKMILDFFGFHISTEASLGVVALSLSTGVLLSLTNK 380


>gi|170782412|ref|YP_001710745.1| integral membrane protein [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169156981|emb|CAQ02150.1| conserved integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 346

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 46/360 (12%), Positives = 109/360 (30%), Gaps = 92/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S      W         +  + + +      +G     ++       E SLS +
Sbjct: 30  RRPHVPSTKESALWVAFYVGLALVFAVIMLFVAGGEHAGQFLAGWLT------EYSLSID 83

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + +      +Q+  L  GI+IA+  +R IF ++                   
Sbjct: 84  NLFVFVIIMSRFSVPRKYQQEVLMVGIIIAL-VLRGIFILLGA----------------- 125

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +++  I    G FL+  ++      +++                      
Sbjct: 126 -------ELIESYSWIFYIFGAFLLYTAVKQAVGDEDEES-------------------- 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +    F+         F G      +      +        + +
Sbjct: 159 --------------EDSLFIRFLRRRLKIAPDFDGAKVRTVI------DGRKVLTPMVIV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+ +   D   +LD + + F IT++ FI+        + +R +    L  G+L++  YL+
Sbjct: 199 FVSIGTTDLIFALDSIPAIFGITESPFIVFTANIFALMGLRQL--YFLLGGLLDRLVYLK 256

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G  + +F + V + L  +                  +IP + +       + ++  +S+
Sbjct: 257 YGIAFILFFIGVKLVLHAMHENTLPFVNGGEGIEWAPEIPTLVSLVVILASMVVATVASL 316


>gi|308178306|ref|YP_003917712.1| TerC family membrane protein [Arthrobacter arilaitensis Re117]
 gi|307745769|emb|CBT76741.1| TerC family membrane protein [Arthrobacter arilaitensis Re117]
          Length = 394

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 42/362 (11%), Positives = 102/362 (28%), Gaps = 91/362 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   SL     W+ +      + G+ + +     +       YI       E +LS +
Sbjct: 28  RKAHVPSLREAAIWSSIYVGIALVFGVLVLFFGGLDMGAEYFAGYIT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ ++   R  F  +   +++             
Sbjct: 82  NLFVFLIIIASFRVPREDQQKVLLFGIVFSLIA-RTAFIFVGAALINQ------------ 128

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G  L++ +                                
Sbjct: 129 ------------FAWVFYLFGLILLLTAGNLLKKDDESDE-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +             + G      +      +        L +
Sbjct: 157 --------------ANNFIIRIAKKLFHTTDNYDGDKLFTKI------DGKKVLTPMLLV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+N +I+        + +R +    L  G+L++  YL 
Sbjct: 197 MVAIGGTDILFALDSIPAIFGLTQNVYIVFTATAFSLMGLRQL--YFLLDGLLDRLIYLS 254

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSIK 344
           +G    +  + V + L  +                 +I    + T    ++ L++ +S+ 
Sbjct: 255 YGLAAILAFIGVKLILHALHENNLPFVNNGEHVTVIEISTGLSLTVIIGVLVLTVLASLF 314

Query: 345 NK 346
           +K
Sbjct: 315 SK 316


>gi|225439789|ref|XP_002276398.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 389

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 43/341 (12%), Positives = 103/341 (30%), Gaps = 75/341 (21%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           + +   R   L      + G+G+G++     +      Y+      +E SLS +N  +  
Sbjct: 119 TYVSSIRTVALWVCMAVIFGVGVGFKDGVGKASEFFAGYL------LEQSLSVDNLFVFV 172

Query: 69  KNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
              +     +++Q R L++GI  A+   R+   ++    +                    
Sbjct: 173 LIFKYFQVPTMYQGRVLSYGIAGAII-FRLSLILLGTATL-------------------- 211

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
               Q    ++      L+  S   F   +++                            
Sbjct: 212 ----QRFEAVNLLFAAILLFSSFKLFAADEDETD-------------------------- 241

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
                  L  N +             + G  F+         + V      L   + +E+
Sbjct: 242 -------LSNNFVVKTCQKFIPVTANYDGNLFVT------IQDGVWKATPLLLTVVVIEL 288

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
            D + ++D + + F +T++ FI+        + +RS+    L    +++ +YL+      
Sbjct: 289 SDIAFAVDSIPAVFGVTRDPFIVFTSNLFAILGLRSL--YTLISESMSELEYLQPSIGVV 346

Query: 307 IFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +  +   M        +    +       +   +  S+  K
Sbjct: 347 LGFIGCKMISDFFGFHVSTEASLGFVATSLGAGVLLSLMKK 387


>gi|226309080|ref|YP_002769040.1| hypothetical protein RER_55930 [Rhodococcus erythropolis PR4]
 gi|226188197|dbj|BAH36301.1| conserved hypothetical membrane protein [Rhodococcus erythropolis
           PR4]
          Length = 361

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 47/352 (13%), Positives = 97/352 (27%), Gaps = 82/352 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ L      +  + +            +T ++      +E SLS +
Sbjct: 27  RGAHVIGFKEAAWWSALWVGLSLVFAVVVTLTLGVNSGVEFTTAWL------LEKSLSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G++ A+   R IF    V +VS             
Sbjct: 81  NLFVFALIFGYFKVPREYQHRVLFFGVIGALI-FRGIFLAAGVAVVSKFT---------- 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +       L+  +     +          L               
Sbjct: 130 --------------AVLFVFAAILLYSAYKLLKDDDESFDPGTSL--------------- 160

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                                 +         + G  F                     +
Sbjct: 161 ------------------AVRLLRKIMPVREEYAGTKFFV------KEAGKRVATPLFAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   ++D V +  A++ + FI+        + +R++    L  G+L K+ YL 
Sbjct: 197 VVAIEAADLVFAVDSVPAVLAVSDDPFIVYSSNAFAILGLRAL--YFLLSGLLEKFHYLS 254

Query: 301 HGSYYSIFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSIK 344
            G    +  + V + +Q           +IP + +     +++  SI  S+K
Sbjct: 255 KGLSIILAFIGVKLIMQASHKVISTSIPEIPSLVSLAVIIVVLAGSIILSLK 306


>gi|300933056|ref|ZP_07148312.1| hypothetical protein CresD4_03253 [Corynebacterium resistens DSM
           45100]
          Length = 348

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 44/326 (13%), Positives = 93/326 (28%), Gaps = 76/326 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT-----HTLSGTISTVYICIILAVVEI 57
                 ++     W++       L G  +   +      H         Y+       E 
Sbjct: 28  RTPHEPTMKESALWSLFYIGLACLFGGFLWLTWGEPGNPHQHGVEFFAGYVT------EK 81

Query: 58  SLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           +LS +N  + A  +        +Q++ L WGI +A+   R IF  M   +++        
Sbjct: 82  ALSVDNLFIFALIMSSFKIPRKYQQKVLLWGIAMAL-VFRGIFIAMGAAVIA-------- 132

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                           A   +    G FL+  ++    +  +                  
Sbjct: 133 ----------------AWSDVFYLFGIFLLWTAVKLVIDEFSDKE--------------- 161

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                  +   +         + G         +   +      
Sbjct: 162 ---------------ETDPENMWVVRTIRKVVPVSKDYNGDKL------AYRQSGKLILT 200

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L   L +  ID   +LD + + + IT   +I+     +  + +R +    L  G+L+K
Sbjct: 201 PLLVGLLAIGFIDLLFALDSIPAIYGITNEPYIVFTTNALALMGLRQL--YFLLDGLLDK 258

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVD 321
             YL +G    +  + V + L  + +
Sbjct: 259 LVYLSYGLGVILAFIGVKLVLHALHE 284


>gi|282890427|ref|ZP_06298954.1| hypothetical protein pah_c017o009 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499681|gb|EFB41973.1| hypothetical protein pah_c017o009 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 418

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 54/354 (15%), Positives = 104/354 (29%), Gaps = 79/354 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQF-----------THTLSGTISTVYICII 51
                 S      W+    +      L I + +           + T+          + 
Sbjct: 28  RTPRTVSTREALAWSFFWIMQALAFNLFIYFLYENHWFGMGLNASQTILDGQEAALQFLA 87

Query: 52  LAVVEISLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTI 109
             V+E SLS +N ++ A          I+Q R L WGIL  +F +R+I  +  + +VS  
Sbjct: 88  GYVIEKSLSLDNIVIIALVFSYFKVPLIYQHRVLFWGILGVLF-LRLIMILGGIALVS-- 144

Query: 110 NPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM 169
                                     I+   G FL+  ++       + L          
Sbjct: 145 ----------------------TFHWINYVFGAFLIFTAIKMLVIRHDNLEP-------- 174

Query: 170 SHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN 229
                                      N +             F+   F         + 
Sbjct: 175 -------------------------QNNPLVRLAYRYFPMTSGFHEDRFFIR------NE 203

Query: 230 NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLK 289
                     + L +E  D   ++D + + FA+TK  FI+        + +RS+      
Sbjct: 204 GRLQMTPLFVVLLVIESSDVLFAIDSIPAIFAVTKEPFIVFTSNIFAILGLRSL--YFAL 261

Query: 290 QGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             ++ ++ YL+    + +  + V M +     IP   +      ++   I +SI
Sbjct: 262 ASMMQRFAYLKASLAFLMAFVGVKMLIANHYQIPIGVSLAMIGGVLLTGILASI 315


>gi|226941238|ref|YP_002796312.1| transmembrane transport protein [Laribacter hongkongensis HLHK9]
 gi|226716165|gb|ACO75303.1| transmembrane transport protein [Laribacter hongkongensis HLHK9]
          Length = 329

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 54/354 (15%), Positives = 115/354 (32%), Gaps = 77/354 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTI----------STVYICII 51
           K  S   S      W+ +      L  L + W     +   +                + 
Sbjct: 34  KQGSHKVSAREALGWSAIWISIAMLFNLWLWWHIRTNVDSGLDEVARAALADQKALEFLT 93

Query: 52  LAVVEISLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTI 109
             ++E SL+ +N  +           + +Q+R L +G+L A+F MR I   +   +V+  
Sbjct: 94  GYLIEKSLAVDNIFVFLLIFNYFKVPAAYQRRVLVYGVLGAIF-MRAIMIALGAVLVAEF 152

Query: 110 NPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAM 169
           +                         +    G FL+   +      +             
Sbjct: 153 S------------------------WVLYLFGAFLVFTGIKMMLPEKESAD--------- 179

Query: 170 SHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSN 229
                                   L  N +  ++ S       ++G +F         S 
Sbjct: 180 -----------------------DLGNNRLLKWIRSHMRITTDYHGESFFVR------SG 210

Query: 230 NVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLK 289
            +        +   +E+ D   ++D + + FA+T++ FI++       + +R+M    L 
Sbjct: 211 GILWATPMFLVLTMIELSDLVFAVDSIPAIFAVTRDPFIVLTSNIFAILGLRAM--YFLL 268

Query: 290 QGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             + +++  L++G    +  + V M L  I  IP + + T+   ++  SI  S+
Sbjct: 269 ADVADRFHLLKYGLAVVLTFIGVKMLLLDIYHIPTVISLTTVFAVLTTSIILSL 322


>gi|241759640|ref|ZP_04757741.1| transmembrane transport protein [Neisseria flavescens SK114]
 gi|241320012|gb|EER56393.1| transmembrane transport protein [Neisseria flavescens SK114]
          Length = 324

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/350 (13%), Positives = 103/350 (29%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ +   S+     W+ +           + ++     +                 V+E 
Sbjct: 33  KNGAHKVSIKEALAWSGIWVAVSCAFAGWLYFELAGNPTYGAVVAKEKVLEFFTGYVLEK 92

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+  A   +R I   +   +V         
Sbjct: 93  SLAVDNIFVFLMIFGYFKVEPKFQHRVLLYGVFGA-IVLRAIMIFIGAALV--------- 142

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +                          
Sbjct: 143 ---------------QQFEWILYLFGAFLLYTGIHMMKPEAE------------------ 169

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  N++ + +         F G  F          N      
Sbjct: 170 --------------AEEDLSQNKILTLLKKVIPTSQQFDGEKFFT------LENGKRIAT 209

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L      +
Sbjct: 210 PLLLVLIMIELSDVIFAVDSIPAIFAVTTDPFIVLTSNIFAILGLRAM--YFLLADFAER 267

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + + M +   V IP   + +     +  SI +S+  
Sbjct: 268 FIFLKYGLAFVLSFIGIKMLIMHWVHIPISISLSVVFGALSASILTSLVY 317


>gi|296127952|ref|YP_003635202.1| Integral membrane protein TerC [Cellulomonas flavigena DSM 20109]
 gi|296019767|gb|ADG73003.1| Integral membrane protein TerC [Cellulomonas flavigena DSM 20109]
          Length = 344

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 44/344 (12%), Positives = 99/344 (28%), Gaps = 75/344 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +    +     W+ +    G   G  +   +  T        Y+       E SL+ +
Sbjct: 27  RRAHVIDVREAAVWSGVWVALGVGFGALVWQVYGSTAGQQYFAGYLI------EKSLAVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A            Q R L  G+L A+   R  F      ++ +            
Sbjct: 81  NVFVWAIIFTYFAVPRELQHRVLFLGVLGAL-VFRGAFIAGGAALIESFG---------- 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +      FL+             L                     
Sbjct: 130 --------------WVLYLFAAFLLWTGYRMLRQRDEHLDPTR----------------- 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +  +            F+G   L         +        L +
Sbjct: 159 ----------------SRAWLLFRRHVPMTDAFHGQRLLVRR------DGALLATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E+ D   ++D + + FA+T + F++        + +R+M    L   +++++ YL+
Sbjct: 197 LVLVEVTDVVFAVDSIPAIFAVTDDVFLVFTANAFAILGLRAM--YFLLADLMHRFVYLK 254

Query: 301 HGSYYSIFVLSVIMFLQT-IVDIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + + M L+  ++ IP   +      ++ +S+ +S+
Sbjct: 255 TGLALVLVWVGIKMLLKIDVLYIPTTLSLAVVVTILAVSVAASL 298


>gi|239917625|ref|YP_002957183.1| membrane protein TerC, possibly involved in tellurium resistance
           [Micrococcus luteus NCTC 2665]
 gi|281413884|ref|ZP_06245626.1| membrane protein TerC, possibly involved in tellurium resistance
           [Micrococcus luteus NCTC 2665]
 gi|239838832|gb|ACS30629.1| membrane protein TerC, possibly involved in tellurium resistance
           [Micrococcus luteus NCTC 2665]
          Length = 419

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 43/321 (13%), Positives = 97/321 (30%), Gaps = 69/321 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   S+     W+ +      + GL          +    T Y+      +E +LS +
Sbjct: 28  RKAHTPSIREAAIWSGVYVGLALVFGLVFFAFGDTQHAVEYYTGYL------LEKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L +GI  A+   R +F ++   ++S             
Sbjct: 82  NLFVFLVIMASFRVPRDYQQKVLLFGITFALIS-RTLFILLGAAVIS------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   +    G  L++++                                
Sbjct: 128 -----------AWSDVFYLFGILLLVIAGGQLKGE------------------------- 151

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
              ++     +     N M   V     A   F G     +V      +        L +
Sbjct: 152 ---MTGDAEGAQDEADNVMVRLVKRFLPASDQFDGDRLFTTV------DGKRLMTPMLLV 202

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   + D + + F +T+  +I+        + +R +    L  G+L++  YL 
Sbjct: 203 MIAIGATDVLFAFDSIPAIFGVTQEAYIVFTATAFSLMGLRQL--YFLIDGLLDRLVYLA 260

Query: 301 HGSYYSIFVLSVIMFLQTIVD 321
           +G    +  + V + L  + +
Sbjct: 261 YGLAALLGFIGVKLILHALHE 281


>gi|323359675|ref|YP_004226071.1| hypothetical protein MTES_3227 [Microbacterium testaceum StLB037]
 gi|323276046|dbj|BAJ76191.1| membrane protein TerC, possibly [Microbacterium testaceum StLB037]
          Length = 353

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 45/360 (12%), Positives = 106/360 (29%), Gaps = 90/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +      W +       +    +       ++G     ++       E SLS +
Sbjct: 30  KRPHIPAAKESTLWVVFYVTLALIFAGVLWIVAGGEVAGQFVAGWLT------EYSLSID 83

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + +      +Q+  L  GI+IA+  +R  F ++   I+   +P         
Sbjct: 84  NLFVFVLIMGQFAVPRRYQQEVLMVGIIIAL-VLRGAFILVGATIIENFSP--------- 133

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          I    G FL+  ++   F   +                       
Sbjct: 134 ---------------IFYLFGLFLVYTAIRQAFPGDDDDDAQK----------------- 161

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   +         + G   +  V      N        + +
Sbjct: 162 ---------------ENLIVRTLRRVLPMSDSYDGKRVITRV------NGKKLFTPMIIV 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+ + + D   ++D + + F IT++ FI+        + +R +    L   +L++ KYL 
Sbjct: 201 FVAIGVTDLLFAIDSIPAIFGITQSPFIVFTANLFALMGLRQL--YFLLGDLLDRLKYLH 258

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G  + +  + V + L  +                  +I    +     + + ++  +S+
Sbjct: 259 YGIAFILAFIGVKLVLHAMHVNELPFLNGGEPIEWAPEISTWTSLAVIVLSMAVATIASL 318


>gi|9759380|dbj|BAB10031.1| unnamed protein product [Arabidopsis thaliana]
          Length = 344

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/349 (13%), Positives = 102/349 (29%), Gaps = 75/349 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +K      +    F+   L        G+GIG +     +      YI      +E SLS
Sbjct: 64  LKDYQQEETYKTSFKTVALCVGTAVAFGIGIGLKEGVGKASEFFAGYI------LEQSLS 117

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +     +      ++Q + LT+GI  A    R    ++    +     +  +  A
Sbjct: 118 VDNLFVFVLVFKYFKVPLMYQNKVLTYGIAGA-IVFRFTLILLGTATLQKFEAVNLLLAA 176

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
           +                            S   F + ++                     
Sbjct: 177 VLL------------------------YSSFKLFASEEDDTD------------------ 194

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +             + G  F          + +      L
Sbjct: 195 ---------------LSDNFIVKTCQRFIPVTSSYDGNRFFT------KHDGILKATPLL 233

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
                +E+ D + ++D + + F +T++ FI++       + +RS+    L    +++ +Y
Sbjct: 234 LTVAVIELSDIAFAVDSIPAVFGVTRDPFIVLTSNLFAILGLRSL--YTLISEGMDELEY 291

Query: 299 LEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIKNK 346
           L+      +  + V M L      I    +     + +   +  S+ NK
Sbjct: 292 LQPSIAVVLGFIGVKMILDFFGFHISTEASLGVVALSLSTGVLLSLTNK 340


>gi|171060823|ref|YP_001793172.1| integral membrane protein TerC [Leptothrix cholodnii SP-6]
 gi|170778268|gb|ACB36407.1| Integral membrane protein TerC [Leptothrix cholodnii SP-6]
          Length = 323

 Score =  154 bits (388), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 47/346 (13%), Positives = 104/346 (30%), Gaps = 70/346 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLS 60
           + +   S+     W        F     + W     +   ++       +   ++E SLS
Sbjct: 33  NKAHRVSVKEAGSWVAAWVAMAFAFAGLLWWHLDANVGREMADRKALEFITGYLIEQSLS 92

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +              Q+R L +G+L A   MR    +  V +V            
Sbjct: 93  VDNMFVFVMIFSYFAVPPELQRRVLLYGVLGA-IVMRAGMILAGVWLV------------ 139

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                       +    I    G FL++  +     ++ K                    
Sbjct: 140 ------------REFAWILYVFGAFLIVTGIKMLVFAEQKPD------------------ 169

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +  ++          +G  F   +      + V       
Sbjct: 170 ---------------LERNPLLRWLRGHMRITPALHGEKFFVRI------DGVRWATPMF 208

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + +E  D   ++D + + FA+T + FI+        + +R++    L   +  ++  
Sbjct: 209 LVLMMIEASDLVFAVDSIPAIFAVTTDPFIVFTSNIFAIMGLRAL--YFLLADMAERFHL 266

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           L++G    +  +   M +     +P  ++      +I  S+  S+K
Sbjct: 267 LKYGLALVLVFIGGKMLVAPWFHMPVQWSLAIVGAVILASVLLSLK 312


>gi|153004655|ref|YP_001378980.1| integral membrane protein TerC [Anaeromyxobacter sp. Fw109-5]
 gi|152028228|gb|ABS25996.1| Integral membrane protein TerC [Anaeromyxobacter sp. Fw109-5]
          Length = 318

 Score =  154 bits (388), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 47/343 (13%), Positives = 96/343 (27%), Gaps = 74/343 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
                  +     RW         L    I W+F    +    T Y+       E SLS 
Sbjct: 30  NRKDHVITTKEALRWTAFWIALALLFNGLIWWKFGTRPAIEFLTGYLI------EKSLSV 83

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  +           + +Q R L WGI+ A+    ++                      
Sbjct: 84  DNLFVFVIIFGTFAIPAAYQHRVLFWGIVTALVLRAVMIVG------------------- 124

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                    +      +    G FL++  +  FF+ + + H                   
Sbjct: 125 ------GTALLSRFHWLIYVFGAFLLVTGVRLFFHKEEEHHP------------------ 160

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                            +  +  +     +     G  F                   L 
Sbjct: 161 ---------------ERSWAFRTLRRVIPSTHRIEGHAFFLR------DAGRIVATPLLL 199

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
               +EI D   +LD + + F +T + FI+        + +RS+        +LN+++YL
Sbjct: 200 ALALIEISDVVFALDSIPAIFGVTLDPFIVFTSNIFAILGLRSL--YFAVAQLLNRFEYL 257

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
             G    +  +   M +   + +  + +      ++  ++  S
Sbjct: 258 SAGLSAVLVFIGGKMLVSRWIHVHPLVSLAVVVAILGGAMIFS 300


>gi|322420853|ref|YP_004200076.1| Integral membrane protein TerC [Geobacter sp. M18]
 gi|320127240|gb|ADW14800.1| Integral membrane protein TerC [Geobacter sp. M18]
          Length = 306

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 53/344 (15%), Positives = 101/344 (29%), Gaps = 74/344 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
              S          W ++         LG+ +      +    T YI       E SLS 
Sbjct: 27  NRKSHEIKFREALAWTLVWVGLALAFNLGVWYFMGPAKALEFFTGYII------EESLSV 80

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  +          S   Q + L WGI+ A+  MR IF ++ +                
Sbjct: 81  DNLFVFIMIFSYFHVSRAQQPKILKWGIIGAL-VMRGIFIVVGI---------------- 123

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                    + +    +    G  L+       F    ++H                   
Sbjct: 124 --------ELIERFHWMVYIFGAVLIYTGFKMAFGGDEEVHP------------------ 157

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                            N +   V          YG +F            +        
Sbjct: 158 ---------------ENNPLVKLVRRFMPITRRTYGDHFFIKR------RGIWAATPLFL 196

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + +E  D   ++D + +  A+T + FI+        + +RS+    L   ++  + YL
Sbjct: 197 TLVVVESSDVIFAVDSIPAVLAVTHDPFIVYSSNVFAIMGLRSL--YYLLAHVMEMFSYL 254

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + G    +  +   M L  +V+IP + +       + +SI +S+
Sbjct: 255 KLGVSVILAFVGAKMLLVDLVEIPLLLSLGVIVGTLTISILTSV 298


>gi|54025831|ref|YP_120073.1| putative transporter membrane protein [Nocardia farcinica IFM
           10152]
 gi|54017339|dbj|BAD58709.1| putative transporter membrane protein [Nocardia farcinica IFM
           10152]
          Length = 334

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 43/359 (11%), Positives = 107/359 (29%), Gaps = 87/359 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +      W+ +        G  + W++  T  G     ++       E +LS +
Sbjct: 28  RTPHEPTFRESGFWSAVYIGLALAFGGYVWWRWGSTYGGEYYAGFVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +       I+Q++ L  GI++A+  MR  F  +    +S             
Sbjct: 82  NLFVFLIIMSTFAVPRIYQQKVLLIGIVLAL-VMRGAFIAVGAAAIS------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   +    G FL+  ++     S +++                     
Sbjct: 128 -----------AFSWVFYLFGAFLIYTAIKLMRESGHEVE-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                     +     + + + V         + G   +  V      +           
Sbjct: 157 ----------AEEKRDSRIVTLVKKVVPTTQEYDGDRLVTRV------DGTRALTPLALA 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +   D   +LD + + + +T+  +++        + +R +    L  G+L++  YL 
Sbjct: 201 LLAIGFADLLFALDSIPAIYGLTEQPYLVFTANAFALMGLRQL--YFLIGGLLDRLVYLS 258

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +                 +I    + +    ++ ++  +S+
Sbjct: 259 YGLAAILAFIGVKLVLHALHENTLPFVNGGEHVSVPEISTPLSLSVILGVLVVATVASL 317


>gi|291619006|ref|YP_003521748.1| Alx [Pantoea ananatis LMG 20103]
 gi|291154036|gb|ADD78620.1| Alx [Pantoea ananatis LMG 20103]
          Length = 323

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/343 (13%), Positives = 103/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  S   S      W+++      L      W    T    ++T      L   V+E SL
Sbjct: 30  RRGSQTMSFKQAAVWSLIWVSVSLLFSAAFWWYLDGTAGREVATSQTLAFLTGYVLEKSL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +V+  +       
Sbjct: 90  AVDNVFVWLMLFSYFSVPANLQRRVLIYGVLGA-IVLRTIMIFAGSWLVTQFS------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      ++                    
Sbjct: 142 -----------------WILYIFGAFLLFTGIKMAMAKEDD------------------- 165

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++           G  F          N V      
Sbjct: 166 --------------AAVGDKPVVRWLRKHLRMTDTLEGEKFFTR------KNGVLFATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 206 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSNVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +  I  IP   +      ++  ++ 
Sbjct: 264 MLKYGLAVVLVFIGIKMLIVDIYHIPVAISLGVVGAILASTLM 306


>gi|302558026|ref|ZP_07310368.1| TerC family membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302475644|gb|EFL38737.1| TerC family membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 350

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 54/345 (15%), Positives = 102/345 (29%), Gaps = 76/345 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            ++          W+ +    G   GL +       +S T    Y+       E +LS +
Sbjct: 32  RDNHVIGFREAAVWSGVWIAIGLAFGLVLFAWQGGEVSSTYYAGYLI------EKALSID 85

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q + L WG++ A+   R++F  +                   
Sbjct: 86  NVFVFALVFSFFAVPDAYQHKVLFWGVIGAL-VFRLVFIFVGA----------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + Q     +   G FL+        +   ++H                    
Sbjct: 128 -------ELLQVFFWTAYLFGAFLIWTGYKMAVSKDEEVHP------------------- 161

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   V         F+G  F   +      N           
Sbjct: 162 --------------DRNIVVRLVKRMIPTDPTFHGGRFFTRI------NGRRVATLLFVA 201

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   ++D V +  AIT N F++        + +RS+       G+L ++ YL 
Sbjct: 202 LVAIEATDLIFAVDSVAAVLAITTNTFLVWTANAFAVLGLRSL--YFCLAGLLRRFAYLH 259

Query: 301 HGSYYSIFVLSVIMFLQ--TIVDIPEIFTGTSSTILIFLSIYSSI 343
           +G    +    V + L    +  +P   T     + I +SI  S+
Sbjct: 260 YGLAVLLAFAGVKLILSETPVGKLPIPLTLGVIVVTITVSICWSL 304


>gi|284031046|ref|YP_003380977.1| Integral membrane protein TerC [Kribbella flavida DSM 17836]
 gi|283810339|gb|ADB32178.1| Integral membrane protein TerC [Kribbella flavida DSM 17836]
          Length = 381

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 42/363 (11%), Positives = 92/363 (25%), Gaps = 90/363 (24%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       +                  GLG+        +G     ++       E SLS
Sbjct: 26  IGRRPHEPTTRESATAIAFYVGLAIAFGLGVWAFSGGRYAGEFFAGWLT------EYSLS 79

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + +      +Q+       +I     R +F  +    ++  +        
Sbjct: 80  VDNLFIFLIIMARFQVPRKYQQTA-LLIGIILALIFRGVFIAVGAAAINQFS-------- 130

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            I    G FL+  ++      +N                     
Sbjct: 131 ----------------WIFYLFGAFLVYTAVHLAMQGENDD------------------- 155

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N +  F      A   + G+            N         
Sbjct: 156 -------------EDYKENAVIRFAKKRLNATDEYNGVKLTV------IKNGKRLVTPMA 196

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + L   D   +LD + + + +T+  F++        + +R +    L   +L +  Y
Sbjct: 197 IVIIALGTTDLLFALDSIPAIYGLTQEPFLVFTANVFALMGLRQL--YFLLGDLLRRLIY 254

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYS 341
           L  G    +  + V + L  +                  +IP  F+     I + ++   
Sbjct: 255 LSIGLSVVLAFIGVKLVLHAMHVNELSFINGGEHIKWAPEIPIWFSLGFIIITLGITTVL 314

Query: 342 SIK 344
           S+ 
Sbjct: 315 SLY 317


>gi|126348169|emb|CAJ89890.1| putative membrane protein, TerC family [Streptomyces ambofaciens
           ATCC 23877]
          Length = 336

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 45/353 (12%), Positives = 95/353 (26%), Gaps = 82/353 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            ++          W+ L        G  +      T     +T ++      +E SLS +
Sbjct: 28  RHAHVIGFKEAAAWSGLWVGLALAFGAVVFLVLGGTAGTEYTTAWL------LEKSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G++ A+   R +F    V +VS             
Sbjct: 82  NLFVFALIFAYFKVPRAYQHRVLFFGVIGAL-VFRGVFLAAGVAVVSRFT---------- 130

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +       L           +                        
Sbjct: 131 --------------AVLFVFAAILFYSVYKILKGEEESFDPGRSF--------------- 161

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                                 +         + G  F                   L +
Sbjct: 162 ------------------AVRLLRKVIPVRDTYAGPKFFV------KEAGKLVATPLLAV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
              +E  D   ++D V +  A++ + FI+        + +R++    +  G+L+++ YL 
Sbjct: 198 VAAIEAADLIFAVDSVPAVLAVSDDAFIVYTSNAFAILGLRAL--YFMLSGLLDRFHYLS 255

Query: 301 HGSYYSIFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSIKN 345
            G    +  + V + LQ           +IP   +     +++  S+  S++ 
Sbjct: 256 KGLAIILGFIGVKLILQATHKLVSPSVPEIPSPVSLAVIVVVLAGSVILSLRR 308


>gi|283458174|ref|YP_003362791.1| tellurium resistance membrane protein TerC [Rothia mucilaginosa
           DY-18]
 gi|283134206|dbj|BAI64971.1| membrane protein TerC, possibly involved in tellurium resistance
           [Rothia mucilaginosa DY-18]
          Length = 401

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 45/359 (12%), Positives = 101/359 (28%), Gaps = 87/359 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   S+     W+ +      L GL I      + +      YI       E +LS +
Sbjct: 28  RKAHEPSVKEAAIWSSIYIGIALLFGLYIFVTNGPSAATEFYAGYIT------EEALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +     +   Q++ L +GI+ A+   R  F      I++             
Sbjct: 82  NLFVFMIIMGTFRVARENQQKVLLFGIVFAILA-RGTFIFAGAAIIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      +   +    G  L+M +     +   +                      
Sbjct: 128 -----------SFAWVFYIFGLVLLMTAGNLLKDEITEGDGD------------------ 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N M             F G             N        + +
Sbjct: 159 ------------DEADNIMVRLAKKYLKTSDHFDGDKLFT------IENGKRVMTPMMLV 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T++ +I+        + +R +    L  G+L++  YL 
Sbjct: 201 MVAIAGSDLLFALDSIPAIFGLTQSVYIVFTATAFSLMGLRQL--YFLIDGLLDRLVYLS 258

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +                 +I    +      ++ +++ +S+
Sbjct: 259 YGLATILAFIGVKLILHAMHENNLPFINHGEPVHVVEITTEMSLMVIVGVLIITVLASL 317


>gi|119960744|ref|YP_947816.1| membrane protein, tellurium resistance [Arthrobacter aurescens TC1]
 gi|119947603|gb|ABM06514.1| putative membrane protein, tellurium resistance [Arthrobacter
           aurescens TC1]
          Length = 341

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 46/360 (12%), Positives = 102/360 (28%), Gaps = 91/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     W         L  + +         G     ++       E SLS +
Sbjct: 28  KRPHEPSMKEAGLWVGFYVALALLFAVAMFIFAGPEYGGQFVAGWVT------EYSLSID 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + +      +Q+  L  GI+IA+  +R IF  +   ++              
Sbjct: 82  NLFVFIIIMARFSVPRKYQQEVLMVGIIIALI-LRGIFIALGAVVI-------------- 126

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +    +    G FL+  +     +S                         
Sbjct: 127 ----------EQFSWVFYIFGAFLLWTAWKQARDSGEDEEDT------------------ 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N + + +         F G      V      +        L +
Sbjct: 159 ---------------ENPLIARIRKVLPMSEKFDGNKIRTVV------DGKKVFTPMLIV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+ + + D   ++D + + F +T++ FI+        + +R +    L  G++ +  YL+
Sbjct: 198 FITIGLTDLLFAVDSIPAIFGLTQSAFIVFTANIFALMGLRQL--YFLLGGLMTRLVYLK 255

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           H     +  + V + L  +                  +IP   +       I +++ +S+
Sbjct: 256 HALSVILAFIGVKLVLHAMHVNELPFINGGHHIEWAPEIPTYVSLAVIVGTIIVAVVASL 315


>gi|217969996|ref|YP_002355230.1| integral membrane protein TerC [Thauera sp. MZ1T]
 gi|217507323|gb|ACK54334.1| Integral membrane protein TerC [Thauera sp. MZ1T]
          Length = 325

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 52/345 (15%), Positives = 111/345 (32%), Gaps = 70/345 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLS 60
                 SL     W++       L   G+ W    TL   ++       +   +VE SL+
Sbjct: 31  GKQHRVSLKEAAGWSLAWVTVAMLFAAGLWWYLDGTLGRAVANEQTTAFVTGYLVEKSLA 90

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +              Q+R L +GI+ A   +R I       ++S           
Sbjct: 91  VDNVFVWMMIFSFFAVPLELQRRVLLYGIVGA-IVLRTIMIFAGSWLIS----------- 138

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL++  +   + S++                     
Sbjct: 139 -------------EFHWLLYVFGAFLIVTGIKMAWFSEHDPD------------------ 167

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +  ++ +         G  F          + V       
Sbjct: 168 ---------------LDKNPLIRWIRNHYPITEKLEGERFFVVR------DGVRMMTPLF 206

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +EI D   ++D + + FAIT + FI++       + +R+M    L   + ++++ 
Sbjct: 207 LALVLVEISDVIFAVDSIPAIFAITTDPFIVLTSNLFAILGLRAM--YFLLADLGDRFEL 264

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L++G    +  +   M +   V IP + + +    ++  S+++S+
Sbjct: 265 LKYGLAAILVFIGTKMLIVEWVKIPVLVSLSVVATILACSVFASL 309


>gi|115461793|ref|NP_001054496.1| Os05g0121200 [Oryza sativa Japonica Group]
 gi|54287470|gb|AAV31214.1| putative transmembrane protein [Oryza sativa Japonica Group]
 gi|113578047|dbj|BAF16410.1| Os05g0121200 [Oryza sativa Japonica Group]
 gi|222630013|gb|EEE62145.1| hypothetical protein OsJ_16932 [Oryza sativa Japonica Group]
          Length = 381

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 43/329 (13%), Positives = 91/329 (27%), Gaps = 75/329 (22%)

Query: 19  LVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--SS 76
           LV +A    G+ I  +     +      Y+      +E SLS +N  +     +      
Sbjct: 116 LVVLAAVFFGVSIALRDGVGKASEYFAGYL------LEQSLSVDNLFVFVLVFKYFKVPQ 169

Query: 77  IWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPI 136
            +Q R L++GI  AV   R +   +    +     +  +   I                 
Sbjct: 170 EYQNRVLSYGIAGAVI-FRTVMITLGAATIQRFEAVNLLLALILL--------------- 213

Query: 137 SGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPT 196
                      S   F     +                                   L  
Sbjct: 214 ---------FTSYKLFAEEDEESD---------------------------------LSD 231

Query: 197 NEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGV 256
           N +             + G  F        +   +      L     +E+ D + ++D +
Sbjct: 232 NFIVKTCQRFIPVTDYYDGDRFFT------TQEGLWKATPLLLTVAVIELSDIAFAIDSI 285

Query: 257 ISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFL 316
            + F +T++  I++         +RS+   +L    +++  YL+      +  +   M  
Sbjct: 286 PAVFGVTRDPLIVLSSNIFAISGLRSL--YVLISESMSELDYLQPAIGIVLGFIGTKMVF 343

Query: 317 QTI-VDIPEIFTGTSSTILIFLSIYSSIK 344
                 IP   +    T  +   +  S++
Sbjct: 344 DFFGYHIPTEASLAIVTTCLSGGVILSLR 372


>gi|85859649|ref|YP_461851.1| tellurium resistance protein [Syntrophus aciditrophicus SB]
 gi|85722740|gb|ABC77683.1| tellurium resistance protein [Syntrophus aciditrophicus SB]
          Length = 338

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 53/345 (15%), Positives = 105/345 (30%), Gaps = 76/345 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            N+    +      ++   V   L G G+ +           T Y+      +E SLS +
Sbjct: 28  RNNRKVGIREALLLSLGYFVLALLFGTGVYYFLGANAGVEFFTGYL------LEKSLSID 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +           + +Q R L WGIL A+  MR +  +    I+              
Sbjct: 82  NIFVFVLIFSHFAVPAHYQHRVLFWGILGAL-VMRAVLILTGASII-------------- 126

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      +   +    G FL+            K                      
Sbjct: 127 ----------DSFHWVIYLFGAFLIFTGAKMLSTINRKPD-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                        +  N +   +         + G  F              +    + +
Sbjct: 157 -------------MEGNRLILLIRRHFRVTENYEGHRFFIRR------KGFLYLTPLMLV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E+ D   +LD + + FAIT + FI+        + +R++       G+++++ YL+
Sbjct: 198 LILVEVTDVVFALDSIPAIFAITDDPFIVYTSNVFAILGLRAL--YFALAGMIHRFHYLK 255

Query: 301 HGSYYSIFVLSVIMFLQTIV--DIPEIFTGTSSTILIFLSIYSSI 343
           +G    + V+   M +       IP       + +LI  S+  S+
Sbjct: 256 YGLSMVLMVVGAKMLVNASFGNVIPTEAALLVTALLIGGSMLVSV 300


>gi|312139359|ref|YP_004006695.1| transporter [Rhodococcus equi 103S]
 gi|325672760|ref|ZP_08152456.1| tellurium resistance protein [Rhodococcus equi ATCC 33707]
 gi|311888698|emb|CBH48010.1| putative transporter [Rhodococcus equi 103S]
 gi|325556637|gb|EGD26303.1| tellurium resistance protein [Rhodococcus equi ATCC 33707]
          Length = 332

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 41/359 (11%), Positives = 105/359 (29%), Gaps = 87/359 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +      W+ +      + GL +   +  T  G     Y+       E +LS +
Sbjct: 28  RTPHAPTFRESAFWSAVYIGLAVVFGLFVMANWGTTFGGEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI++A+  MR  F  +    ++             
Sbjct: 82  NLFVFVIIMSTFAVPREYQQKVLLIGIVMAL-VMRGAFIAVGAAAIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                       +  +    G FL+  +     ++ +        E              
Sbjct: 128 -----------TYSWVFYLFGAFLIYTAAKLIKDADHGAEAEQDRE-------------- 162

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N++   V         + G   +  +      +        L  
Sbjct: 163 ----------------NKLVRLVKRVLPTTEEYDGDKLITKI------DGKRVVTPLLLA 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + + +T+  +++        + +R +    L  G+L +  YL 
Sbjct: 201 LVVIGFTDVLFALDSIPAIYGLTQEPYLVFTANAFALMGLRQL--FFLIGGLLERLVYLS 258

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +                 +I  + + +    ++ ++  +S+
Sbjct: 259 YGLSIILAFIGVKLVLHALHENTLPFINGGEHVSVPEISTVMSLSVIMGVLVVTTVASL 317


>gi|258653608|ref|YP_003202764.1| integral membrane protein TerC [Nakamurella multipartita DSM 44233]
 gi|258556833|gb|ACV79775.1| Integral membrane protein TerC [Nakamurella multipartita DSM 44233]
          Length = 360

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 52/351 (14%), Positives = 105/351 (29%), Gaps = 82/351 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ +      +  + I +      +   +T ++      +E SLS +
Sbjct: 27  RGAHIIKFKEAAIWSAVWVGLSLIFAVVIFFTLGADPAVDFTTAWL------LEKSLSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G++ A+   R IF  + V IVST            
Sbjct: 81  NLFVFALIFAYFKVPREYQHRVLFYGVIGAL-VFRGIFLALGVAIVSTFT---------- 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G  L+  ++    +    +                     
Sbjct: 130 --------------AVLFVFGAILIYSAIKLLKDDDESIDPGKSF--------------- 160

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                                 +         + G  F                   L +
Sbjct: 161 ------------------AVRLLRKLVPVSDEYRGTKFF------YKEAGKRIATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   ++D V +  A++ N FII        + +R++    L  G+L K+ YL 
Sbjct: 197 VVAIEAADLIFAVDSVPAVLAVSDNTFIIYSSNAFAILGLRAL--YFLLAGMLKKFHYLG 254

Query: 301 HGSYYSIFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSI 343
            G  + +  + V +FLQ           +IP + +     + + ++I  S+
Sbjct: 255 KGLAFILAFIGVKLFLQAGHKVINPAIPEIPSLVSLGVIVVALTVAIVMSL 305


>gi|58428843|gb|AAW77880.1| export protein [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 370

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 47/343 (13%), Positives = 108/343 (31%), Gaps = 70/343 (20%)

Query: 5   SLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLSFE 62
           +   +      W+I   +        + W     +    +       L   +VE SL+ +
Sbjct: 85  AHKVTFREATWWSIGWVLLALAFNAALWWYLQGGVGDAKADQIGLQFLTGYLVEKSLAVD 144

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         ++R L  G+L A   +R I       +++             
Sbjct: 145 NIFVFLMVMTYFGVPEEQRQRVLIIGVLGA-IVLRAIMIFAGSMLLAK------------ 191

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL++  +  +F++  +                      
Sbjct: 192 ------------FHWLLYVFGAFLLLTGIKMWFSAGKEPD-------------------- 219

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                        L  N +  ++ S       +YG       L S   +          +
Sbjct: 220 -------------LERNPVLRWMRSHLRLSPQYYG------NLLSVIKDGKRWFTPLFVV 260

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + + +ID   ++D + + FAIT + FI++       + +R+M    L  G+ +++  L 
Sbjct: 261 LILIAVIDVIFAVDSIPAIFAITTDPFIVLTSNVFAVLGLRAM--FFLLAGMADRFHLLP 318

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  +   M +  +  IP + +      ++  +I  S+
Sbjct: 319 YGLAVILVFIGTKMMIIDLYKIPVLVSLGVVVTILVATIVLSL 361


>gi|111023709|ref|YP_706681.1| membrane protein [Rhodococcus jostii RHA1]
 gi|110823239|gb|ABG98523.1| membrane protein [Rhodococcus jostii RHA1]
          Length = 327

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 43/359 (11%), Positives = 108/359 (30%), Gaps = 87/359 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +      W+ +      L GL + W +     G     Y+       E +LS +
Sbjct: 28  RTPHAPTFRESAFWSSVYIGIAILFGLVVMWLWGSQYGGEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI++A+  MR IF  +    ++             
Sbjct: 82  NLFVFVIIMGTFAVPREYQQKVLLIGIVMAL-VMRGIFIGVGAAAIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A+  +    G FL+  + T   +  ++                      
Sbjct: 128 -----------AYSWVFYLFGAFLIYTAYTLVRDHGHEKE-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +++ +           + G   +  +      N        L  
Sbjct: 157 ----------VEEERDSKIVAVAKKILPTTDTYDGDKLVTRI------NGKRVVTPLLLA 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + + +T+  +++        + +R +    L  G+L++  YL 
Sbjct: 201 LVAIGFTDVLFALDSIPAIYGLTQEPYLVFTANAFALMGLRQL--YFLIGGLLDRLVYLS 258

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +                 ++  +F+      ++ ++  +S+
Sbjct: 259 YGLSIILAFIGVKLVLHALHENTLGFVNGGEHVAVPEVSTVFSLAVILGVLAVTTVASL 317


>gi|269956332|ref|YP_003326121.1| Integral membrane protein TerC [Xylanimonas cellulosilytica DSM
           15894]
 gi|269305013|gb|ACZ30563.1| Integral membrane protein TerC [Xylanimonas cellulosilytica DSM
           15894]
          Length = 333

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 43/362 (11%), Positives = 108/362 (29%), Gaps = 90/362 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 SL    RW+ +      + G+ +   +  T  G     Y+       E SLS +
Sbjct: 28  RTPHTPSLREAARWSAVYVGIALVFGVVVWAVWGPTYGGEYFAGYVT------EKSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI +A+  +R +F ++    ++  +          
Sbjct: 82  NLFVFVLIMSSFRVPRAYQQKVLLVGITVAL-VLRTVFILLGAAAIANFS---------- 130

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+  ++    +++ +                      
Sbjct: 131 --------------WVFYLFGLFLVWTAIAQLRHAKEQD--------------------- 155

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +  FV         +        V      +        L +
Sbjct: 156 -----------EEFTENAVLRFVRRVLPTTETYVEDRLTTKV------DGKRLITPMLIV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +   D   ++D + + F +T+  +++        + +R +    L  G+L++  YL 
Sbjct: 199 MLAIGSADLLFAVDSIPAIFGLTEQTYLVFAANAFSLLGLRQL--FFLVDGLLDRLVYLG 256

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  +   + +  +                  +IP   +     +++ ++  +S+
Sbjct: 257 YGLAAILGFIGAKLLVHALHTNELPFLNSGQHITVIPEIPTALSLGFIVVVLVITTAASL 316

Query: 344 KN 345
             
Sbjct: 317 YR 318


>gi|225021187|ref|ZP_03710379.1| hypothetical protein CORMATOL_01199 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305680920|ref|ZP_07403727.1| integral membrane protein, TerC family [Corynebacterium matruchotii
           ATCC 14266]
 gi|224945920|gb|EEG27129.1| hypothetical protein CORMATOL_01199 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305659125|gb|EFM48625.1| integral membrane protein, TerC family [Corynebacterium matruchotii
           ATCC 14266]
          Length = 376

 Score =  153 bits (385), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 46/364 (12%), Positives = 115/364 (31%), Gaps = 92/364 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT-----HTLSGTISTVYICIILAVVEI 57
                 +L     W+++      L G+ + + ++     H         YI       E 
Sbjct: 28  RTPHEPTLKESAIWSLVYVTLACLFGIFLWFTWSEPGNPHQHGLEFFHGYIV------EK 81

Query: 58  SLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           +LS +N  + A  +        +Q++ L  GI++A+   R++F ++              
Sbjct: 82  ALSVDNLFVFALIMGSFQVPRKYQQKVLLIGIMLAL-AFRLVFILLG------------- 127

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                      K+   A   +    G FL+  ++    +    +  I+  ++ +      
Sbjct: 128 -----------KVAIDAWSDVFYLFGLFLLYTAVKLVIDEIRHVPEINPNDMWLIKT--- 173

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                      +         +   +                  
Sbjct: 174 ---------------------------LRRIIPVAHGYESDHLFIH------KKGQFAVT 200

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L   + + +ID   +LD + + + IT   +I+        + +R M    L  G+L++
Sbjct: 201 TLLVALIAIGMIDVMFALDSIPAIYGITVEPYIVFTTNAFSLLGLRQM--YFLLDGLLDR 258

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSI 339
             +L +G    +  +SV + L  +                 +IP +++  +   ++ +++
Sbjct: 259 LVFLPYGLGGVLGFISVKLILHALHENKLGFINGGESVPVPEIPTVWSLVTIVGILTIAV 318

Query: 340 YSSI 343
            +S+
Sbjct: 319 VASL 322


>gi|218195992|gb|EEC78419.1| hypothetical protein OsI_18245 [Oryza sativa Indica Group]
          Length = 381

 Score =  153 bits (385), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 42/329 (12%), Positives = 91/329 (27%), Gaps = 75/329 (22%)

Query: 19  LVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--SS 76
           LV +A    G+ I  +     +      Y+      +E SLS +N  +     +      
Sbjct: 116 LVVLAAVFFGVSIALRDGVGKASEYFAGYL------LEQSLSVDNLFVFVLVFKYFKVPQ 169

Query: 77  IWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPI 136
            +Q R L++GI  AV   R +   +    +     +  +   I                 
Sbjct: 170 EYQNRVLSYGIAGAVI-FRTVMITLGAATIQRFEAVNLLLALILL--------------- 213

Query: 137 SGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPT 196
                      S   F     +                                   L  
Sbjct: 214 ---------FTSYKLFAEEDEESD---------------------------------LSD 231

Query: 197 NEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGV 256
           N +             + G  F        +   +      L     +E+ D + ++D +
Sbjct: 232 NFIVKTCQRFIPVTDYYDGDRFFT------TQEGLWKATPLLLTVAVIELSDIAFAIDSI 285

Query: 257 ISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFL 316
            + F +T++  +++         +RS+   +L    +++  YL+      +  +   M  
Sbjct: 286 PAVFGVTRDPLVVLSSNIFAISGLRSL--YVLISESMSELDYLQPAIGIVLGFIGTKMVF 343

Query: 317 QTI-VDIPEIFTGTSSTILIFLSIYSSIK 344
                 IP   +    T  +   +  S++
Sbjct: 344 DFFGYHIPTEASLAIVTTCLSGGVILSLR 372


>gi|120401356|ref|YP_951185.1| integral membrane protein TerC [Mycobacterium vanbaalenii PYR-1]
 gi|119954174|gb|ABM11179.1| Integral membrane protein TerC [Mycobacterium vanbaalenii PYR-1]
          Length = 325

 Score =  153 bits (385), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 49/342 (14%), Positives = 109/342 (31%), Gaps = 74/342 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            ++   ++     W+ +    G   G  + W +    +      Y      V+E SL+ +
Sbjct: 27  RDAHVVTVREAAAWSAVWVTLGLAFGAIVWWMWGAEFAAQYYAGY------VIEKSLAVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G+L A+   R +F      +++             
Sbjct: 81  NVFVFAIIFSYFAVPREYQHRVLFYGVLGAL-VFRAVFIAAGSVLIA------------- 126

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      +   I    G FL+   +    +    ++                    
Sbjct: 127 -----------SFAWILYIFGAFLVATGIQMALHRNETINP------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           + +        +    ++G  FL                  L +
Sbjct: 157 --------------ERSMVLRLFRRLISVTDTYHGQKFLIR------QAGRWVATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E+ D   ++D + + FA+T+  F++        + +R+M    L   +++++ YL+
Sbjct: 197 LVLVEVTDIVFAVDSIPAIFAVTQQPFLVFTSNAFAILGLRAM--YFLLADLMHRFIYLK 254

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
            G    +  + V M L  I  IP   +      L+ ++I +S
Sbjct: 255 LGLALVLVWVGVKMLLLEIYKIPTGISLAVVVALLAIAITAS 296


>gi|261344852|ref|ZP_05972496.1| protein Alx [Providencia rustigianii DSM 4541]
 gi|282566988|gb|EFB72523.1| protein Alx [Providencia rustigianii DSM 4541]
          Length = 323

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 57/343 (16%), Positives = 113/343 (32%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           K      S+     W+IL      +   G+ W F  T+    +       L   ++E +L
Sbjct: 30  KHKGQAMSMKQAAGWSILWVTLSLIFAGGLWWYFNDTVGREFADTQTMAFLTGYLLEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +VS  +       
Sbjct: 90  AVDNVFVWLMLFGYFAIPANLQRRVLVYGVLGA-IVLRTIMIFAGSWLVSQFS------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +   F  ++                    
Sbjct: 142 -----------------WILYVFGAFLLFTGIKMAFAKEDD------------------- 165

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                         + +    +  +V S        +G  F          N V      
Sbjct: 166 --------------SPINDKPLVKWVRSHLRMTDELHGEKFFIKR------NGVLFATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +EI D   ++D + + FA+T + FI++       + +R+M    L  G+  K+ 
Sbjct: 206 ILVLILVEISDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLAGVAEKFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + V M L  I  IP   + ++   ++ L++ 
Sbjct: 264 MLKYGLAIILTFIGVKMLLIDIYHIPTAISLSTVAAILILTLV 306


>gi|170781830|ref|YP_001710162.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169156398|emb|CAQ01546.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 367

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 50/360 (13%), Positives = 109/360 (30%), Gaps = 92/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   +L     W+++  V   + G+G+G     T  G     Y+       E +LS +
Sbjct: 28  RKAHEPTLKESATWSVVYIVIALVFGVGVGVFSNWTFGGEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI IA+  MR IF  M   I+              
Sbjct: 82  NLFVFLIIMSSFAVPRAFQQKVLLVGIAIAL-VMRGIFIAMGSAII-------------- 126

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G  L++++      + +                       
Sbjct: 127 ----------DNFSWVFYLFGALLLVMAYKQMKETHD----------------------- 153

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +++   +         + G      V      +          +
Sbjct: 154 -----------ADESDSKLIRTLRRFIPTSDHYDGDKLTTRV------DGKKLFTPMFLV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L + + D   +LD + + F +T+  +I+        + +R +    L  G+L +  YL 
Sbjct: 197 MLAIGLTDVLFALDSIPAIFGLTQEAYIVFTANAFALLGLRQL--YFLISGLLERLIYLS 254

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  ++V + L  +                  +IP  F+ +   + I ++  +S+
Sbjct: 255 QGLAVILGFIAVKLVLHAMHVNEVPFINGGEPMLWAPEIPIWFSLSFILLTITVATVASL 314


>gi|46578981|ref|YP_009789.1| TerC family protein [Desulfovibrio vulgaris str. Hildenborough]
 gi|46448394|gb|AAS95048.1| TerC family protein [Desulfovibrio vulgaris str. Hildenborough]
 gi|311232833|gb|ADP85687.1| Integral membrane protein TerC [Desulfovibrio vulgaris RCH1]
          Length = 359

 Score =  152 bits (384), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 50/348 (14%), Positives = 101/348 (29%), Gaps = 77/348 (22%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+      ++   V   L G GI             T Y+       E SLS
Sbjct: 25  LHRKDRDMSVAEALWMSLAYFVLAMLFGGGIFMFMGEQKGLEFLTGYLI------EKSLS 78

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +              Q R L WGIL A+     +                     
Sbjct: 79  VDNIFVFVLVFTHFSVPRHLQYRVLFWGILGALVMRAGLIVA------------------ 120

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                     I +A   +    G FL +  +     + ++                    
Sbjct: 121 -------GAAILEAFHWVIYVFGAFLAVTGVKMLLAADSEPD------------------ 155

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N +             + G +F+             +    L
Sbjct: 156 ---------------MAGNVVTRTFRRLFPMTEGYDGNHFMVRR------AGKLYATPLL 194

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            +   +E  D   +LD + + FA++++ FI+        + +R++       GI+++++Y
Sbjct: 195 MVLTIIEFTDLVFALDSIPAIFAVSRDPFIVYTSNVFAILGLRAL--YFALAGIIHRFRY 252

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD---IPEIFTGTSSTILIFLSIYSSI 343
           L++G    +  +   M +        IP       + ++I  S+  S+
Sbjct: 253 LKYGLSLVLVFIGAKMIINAWFAAKIIPTDVALLVTALIIGGSMVVSV 300


>gi|328470647|gb|EGF41558.1| putative transmembrane transport protein [Vibrio parahaemolyticus
           10329]
          Length = 339

 Score =  152 bits (384), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 47/350 (13%), Positives = 114/350 (32%), Gaps = 74/350 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEI 57
           ++     ++     W+I   +  FL    I + +     H+           +   ++E 
Sbjct: 40  QTRGGAITMQKAIVWSIFWFLLAFLFAGSIYFFWDVYAPHSAYSNEKATVSFLTGYLLEK 99

Query: 58  SLSFENAILNAKNLQK--MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SLS +N  + A    +  +    + R L WG++ A+  +R I   +   +++        
Sbjct: 100 SLSVDNLFVFAIIFAQYKVPEHLRPRALLWGVIGALL-LRAIMIAVGAQLLAQ------- 151

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                            +  +      FL+   +    +   +     + E         
Sbjct: 152 -----------------YHWVLYLFAAFLIWTGIKLARDKGEEEEVNPYPE--------- 185

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                      +         + G +                  
Sbjct: 186 -------------------------QVIRKLLPVTDEYQGNHMF------LKQAGKWVAT 214

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L +   + ++D   +LD + + FA+T+  F+++       + +RS+    + Q +L+K
Sbjct: 215 PMLIVVGVIAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSL--YFVLQAMLDK 272

Query: 296 YKYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           + YL+      +  + V M L  T  +IP I++ T   +++  ++ +S+ 
Sbjct: 273 FIYLKPALSVIMMFIGVKMLLVGTEYEIPTIWSLTFLILVMTSAVVASVY 322


>gi|212711131|ref|ZP_03319259.1| hypothetical protein PROVALCAL_02202 [Providencia alcalifaciens DSM
           30120]
 gi|212686299|gb|EEB45827.1| hypothetical protein PROVALCAL_02202 [Providencia alcalifaciens DSM
           30120]
          Length = 323

 Score =  152 bits (384), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 54/343 (15%), Positives = 113/343 (32%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           K      S+     W+IL      +   G+ W F  T+   ++       L   ++E +L
Sbjct: 30  KHKGQAMSMKQAAGWSILWVTLSLIFAGGLWWYFNDTVGPEVANTQTMAFLTGYLLEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +V+  +       
Sbjct: 90  AVDNVFVWLMLFGYFAIPANLQRRVLVYGVLGA-IVLRTIMIFAGSWLVTQFS------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +   F  ++                    
Sbjct: 142 -----------------WILYVFGAFLLFTGIKMAFAKEDD------------------- 165

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                         + +    +  +V S        +G  F          N +      
Sbjct: 166 --------------SPINEKPLVKWVRSHLRMTDELHGEKFFI------KKNGLLFATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +EI D   ++D + + FA+T + FI++       + +R+M    L  G+  K+ 
Sbjct: 206 ILVLILVEISDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLAGVAEKFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + V M L  +  IP   +  +   ++ L++ 
Sbjct: 264 MLKYGLAVILSFIGVKMLLMDVFHIPTAVSLGTVAAILVLTLV 306


>gi|297539826|ref|YP_003675595.1| Integral membrane protein TerC [Methylotenera sp. 301]
 gi|297259173|gb|ADI31018.1| Integral membrane protein TerC [Methylotenera sp. 301]
          Length = 321

 Score =  152 bits (384), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 48/347 (13%), Positives = 111/347 (31%), Gaps = 70/347 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S      W+ +        G  +     HT    I+       L   ++E +L
Sbjct: 33  RKGAHKVSAKEALVWSFIWFSLALAFGGALWAWLDHTSGRAIADAKTMEYLTGYLLEKTL 92

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +             +QKR L +G+L A   +R +  ++   +++          
Sbjct: 93  AMDNIFVFVMLFSYFAVPIEYQKRVLVYGVLGA-IVLRALMILLGAWLIA---------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL++  +  F  +  +                   
Sbjct: 142 --------------EFHWVLYVFGVFLLITGIKMFVFADQE------------------- 168

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           L  N + +++         ++G  F        + N V      
Sbjct: 169 --------------PNLAKNPLLTWLKKHMCITDTYHGDKFWV------TKNGVRWFTPM 208

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
             + + +E  D   ++D + + FAIT + FI+        + +R++    L   + +++ 
Sbjct: 209 FLVLILVEFSDVIFAMDSIPAIFAITSDPFIVFTSNIFAILGLRAL--YFLLADMADRFH 266

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
            L++G    +  +   M +    +IP   +      ++ +SI  S+K
Sbjct: 267 LLKYGLAVVLMFVGTKMLIVEWFNIPVAVSLAVVIAVLGISILLSLK 313


>gi|226366146|ref|YP_002783929.1| TerC family integral membrane protein [Rhodococcus opacus B4]
 gi|226244636|dbj|BAH54984.1| putative TerC family integral membrane protein [Rhodococcus opacus
           B4]
          Length = 327

 Score =  152 bits (384), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 43/359 (11%), Positives = 108/359 (30%), Gaps = 87/359 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +      W+ +      L GL + W +     G     Y+       E +LS +
Sbjct: 28  RTPHAPTFRESAFWSSVYIGLAILFGLIVMWLWGSQYGGEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI++A+  MR IF  +    ++             
Sbjct: 82  NLFVFVIIMGTFAVPREYQQKVLLIGIVMAL-VMRGIFIGVGAAAIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A+  +    G FL+  + T   +  ++                      
Sbjct: 128 -----------AYSWVFYLFGAFLIYTAYTLVRDHGHEKE-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +++ +           + G   +  +      N        L  
Sbjct: 157 ----------VEEERDSKIVAIAKKILPTTDTYDGDKLVTRI------NGKRVVTPLLLA 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + + +T+  +++        + +R +    L  G+L++  YL 
Sbjct: 201 LVAIGFTDVLFALDSIPAIYGLTQEPYLVFTANAFALMGLRQL--YFLIGGLLDRLVYLS 258

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +                 ++  +F+      ++ ++  +S+
Sbjct: 259 YGLSIILAFIGVKLVLHALHENTLGFVNGGEHVAVPEVSTVFSLAVIIGVLAVTTVASL 317


>gi|118591752|ref|ZP_01549148.1| transporter [Stappia aggregata IAM 12614]
 gi|118435745|gb|EAV42390.1| transporter [Stappia aggregata IAM 12614]
          Length = 345

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 46/348 (13%), Positives = 100/348 (28%), Gaps = 77/348 (22%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +        +      +      G L  L I        +    T ++       E SLS
Sbjct: 34  LHRRPHEIGIRESLLLSAFYISLGLLFSLWIWLMLGAREAAMYLTGFVV------EKSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A           +Q R L +GIL  V  +R +       IVS           
Sbjct: 88  LDNVFVIAVIFSFFAIPKQYQHRVLIYGILG-VIVLRGLMIGAGTAIVSRFE-------- 138

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +      FL+   +   FN + +                    
Sbjct: 139 ----------------WVLYLFAAFLVFTGVKMLFNCERECD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N +   +          +G  F         S +       L
Sbjct: 165 ---------------VAANPVQRMLRKWLPLTASLHGDRFFVR------SGSRFLATPLL 203

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E  D   ++D + + F+IT + +I+        + +R++    +   +++++ Y
Sbjct: 204 LALVTVEFTDLIFAVDSIPAIFSITTDPYIVYTSNIFAILGLRAL--YFVLAVMMDRFTY 261

Query: 299 LEHGSYYSIFVLSVIMFLQTIV---DIPEIFTGTSSTILIFLSIYSSI 343
           L++     +  +   +F+  +      P   +   + +LI   +  S+
Sbjct: 262 LKYALSLVLVFIGSKIFVADLFDWEKFPPSLSLAITLLLICGGMLISL 309


>gi|213022049|ref|ZP_03336496.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Typhi str. 404ty]
          Length = 303

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 103/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+IL      L      W    T    ++       L   ++E SL
Sbjct: 11  RRGAHAMSMKQAAGWSILWVTLSLLFNAAFWWYLAETQGREVADPQALAFLTGYLIEKSL 70

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G+L A   +R I       +++          
Sbjct: 71  AVDNVFVWLMLFSYFSVPPALQRRVLVYGVLGA-IVLRTIMIFAGTWLITQFE------- 122

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      +++                   
Sbjct: 123 -----------------WLLYVFGAFLLFTGVKMALAKEDESG----------------- 148

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    M  ++             +F          N + +    
Sbjct: 149 ----------------IGEKPMVRWLRGHLRMTDTIENEHFFVR------KNGLLYATPL 186

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E  D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 187 LLVLIMVEFSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSGVAERFS 244

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ +++ 
Sbjct: 245 MLKYGLAVILVFIGIKMLIVDFYHIPIAISLGVVFGILTITLV 287


>gi|171912759|ref|ZP_02928229.1| Integral membrane protein TerC [Verrucomicrobium spinosum DSM 4136]
          Length = 323

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 49/344 (14%), Positives = 106/344 (30%), Gaps = 70/344 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLS 60
             +    +     W  +      L  LGI   +       +        L+  V+E SLS
Sbjct: 26  RKAHVVKVREALTWTAIWVALALLFSLGIAMGYVGAYPEGLQQQASLEFLSGYVLEKSLS 85

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A          ++Q R L WGIL A+  MR +F    V               
Sbjct: 86  VDNVFVFALLFAYFKVPQLYQHRVLFWGILGAL-VMRAVFIFAGVA-------------- 130

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                     + +    I    G  L++  +  + +   ++                   
Sbjct: 131 ----------LIERFHWILYIFGVILIVSGVKMWMSKDVEIDP----------------- 163

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                            TN +              +G +F                    
Sbjct: 164 ----------------ATNPVLRLTRRLLPVSETMHGQDFFVR------QGGKLMVTPLF 201

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + +++E  D   ++D + +  A++++ FI+        + +RS+       G+++++  
Sbjct: 202 VVLIFVEWSDLVFAVDSIPAVLAVSRDPFIVFTSNVFAILGLRSL--YFALSGVMDRFHM 259

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSS 342
           L +G    +  + V M +     +P   +    T ++ +S+ +S
Sbjct: 260 LHYGLSAILAFVGVKMLIVDFYKVPIGISLAIITAILTVSVVTS 303


>gi|108802061|ref|YP_642258.1| integral membrane protein TerC [Mycobacterium sp. MCS]
 gi|119871213|ref|YP_941165.1| integral membrane protein TerC [Mycobacterium sp. KMS]
 gi|126438040|ref|YP_001073731.1| integral membrane protein TerC [Mycobacterium sp. JLS]
 gi|108772480|gb|ABG11202.1| Integral membrane protein TerC [Mycobacterium sp. MCS]
 gi|119697302|gb|ABL94375.1| Integral membrane protein TerC [Mycobacterium sp. KMS]
 gi|126237840|gb|ABO01241.1| Integral membrane protein TerC [Mycobacterium sp. JLS]
          Length = 322

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 51/347 (14%), Positives = 107/347 (30%), Gaps = 76/347 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +  ++          W+ +   AG   G  + W +   ++GT    Y+       E +LS
Sbjct: 29  LHRDNHVIGFREAAVWSAIWIAAGLGFGAIVWWAYGGDVAGTYYAGYLI------EKALS 82

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A           +Q + L +G++ A+   R++F  +   +++           
Sbjct: 83  VDNVFVFALIFTYFAVPDEYQHKVLFYGVIGALL-FRLVFIFVGAELLA----------- 130

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                        A    +   G FL+  +    F     L                   
Sbjct: 131 -------------AFFWTAYLFGAFLIYTAYKMAFQHDKDLEP----------------- 160

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N M   V         ++G      V      +         
Sbjct: 161 ----------------DKNLMVRLVRRLVPIDTRYHGDRLFTRV------DGKRVATLLF 198

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + +E  D   ++D V +  AIT + FI+        + +RS+       G+L ++ +
Sbjct: 199 VVLIAVEATDLIFAIDSVAAVLAITTSTFIVWTANAFAVLGLRSL--YFCLSGLLRRFTH 256

Query: 299 LEHGSYYSIFVLSVIMFLQ--TIVDIPEIFTGTSSTILIFLSIYSSI 343
           L +G    +    V + L    +  +P   T +   + +  S+  S+
Sbjct: 257 LHYGLAILLAFAGVKLILSETPVGKLPIPLTLSVIVVTLTASVVWSL 303


>gi|271967330|ref|YP_003341526.1| integral membrane protein TerC [Streptosporangium roseum DSM 43021]
 gi|270510505|gb|ACZ88783.1| integral membrane protein TerC [Streptosporangium roseum DSM 43021]
          Length = 330

 Score =  152 bits (383), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 49/345 (14%), Positives = 108/345 (31%), Gaps = 81/345 (23%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S+     W         + G+ +      T +G     YI       E SLS +N  +  
Sbjct: 35  SMKQAGYWVAFYVALAVVFGIVLWIFAGPTPAGQFFAGYIT------EYSLSVDNLFVFY 88

Query: 69  KNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
             + +     I Q + L  GIL+A+  MR IF  +    +++                  
Sbjct: 89  IIMTRFAVPKIHQHKVLLVGILMAL-VMRGIFIAVGAAALASFG---------------- 131

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
                    +    G FL+  ++       +                             
Sbjct: 132 --------WLFYVFGLFLIYTAVQLIRQHGHDDD-------------------------- 157

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
                  +P N +  +   +      + G   +  V      +        L + + +  
Sbjct: 158 ------DVPENAVLRWARRALPHTDDYVGSKVVVKV------DGKRMVTPLLIVMIAIGT 205

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
            D   +LD + + F +T + FI+        + +R +    L  G+L +  YL +G  + 
Sbjct: 206 TDLLFALDSIPAIFGLTTDAFIVFSANAFALMGLRQL--YFLLGGLLQRLVYLSYGLAFI 263

Query: 307 IFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSI 343
           +  + V + L+ +         ++P   + +   + + ++  +S+
Sbjct: 264 LGFIGVKLILEALHSSGVSWAPEVPIWLSLSVIGVTMVITTAASL 308


>gi|239927983|ref|ZP_04684936.1| putative integral membrane export protein [Streptomyces ghanaensis
           ATCC 14672]
 gi|291436315|ref|ZP_06575705.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291339210|gb|EFE66166.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 341

 Score =  152 bits (383), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 44/351 (12%), Positives = 94/351 (26%), Gaps = 82/351 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+        + G  +      T     +T ++      +E SLS +
Sbjct: 28  RTAHVIGFKEAAAWSAGWIGLALVFGAVVFLVLGTTAGTEYTTAWL------LEKSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L  G+  A+   R +F    V +V+             
Sbjct: 82  NLFVFAVIFSYFKVPRAYQHRVLFLGVFGAL-VFRALFLAAGVAVVNRFT---------- 130

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +       L   +       +                        
Sbjct: 131 --------------VVLYLFAAVLFYSTYKLLRGEEESFDPG------------------ 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +     +         + G  F                   L +
Sbjct: 159 ---------------NSFAVRMLRKVIPVRDEYAGTKFFV------KEAGKRVATPLLAV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   ++D V +  A++ + FI+        + +R++    +  G+L+++ YL 
Sbjct: 198 VVAVEAADLIFAVDSVPAVLAVSDDVFIVYTSNAFAILGLRAL--YFMLAGLLDRFHYLG 255

Query: 301 HGSYYSIFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V + LQ           +IP   +     +++  SI  S+
Sbjct: 256 VGLAVILAFIGVKLVLQASHKMISTDIPEIPSPVSLAVIVVVLAASIALSM 306


>gi|332107784|gb|EGJ09008.1| export protein [Rubrivivax benzoatilyticus JA2]
          Length = 314

 Score =  152 bits (383), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 47/346 (13%), Positives = 103/346 (29%), Gaps = 70/346 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLS 60
             +    +    RW+++             W    T    ++       L   ++E SL+
Sbjct: 23  QGAHAVGVREALRWSVVWVALSLAFNALFWWALQGTHGTEVANTRALEFLTGYLIEKSLA 82

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +             +QKR L  GI+ A   +R +  ++   +++           
Sbjct: 83  VDNIFVFLMIFSYFAIPPEFQKRVLMIGIVGA-IVLRTVMILLGAWLIA----------- 130

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL++  +  + ++                       
Sbjct: 131 -------------EFHWLLYVFGAFLIVTGIKMWRHAGE--------------------- 156

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                       +  +  N     +           G NF          N        L
Sbjct: 157 ------------APDMEANPALKLLRRVMPVSPKLDGENFFTV------ENGKRIATPLL 198

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            +   + I D   ++D + + FAIT + FI++       + +R+M    L      K+  
Sbjct: 199 LVVALVGITDVIFAVDSIPAIFAITTDPFIVLTSNIFAILGLRAM--YFLLAAAAEKFHL 256

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           L +G    +  +   M L  +  IP + +      ++ +++  S+K
Sbjct: 257 LGYGLAVILTFIGTKMVLIDVFKIPVLVSLGVVAAILAVTMIWSLK 302


>gi|311898896|dbj|BAJ31304.1| putative tellurium resistance protein [Kitasatospora setae KM-6054]
          Length = 328

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/350 (15%), Positives = 107/350 (30%), Gaps = 78/350 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     W  +      L G  + W      +G     YI       E SLS +
Sbjct: 28  RKPHEVSVKEAGIWTAVWVALAALFGGFLWWYGGGKPAGEFFAGYIT------EKSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + K     I+Q+R L +G++IA+  +R +F      +VS  +          
Sbjct: 82  NLFVFILIMGKFAVPRIYQQRVLMFGVIIAL-VLRAVFIAGGAALVSQFS---------- 130

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+  +      ++                        
Sbjct: 131 --------------WVFYLFGAFLVWTAWKLIKEARAD---------------------- 154

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   V     +   + G   +         N        L +
Sbjct: 155 --------EEEEEFEENRLLKAVQRRIPSTADYRGTKLIVR------ENGRRLVTPMLIV 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +   D   +LD + + F +T++ +I+        + +R +    L  G+L K  +L 
Sbjct: 201 MLAIGTTDVLFALDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLIGGLLKKLVHLS 258

Query: 301 HGSYYSIFVLSVIMFLQTIV----DIPEI---FTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +      +PEI    +     + + ++  +S+
Sbjct: 259 YGLSVILGFIGVKLVLHALHESGVHVPEISIPVSLGFIVLTLAVTTVTSL 308


>gi|240137384|ref|YP_002961855.1| hypothetical protein MexAM1_META1p0648 [Methylobacterium extorquens
           AM1]
 gi|240007352|gb|ACS38578.1| conserved hypothetical protein; putative inner membrane protein alx
           [Methylobacterium extorquens AM1]
          Length = 341

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 49/347 (14%), Positives = 101/347 (29%), Gaps = 70/347 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           +  +    +             G   G  I W      +    T        V+E SLS 
Sbjct: 38  RDKNHEIGVKESLLLTAFYFTLGLAFGGWIWWMLGFDPAQEYVTGL------VIEKSLSM 91

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A  L  +      Q R L WGIL A   +R +   +   +V             
Sbjct: 92  DNVFVIAVILTSLGVPRAAQHRVLVWGIL-AAVLLRGLMIGLGSALV------------- 137

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                      Q    +      FL+ V +    + +   H                   
Sbjct: 138 -----------QQAHWVLSVFAAFLIYVGIKMLVSKEEDEH------------------- 167

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         +  +     +           G +F+       +   V        
Sbjct: 168 -------------DIQNSASMRLLKKWVRVTDKPEGQHFIVRRPDPKTGKMVRWLTPLAV 214

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + + I D   ++D V + FAIT + FI+        + +R++        +++++ YL
Sbjct: 215 ALVLVNIADVIFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAAMVDRFAYL 272

Query: 300 EHGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSIYSSI 343
           +      +  +   + +     +V +P   +   + +L+ L +  S+
Sbjct: 273 KTALALILLFIGAKIVVADTLELVHLPPWVSLVVTLVLLTLGVVYSL 319


>gi|120435471|ref|YP_861157.1| TerC family membrane protein [Gramella forsetii KT0803]
 gi|117577621|emb|CAL66090.1| TerC family membrane protein [Gramella forsetii KT0803]
          Length = 323

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/346 (14%), Positives = 105/346 (30%), Gaps = 74/346 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            N    +      ++      G      I W      +G   T Y+       E SLS +
Sbjct: 47  RNPHKINTREAAWYSAGWISLGVAFTGVIAWWQGTGAAGEYITGYLI------EKSLSMD 100

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  L A           +Q + L WGI  A+  +R+ F +  +                 
Sbjct: 101 NVFLWAVLFTYFKVPKEFQHKVLFWGIFGAL-VLRVAFILGGIA---------------- 143

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    I    G FL+  +   F +  +                       
Sbjct: 144 --------LIEKFHWIIYVFGAFLLFTAYKIFKSKTSGTDP------------------- 176

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N ++ +          +    F          N          +
Sbjct: 177 --------------ENNRIFKWAKKIIPQTNKYVEDKFFV------IENGKRLATPLFVV 216

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E+ D   +LD + +  A+T++ FI++       + +R++    L   + +++ +L 
Sbjct: 217 LVIVELTDIIFALDSIPAILAVTRDKFIVISSNAFAILGLRAL--YFLLADMKDRFVFLN 274

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            G    +  + V   +   V+IP   +     +++  SI  S+++K
Sbjct: 275 EGLAIILAFVGVKFLVSEQVEIPIWISLVFIAVILTGSILLSLRHK 320


>gi|256825139|ref|YP_003149099.1| tellurium resistance membrane protein TerC [Kytococcus sedentarius
           DSM 20547]
 gi|256688532|gb|ACV06334.1| membrane protein TerC, possibly involved in tellurium resistance
           [Kytococcus sedentarius DSM 20547]
          Length = 342

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 56/360 (15%), Positives = 111/360 (30%), Gaps = 87/360 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            N    S      +  +   A  L G+G+ +             ++       E SLS +
Sbjct: 24  RNPHVPSRKETTGFLTVYVSAAVLFGIGVWFFSGAQYGTEFFAGWLT------EYSLSID 77

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + K      +Q+  L WGI+IA+  +R IF  +    ++             
Sbjct: 78  NLFIFLIIMAKFGVPRKYQQDALLWGIIIAL-VLRAIFIAVGATAIN------------- 123

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   +    G FL+  ++  F  + N+     F E              
Sbjct: 124 -----------AFSWVFYIFGAFLIYTAIKLFLEAINEDDDEEFQE-------------- 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N+   FV     A+  + G             N        L  
Sbjct: 159 ----------------NKFIQFVKKHFPAVDDWEGGTKFVV-----KRNASKFITPMLLT 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L L   D   +LD + + F +T+  +++++      + +R +    L   +L K  YL 
Sbjct: 198 VLALGSTDLLFALDSIPAIFGLTQEPYLVLMANVFALMGLRQL--YFLLGDLLKKLVYLG 255

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V + L  +                  +IP   +  +  +++ ++  +S+
Sbjct: 256 VGLSVLLAFIGVKLILHAMHENELPFINGGEHIGWAPEIPITVSLGAIVVILGITTVASL 315


>gi|218528870|ref|YP_002419686.1| integral membrane protein TerC [Methylobacterium chloromethanicum
           CM4]
 gi|218521173|gb|ACK81758.1| Integral membrane protein TerC [Methylobacterium chloromethanicum
           CM4]
          Length = 341

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 49/347 (14%), Positives = 101/347 (29%), Gaps = 70/347 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           +  +    +             G   G  I W      +    T        V+E SLS 
Sbjct: 38  RDKNHEIGVKESLLLTAFYFTLGLAFGGWIWWMLGFDPAQEYVTGL------VIEKSLSM 91

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A  L  +      Q R L WGIL A   +R +   +   +V             
Sbjct: 92  DNVFVIAVILTSLGVPRAAQHRVLVWGIL-AAVLLRGLMIGLGSALV------------- 137

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                      Q    +      FL+ V +    + +   H                   
Sbjct: 138 -----------QQAHWVLSVFAAFLIYVGIKMLVSKEEDEH------------------- 167

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         +  +     +           G +F+       +   V        
Sbjct: 168 -------------DIQNSASMRLLKKWVRVTDKPEGQHFIVRKPDPKTGKMVRWLTPLAV 214

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + + I D   ++D V + FAIT + FI+        + +R++        +++++ YL
Sbjct: 215 ALVLVNIADVIFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAAMVDRFAYL 272

Query: 300 EHGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSIYSSI 343
           +      +  +   + +     +V +P   +   + +L+ L +  S+
Sbjct: 273 KTALALILLFIGAKIVVADTLELVHLPPWVSLVVTLVLLTLGVVYSL 319


>gi|332163023|ref|YP_004299600.1| putative drug efflux protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318604104|emb|CBY25602.1| integral membrane protein TerC [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667253|gb|ADZ43897.1| putative drug efflux protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330859527|emb|CBX69869.1| inner membrane protein alx [Yersinia enterocolitica W22703]
          Length = 328

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 49/343 (14%), Positives = 111/343 (32%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  S   +L     W+++      L   G  W  T T+   I+       L   ++E +L
Sbjct: 31  RRGSQTMTLRQAACWSLVWVSLSLLFNAGFWWYLTETMGREIADKQALAFLTGYLIEKAL 90

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +VS  +       
Sbjct: 91  AVDNVFVWLMLFSYFAVPANLQRRVLIYGVLGA-IVLRTIMIFAGSWLVSQFS------- 142

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      ++                    
Sbjct: 143 -----------------WILYLFGAFLLFTGIKMALAKED-------------------- 165

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                        S  +    +  ++ +        +G  F          N + +    
Sbjct: 166 -------------STPIGEKPLVRWIRNHLRMTDELHGDRFTVR------KNGLLYATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 207 VLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + V M +  +  IP   +      ++ L++ 
Sbjct: 265 MLKYGLSVILVFIGVKMMIIDLFHIPIGISLGVVAGILALTLL 307


>gi|182412745|ref|YP_001817811.1| integral membrane protein TerC [Opitutus terrae PB90-1]
 gi|177839959|gb|ACB74211.1| Integral membrane protein TerC [Opitutus terrae PB90-1]
          Length = 322

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/347 (15%), Positives = 103/347 (29%), Gaps = 72/347 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           +  S    +     W  +           +       L       Y+       E+SLS 
Sbjct: 37  QRESHAIKMKEALLWCGVWVALALGFNAIVWAWRGAELGQQFLASYLI------ELSLSV 90

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  +           + WQ R L WGI+ AV  MR +F ++ V                
Sbjct: 91  DNVFVFILVFAYFKVPAKWQHRVLFWGIIGAV-VMRAVFILVGVS--------------- 134

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                    + Q    +    G FL+   +     S+ ++                    
Sbjct: 135 ---------MIQRFHWVLYVFGAFLVYTGIKMALPSKEEV-------------------- 165

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                      +     N +                 +F                     
Sbjct: 166 -----------NVDPDHNPVVRLFKRFYPVAARNEEGHFFVR------HEGRLMATPLFI 208

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
           + L +E  D   +LD + +  AITK+ F+ +       + +RS+       GI+  ++YL
Sbjct: 209 VLLVVETTDVVFALDSIPAVLAITKDGFVALTSNIFAILGLRSL--YFALSGIMQLFRYL 266

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
           + G    +  + V M ++  V+IP   +      ++ +S+  S+  +
Sbjct: 267 KIGLAVILCFIGVKMLIEHWVNIPTSASLAVIACVLTMSVLLSVLIR 313


>gi|254559564|ref|YP_003066659.1| hypothetical protein METDI1019 [Methylobacterium extorquens DM4]
 gi|254266842|emb|CAX22641.1| conserved hypothetical protein; putative inner membrane protein alx
           [Methylobacterium extorquens DM4]
          Length = 341

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 49/347 (14%), Positives = 101/347 (29%), Gaps = 70/347 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           +  +    +             G   G  I W      +    T        V+E SLS 
Sbjct: 38  RDKNHEIGVKESLLLTAFYFTLGLAFGGWIWWMLGFDPAQEYVTGL------VIEKSLSM 91

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A  L  +      Q R L WGIL A   +R +   +   +V             
Sbjct: 92  DNVFVIAVILTSLGVPRAAQHRVLVWGIL-AAVLLRGLMIGLGSALV------------- 137

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                      Q    +      FL+ V +    + +   H                   
Sbjct: 138 -----------QQAHWVLSVFAAFLIYVGIKMLVSKEEDEH------------------- 167

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         +  +     +           G +F+       +   V        
Sbjct: 168 -------------DIKNSASMRLLKKWVRVTDKPEGQHFIVRRPDPKTGKMVRWLTPLAV 214

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + + I D   ++D V + FAIT + FI+        + +R++        +++++ YL
Sbjct: 215 ALVLVNIADVIFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAAMVDRFAYL 272

Query: 300 EHGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSIYSSI 343
           +      +  +   + +     +V +P   +   + +L+ L +  S+
Sbjct: 273 KTALALILLFIGAKIVVADTLELVHLPPWVSLVVTLVLLTLGVVYSL 319


>gi|108758817|ref|YP_629787.1| TerC family membrane protein [Myxococcus xanthus DK 1622]
 gi|108462697|gb|ABF87882.1| membrane protein, TerC family [Myxococcus xanthus DK 1622]
          Length = 316

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/344 (12%), Positives = 96/344 (27%), Gaps = 75/344 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +      W ++      +   GI      T+     T Y+       E +LS +
Sbjct: 28  RKDHAVTPKEAGLWTLVWITLSLIFCAGIWHYQGPTVGLQWLTAYVV------EYALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +          +   Q R L WGIL A      +                       
Sbjct: 82  NLFVFLMVFSYFRVAPEHQHRVLFWGILGAFVMRAGLIIA-------------------- 121

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    +    G FL+  ++    +   ++                     
Sbjct: 122 -----GTALVKQFHWLIYLFGAFLVFTAVKMLVSKDEEMDP------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             +  F         +  G  F+         +  +       +
Sbjct: 158 --------------EQQGIVKFARRVLPVARLGEGSRFMV------QEDGRSKFTPLFIV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +E  D   +LD + +   I+++ FII        + +RS+    +   ++ K+ +L+
Sbjct: 198 LLVVEATDLLFALDSIPAVLGISQDAFIIYTSNVCAILGLRSL--FFVVASLMEKFHFLK 255

Query: 301 HGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V M +    + +P   +      ++  +I +S+
Sbjct: 256 VGLSAILGFVGVKMLITFFDIHVPIGISLGVIAGVLVAAIVASL 299


>gi|163850313|ref|YP_001638356.1| integral membrane protein TerC [Methylobacterium extorquens PA1]
 gi|163661918|gb|ABY29285.1| Integral membrane protein TerC [Methylobacterium extorquens PA1]
          Length = 341

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 49/347 (14%), Positives = 101/347 (29%), Gaps = 70/347 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           +  +    +             G   G  I W      +    T        V+E SLS 
Sbjct: 38  RDKNHEIGVKESLLLTAFYFTLGLAFGGWIWWMLGFDPAQEYVTGL------VIEKSLSM 91

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A  L  +      Q R L WGIL A   +R +   +   +V             
Sbjct: 92  DNVFVIAVILTSLGVPRAAQHRVLVWGIL-AAVLLRGLMIGLGSALV------------- 137

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                      Q    +      FL+ V +    + +   H                   
Sbjct: 138 -----------QQAHWVLSVFAAFLIYVGIKMLVSKEEDEH------------------- 167

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                         +  +     +           G +F+       +   V        
Sbjct: 168 -------------DIKNSASMRLLKKWVRVTDKPEGQHFIVRKPDPKTGKMVRWLTPLAV 214

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + + I D   ++D V + FAIT + FI+        + +R++        +++++ YL
Sbjct: 215 ALVLVNIADVIFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAAMVDRFAYL 272

Query: 300 EHGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSIYSSI 343
           +      +  +   + +     +V +P   +   + +L+ L +  S+
Sbjct: 273 KTALALILLFIGAKIVVADTLELVHLPPWVSLVVTLVLLTLGVVYSL 319


>gi|225076352|ref|ZP_03719551.1| hypothetical protein NEIFLAOT_01396 [Neisseria flavescens
           NRL30031/H210]
 gi|224952337|gb|EEG33546.1| hypothetical protein NEIFLAOT_01396 [Neisseria flavescens
           NRL30031/H210]
          Length = 314

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 47/350 (13%), Positives = 102/350 (29%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ +   S+     W+ +           + ++     +                 V+E 
Sbjct: 23  KNGAHKVSIKEALAWSGIWVAVSCAFAGWLYFELAGNPTYGAVVAKEKVLEFFTGYVLEK 82

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+  A   +R I   +   +V         
Sbjct: 83  SLAVDNIFVFLMIFGYFKVEPKFQHRVLLYGVFGA-IVLRAIMIFIGAALV--------- 132

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +                          
Sbjct: 133 ---------------QQFEWILYLFGAFLLYTGIHMMKPEAE------------------ 159

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  N++ + +         F G  F          N      
Sbjct: 160 --------------AEEDLSQNKILTLLKKVIPTSQQFDGEKFFT------IENGKRIAT 199

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
               + + +E+ D   ++D + + FA+T + FI++       + +R+M    L      +
Sbjct: 200 PLFLVLIMIELSDVIFAVDSIPAIFAVTTDPFIVLTSNIFAILGLRAM--YFLLADFAER 257

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + + M +   V IP   + +     +  SI +S+  
Sbjct: 258 FIFLKYGLAFVLSFIGIKMLIMHWVHIPISISLSVVFGALGASILTSLVY 307


>gi|149184727|ref|ZP_01863045.1| Integral membrane protein TerC [Erythrobacter sp. SD-21]
 gi|148832047|gb|EDL50480.1| Integral membrane protein TerC [Erythrobacter sp. SD-21]
          Length = 345

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/349 (13%), Positives = 107/349 (30%), Gaps = 72/349 (20%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +        +    + +        L G  + ++   T      T +       +E +LS
Sbjct: 34  LHKEDKELGIGESLKLSAFYIGVALLFGAWVWFERGATAGMEYYTGF------FIEKALS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + +           +Q R L WGI+ AV  +R +       +++           
Sbjct: 88  IDNVFVISLIFTYFAIPPKYQYRALLWGIM-AVIVLRGLMIAGGAALLAEA--------- 137

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +      FL++  +  FF     +                   
Sbjct: 138 ---------------YWVLYIFAAFLIVTGIKMFFAGDEPMD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N +  ++S+        +   F   V  S +   VT      
Sbjct: 165 ---------------VGKNPVIRWISTHMRVTRKLHAQRFFVKVPDSKTGKLVTAATPLF 209

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + + + D   +LD V + FAIT + FI+        + +R++        ++++++Y
Sbjct: 210 LALVVINLADLVFALDSVPAIFAITTDTFIVYTSNIFAILGLRAL--YFALAAMVHRFQY 267

Query: 299 LEHGSYYSIFVLSVIMFLQTIV----DIPEIFTGTSSTILIFLSIYSSI 343
           L++     +  +   +F+   +     +P   +   +  LI   I  S+
Sbjct: 268 LKYALAAVLVFIGSKIFVTDFLLGGGKMPAWISLGVTFGLILAGILYSL 316


>gi|320011421|gb|ADW06271.1| Integral membrane protein TerC [Streptomyces flavogriseus ATCC
           33331]
          Length = 339

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 55/352 (15%), Positives = 109/352 (30%), Gaps = 78/352 (22%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S      W I+      L GLG+        SG     +I       E SLS
Sbjct: 25  IGRKPHDVSTKEAGIWTIVWITLAVLFGLGLLVFGESQASGEFFAGFIT------EKSLS 78

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + K    S  Q+R L  G+LIA+  +R IF      +++  +        
Sbjct: 79  VDNLFVFVLIMAKFSVPSHLQQRVLLIGVLIAL-VLRAIFIAAGAAVIANFS-------- 129

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL+  +                              
Sbjct: 130 ----------------WVFYIFGAFLIYTAWKLIQE------------------------ 149

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                 +      +    N +   +         ++G            +N        +
Sbjct: 150 ------ARADEEEDDFEENRLLKSIEHRFGVADKYHGTKLFIR------NNGKRVMTPLM 197

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +   D   +LD + + F +T++ +I+        + +R +    L  G+L K  +
Sbjct: 198 VVMLAIGTTDVLFALDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLIGGLLKKLVH 255

Query: 299 LEHGSYYSIFVLSVIMFLQTIV----DIPEI---FTGTSSTILIFLSIYSSI 343
           L +G    +  + V + L  +      +PEI   F+ T    ++ ++  +S+
Sbjct: 256 LSYGLSVILGFIGVKLVLHALHESGVHVPEISIPFSLTVICGVLVITTITSL 307


>gi|187476763|ref|YP_784787.1| pH-regulated membrane protein [Bordetella avium 197N]
 gi|115421349|emb|CAJ47854.1| putative pH-regulated membrane protein [Bordetella avium 197N]
          Length = 323

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/346 (15%), Positives = 105/346 (30%), Gaps = 69/346 (19%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +  +     +      +     A  L G GI WQ          T ++       E SLS
Sbjct: 34  LHKDEREIGVRESLLLSAGYIAAALLFGSGIWWQMGAESGMAYYTGFLI------EKSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A           +Q R L WGIL  V  +R +   +   +VS           
Sbjct: 88  MDNVFVIALIFSYFAIPRRYQHRVLFWGILG-VIVLRALMIGLGTALVSQFG-------- 138

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL+   +  +     +                    
Sbjct: 139 ----------------WVMYVFGAFLVYTGVKMWRMVDEEPD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N +  F+           G  F        +          L
Sbjct: 165 ---------------IANNAILKFLKRRMRVTDDLRGNAFTVVETDPVTQRKTRFATPLL 209

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E +D   ++D V + FAIT + FI+        + +R++        +++++ Y
Sbjct: 210 LALVLIEFVDLLFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALSALIHRFHY 267

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
           L++     +  +   +FL  ++  +P + + + +  LI   I  S+
Sbjct: 268 LKYALALVLVFIGGKIFLHGLIGKVPAVLSLSVTFGLIAAGILYSL 313


>gi|329298767|ref|ZP_08256103.1| Integral membrane protein TerC [Plautia stali symbiont]
          Length = 323

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/343 (13%), Positives = 104/343 (30%), Gaps = 69/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S      W+++      L      W    +    ++T      L   V+E +L
Sbjct: 30  RRGAQTMSFKQAAVWSLVWISVSLLFAAAFWWYLDGSAGREVATAQTLAFLTGYVLEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           S  Q+R L +G+L A   +R I       +V+  +       
Sbjct: 90  AVDNVFVWLMLFSYFAIPSNLQRRVLIYGVLGA-IVLRTIMIFAGSWLVTQFS------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +   F                        
Sbjct: 142 -----------------WILYIFGAFLLFTGIKMAFAKDGDD------------------ 166

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++          +G  F          N V      
Sbjct: 167 --------------AAVGDKPVVRWLRKHLRMTDELHGEKFFTR------KNGVLFATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 207 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   + T   +++  ++ 
Sbjct: 265 MLKYGLAIVLVFIGIKMLIVEFYHIPVAISLTVVGVILGGTLL 307


>gi|219683970|ref|YP_002470353.1| hypothetical protein TerC [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|219621620|gb|ACL29777.1| Integral membrane protein TerC [Bifidobacterium animalis subsp.
           lactis AD011]
 gi|289178754|gb|ADC86000.1| TerC [Bifidobacterium animalis subsp. lactis BB-12]
          Length = 337

 Score =  151 bits (381), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 46/360 (12%), Positives = 101/360 (28%), Gaps = 91/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S     +          + G  I W      +    + ++       E SLS +
Sbjct: 29  RRPHVPSTKECVQHIAFFVAMALVFGGLIWWVAGAKPAVEFYSGWLT------EYSLSID 82

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         QK  L+ GI IA+  +R +F ++   +VS             
Sbjct: 83  NLFVFVIIMSNFAVPKKLQKFVLSVGITIAL-VLRGLFILIGAALVSRFT---------- 131

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+  ++       +                       
Sbjct: 132 --------------WVFFIFGAFLIYTAVKVAIGEDDDEE-------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   +   +     + G     ++      +   +    L +
Sbjct: 158 -------------FHENGLIRLMRRFSHITNEYDGERLRTTI------DGRKYWTPMLIV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+ +   D   + D + + F +TK+ FI+        + ++ +    L   +L+K  YL 
Sbjct: 199 FITIGTTDVMFAFDSIPAIFGLTKDPFIVFTSNVFALLGLQQL--YFLLGRLLDKLVYLP 256

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V + L+ +                  ++P   +     + I  S  +S+
Sbjct: 257 VGLSLVLGFIGVKLILEALHGNTLPFINHGQPLGMVPEVPTWLSLVVIIVCIGGSALASV 316


>gi|292489560|ref|YP_003532450.1| putative TerC family transporter [Erwinia amylovora CFBP1430]
 gi|291554997|emb|CBA23022.1| putative TerC family transporter [Erwinia amylovora CFBP1430]
 gi|312173735|emb|CBX81989.1| putative TerC family transporter [Erwinia amylovora ATCC BAA-2158]
          Length = 350

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 108/343 (31%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+++      L      W  T T+   ++       L   ++E +L
Sbjct: 54  RRGAHTMSMKQAAVWSLVWVTLSLLFNAAFWWYLTGTVGREVADTQALAFLTGYLIEKAL 113

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +V+  +       
Sbjct: 114 AVDNVFVWLMLFGYFAVPAALQRRVLIYGVLGA-IVLRTIMIFAGSWLVTQFS------- 165

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +    ++++                    
Sbjct: 166 -----------------WLLYLFGAFLLFTGIKMALSNEDDSD----------------- 191

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++           G +F          N +      
Sbjct: 192 ----------------IGDKPLVRWLRGRLRMTDKIEGEHFFVRR------NGLLFATPL 229

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 230 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 287

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + V M +     IP   +      ++ L++ 
Sbjct: 288 MLKYGLSLILVFIGVKMLIVDFYHIPIAISLGIVGGILALTLL 330


>gi|114707623|ref|ZP_01440518.1| TerC family protein [Fulvimarina pelagi HTCC2506]
 gi|114536867|gb|EAU39996.1| TerC family protein [Fulvimarina pelagi HTCC2506]
          Length = 375

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 45/348 (12%), Positives = 105/348 (30%), Gaps = 71/348 (20%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +   +    +      + +    G   G  + WQ          T ++       E +L+
Sbjct: 73  LHRENREIEVRESLVLSSMYIALGLAFGGFVWWQLGSESGLNYLTGFVV------EKTLA 126

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A           +Q R L WGIL  V  +R I   +   +VS  +        
Sbjct: 127 LDNVFVIALIFSFFAVPRKYQHRVLFWGILG-VIVLRAIMIGLGATLVSQFS-------- 177

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +      FL++  +   +  + +                    
Sbjct: 178 ----------------WVLYVFAAFLIITGIKMLWIGEKEPD------------------ 203

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N +  F+          +G  F     +  +           
Sbjct: 204 ---------------IGNNPIVGFLRRRFNVTDQHHGEAFFVRKANPVTGQLTWFMTPLF 248

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +EI D   ++D V + FAIT + FI+        + +R++        ++++++Y
Sbjct: 249 MALVMVEIADVIFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAAMIHRFRY 306

Query: 299 LEHGSYYSIFVLSVIMFLQTIV---DIPEIFTGTSSTILIFLSIYSSI 343
           L+      +  +   +F+  ++     P   + + +  +I   +  S+
Sbjct: 307 LKPALAIVLIFIGSKIFVADLLGLEKFPATLSLSITFAIIGSGVVWSL 354


>gi|325962816|ref|YP_004240722.1| membrane protein TerC, possibly involved in tellurium resistance
           [Arthrobacter phenanthrenivorans Sphe3]
 gi|323468903|gb|ADX72588.1| membrane protein TerC, possibly involved in tellurium resistance
           [Arthrobacter phenanthrenivorans Sphe3]
          Length = 343

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/344 (13%), Positives = 103/344 (29%), Gaps = 75/344 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +    +     W+ +    G   G+ +   +           Y+       E SL+ +
Sbjct: 27  RKAHVIGVREAALWSAVWVAFGVGFGVLVWQLYGAEFGQQYFAGYLI------EKSLAVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G+L A+    I        I S             
Sbjct: 81  NVFIWAIIFTYFAVPREYQHRVLFFGVLGALVFRGIFIAAGAAIIASAG----------- 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +      FL++       +  + +                     
Sbjct: 130 --------------WVLYLFAAFLLVTGYRMIRHRNDHVDP------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +               F+G  FL         + V      L +
Sbjct: 157 --------------AKSRALKLFRRYVPMTNDFHGQRFLIRR------DGVLLATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   ++D + + FA+T + F++        + +R+M    L   +++++ YL+
Sbjct: 197 LVLVEATDIIFAVDSIPAIFAVTDDVFLVFTANAFAILGLRAM--YFLLADLIHRFIYLK 254

Query: 301 HGSYYSIFVLSVIMFLQT-IVDIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + + MFL+  I  IP   +     +++ +S+ +S+
Sbjct: 255 TGLALVLIWVGIKMFLKIDIYYIPTPVSLAVIAVILSVSVAASL 298


>gi|183601488|ref|ZP_02962858.1| hypothetical protein BIFLAC_02502 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|241191012|ref|YP_002968406.1| putative tellurium resistance membrane protein [Bifidobacterium
           animalis subsp. lactis Bl-04]
 gi|241196418|ref|YP_002969973.1| membrane protein for putative tellurium resistance [Bifidobacterium
           animalis subsp. lactis DSM 10140]
 gi|183219094|gb|EDT89735.1| hypothetical protein BIFLAC_02502 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|240249404|gb|ACS46344.1| Membrane protein for probable tellurium resistance [Bifidobacterium
           animalis subsp. lactis Bl-04]
 gi|240250972|gb|ACS47911.1| Membrane protein for probable tellurium resistance [Bifidobacterium
           animalis subsp. lactis DSM 10140]
 gi|295794001|gb|ADG33536.1| Membrane protein for probable tellurium resistance [Bifidobacterium
           animalis subsp. lactis V9]
          Length = 329

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 46/360 (12%), Positives = 101/360 (28%), Gaps = 91/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S     +          + G  I W      +    + ++       E SLS +
Sbjct: 21  RRPHVPSTKECVQHIAFFVAMALVFGGLIWWVAGAKPAVEFYSGWLT------EYSLSID 74

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         QK  L+ GI IA+  +R +F ++   +VS             
Sbjct: 75  NLFVFVIIMSNFAVPKKLQKFVLSVGITIAL-VLRGLFILIGAALVSRFT---------- 123

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+  ++       +                       
Sbjct: 124 --------------WVFFIFGAFLIYTAVKVAIGEDDDEE-------------------- 149

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   +   +     + G     ++      +   +    L +
Sbjct: 150 -------------FHENGLIRLMRRFSHITNEYDGERLRTTI------DGRKYWTPMLIV 190

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+ +   D   + D + + F +TK+ FI+        + ++ +    L   +L+K  YL 
Sbjct: 191 FITIGTTDVMFAFDSIPAIFGLTKDPFIVFTSNVFALLGLQQL--YFLLGRLLDKLVYLP 248

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V + L+ +                  ++P   +     + I  S  +S+
Sbjct: 249 VGLSLVLGFIGVKLILEALHGNTLPFINHGQPLGMVPEVPTWLSLVVIIVCIGGSALASV 308


>gi|86143348|ref|ZP_01061750.1| membrane protein, TerC family protein [Leeuwenhoekiella blandensis
           MED217]
 gi|85830253|gb|EAQ48713.1| membrane protein, TerC family protein [Leeuwenhoekiella blandensis
           MED217]
          Length = 326

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 51/353 (14%), Positives = 102/353 (28%), Gaps = 73/353 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTIS------TVYICIILAVV 55
             +           W  +           I W F   L    +       V   I   ++
Sbjct: 23  NKHDHVIKSKEAGIWTAVWFTIAMAFSGVIYWLFNTDLVENPTGISANTAVLKYITGYLI 82

Query: 56  EISLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIE 113
           E+SLS +N  + A           +Q R L WGIL A+    ++    +           
Sbjct: 83  ELSLSIDNVFVIAVIFSSFKIPPKYQHRVLFWGILGAIIFRALMIVFGVA---------- 132

Query: 114 AMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLS 173
                          +      I    G FL+  +     ++  +               
Sbjct: 133 ---------------LINKFEWIIYVFGGFLLFTAYRMLKSNGEED-------------- 163

Query: 174 KIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH 233
                                  + +Y  V           G +F        +      
Sbjct: 164 ------------------YDPQDSTVYKTVKKMFPVTTKMEGHDFFI------TDQGKRA 199

Query: 234 GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
                   + +E+ D   +LD + +  AIT + F++     +  + +RSM    L   +L
Sbjct: 200 ATPLFLALIVIELTDILFALDSIPAILAITADPFLVFTSNILAILGLRSM--YFLISRML 257

Query: 294 NKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            K++Y+ +     +  + + M    ++++PE  +     + +   I +SI  K
Sbjct: 258 QKFRYIHYSLVVILAFVGLKMIFSHMIEVPEWLSLGVIVVSLVAGILASIYLK 310


>gi|300772301|ref|ZP_07082171.1| tellurium resistance protein TerC family protein [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300760604|gb|EFK57430.1| tellurium resistance protein TerC family protein [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 339

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 46/347 (13%), Positives = 93/347 (26%), Gaps = 55/347 (15%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTIST---VYICIILAVVEIS 58
              S   +      W  +      +    + + F     G                +E +
Sbjct: 32  NKKSHIVTSKEATIWTFVWISLAMIFSGIVYYVFNGDAGGHQLAIEKFTQFQAAYWIEKA 91

Query: 59  LSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMN 116
           LS +N  +                + L WGIL A+   R IF    V I++         
Sbjct: 92  LSVDNLFVFILVFSYFKVPRNLHHKVLFWGILGAL-VFRAIFIFAGVGIINITYLPAMQL 150

Query: 117 LAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
           L      +           +    G FL+   +  +                        
Sbjct: 151 LGHTVEINV----------VLTLFGLFLIYAGIKSWGGGDEDDE---------------- 184

Query: 177 GIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH 236
                               +     +         +    F          N +     
Sbjct: 185 ---------------QDFSNSAGARLIKKLYKVSDNYDRDRFFTV------QNGMKIATP 223

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
            L +   +E  D   ++D + + FAI+K+ FI+        + +RS+    L    ++ +
Sbjct: 224 LLVVVAVIEFTDVLFAVDSIPAIFAISKDPFILYTSNIFAILGLRSL--YFLLSNFIHMF 281

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
             L +G    +  + + M +     IP   +      ++ +S+  SI
Sbjct: 282 SKLPYGLSVILAFIGIKMLISPWFHIPSPVSLGIVGGVLIISVLLSI 328


>gi|288958411|ref|YP_003448752.1| tellurite resistance protein [Azospirillum sp. B510]
 gi|288910719|dbj|BAI72208.1| tellurite resistance protein [Azospirillum sp. B510]
          Length = 330

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 48/346 (13%), Positives = 100/346 (28%), Gaps = 69/346 (19%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +        +    + +        L G  + W           T +        E SLS
Sbjct: 38  LNRRDHVIGVGESLKLSAFYIAVALLFGGWVWWSMGGEAGLQYYTGFFV------EKSLS 91

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + +            Q R L WGIL  V  +R +       +VS           
Sbjct: 92  LDNVFVISLIFSYFAVPRELQHRVLFWGILG-VIVLRGLMIGAGAALVS----------- 139

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            I    G FL++  +   F    +                    
Sbjct: 140 -------------EFHWILYVFGGFLLLTGIKMLFAKDEE-------------------- 166

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N    F+         F+G  F+    + +           L
Sbjct: 167 -------------ANIGDNAALRFLKRHIRVTDRFHGHRFVVRAPAGEGGALRWTATPLL 213

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E+ D   ++D V + FAIT + +++        + +R++        ++++++Y
Sbjct: 214 LALIMVELADLVFAVDSVPAIFAITTDPYLVYTSNIFAILGLRAL--YFALAAMVHRFRY 271

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPE-IFTGTSSTILIFLSIYSSI 343
           L++     +  +   +F   I   P+ +     +  LI   +  S+
Sbjct: 272 LKYALALVLVFIGGKIFYTQIFGKPDPLIALGVTFALIGGGVLVSL 317


>gi|294628745|ref|ZP_06707305.1| TerC family membrane protein [Streptomyces sp. e14]
 gi|292832078|gb|EFF90427.1| TerC family membrane protein [Streptomyces sp. e14]
          Length = 331

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 51/352 (14%), Positives = 104/352 (29%), Gaps = 75/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       SL     W ++      L GLG+        +G     +I       E SLS
Sbjct: 19  IGRKPHDVSLKEAGLWTVVWITLAGLFGLGLLVFAGGRPAGEFFAGFIT------EKSLS 72

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + K    S +Q+R L  G+LIA+             + +           
Sbjct: 73  VDNLFVFVLIMAKFAVPSHYQQRVLLVGVLIALVLRAAFIAAGAAVLAN----------- 121

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL+  +      ++                      
Sbjct: 122 --------------FSWVFYLFGAFLIWTAWKLIQEAR---------------------- 145

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                       S     N++             ++G             N        L
Sbjct: 146 -----TGGSDPESEEFEENKLLKAAERRFGVADRYHGTKLWIR------ENGKRVMTPML 194

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +   D   +LD + + F +T++ +I+        + +R +    L  G+L K  +
Sbjct: 195 VVMLAIGTTDVLFALDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLIGGLLKKLVH 252

Query: 299 LEHGSYYSIFVLSVIMFLQTIV----DIPEI---FTGTSSTILIFLSIYSSI 343
           L +G    +  + V + L  +      +PEI    +     +++ ++  +S+
Sbjct: 253 LSYGLSVILGFIGVKLVLHALHESGVHVPEISTAVSLGVICVVLAVTTVTSL 304


>gi|153838903|ref|ZP_01991570.1| membrane protein TerC [Vibrio parahaemolyticus AQ3810]
 gi|260362608|ref|ZP_05775515.1| membrane protein TerC [Vibrio parahaemolyticus K5030]
 gi|260877648|ref|ZP_05890003.1| membrane protein TerC [Vibrio parahaemolyticus AN-5034]
 gi|260896438|ref|ZP_05904934.1| membrane protein TerC [Vibrio parahaemolyticus Peru-466]
 gi|260899323|ref|ZP_05907718.1| membrane protein TerC [Vibrio parahaemolyticus AQ4037]
 gi|149747660|gb|EDM58578.1| membrane protein TerC [Vibrio parahaemolyticus AQ3810]
 gi|308087246|gb|EFO36941.1| membrane protein TerC [Vibrio parahaemolyticus Peru-466]
 gi|308090952|gb|EFO40647.1| membrane protein TerC [Vibrio parahaemolyticus AN-5034]
 gi|308108738|gb|EFO46278.1| membrane protein TerC [Vibrio parahaemolyticus AQ4037]
 gi|308112778|gb|EFO50318.1| membrane protein TerC [Vibrio parahaemolyticus K5030]
          Length = 339

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/350 (13%), Positives = 114/350 (32%), Gaps = 74/350 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEI 57
           ++     ++     W+I   +  FL    I + +     H+           +   ++E 
Sbjct: 40  QTRGGAITMQKAIVWSIFWFLLAFLFAGSILFFWDVYAPHSAYSNEKATVSFLTGYLLEK 99

Query: 58  SLSFENAILNAKNLQK--MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SLS +N  + A    +  +    + R L WG++ A+  +R I   +   +++        
Sbjct: 100 SLSVDNLFVFAIIFAQYKVPEHLRPRALLWGVIGAL-VLRAIMIAVGAQLLAQ------- 151

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                            +  +      FL+   +    +   +     + E         
Sbjct: 152 -----------------YHWVLYLFAAFLIWTGIKLARDKGEEEEVNPYPE--------- 185

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                      +         + G +                  
Sbjct: 186 -------------------------QVIRKLLPVTDEYQGNHMF------LKQAGKWVAT 214

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L +   + ++D   +LD + + FA+T+  F+++       + +RS+    + Q +L+K
Sbjct: 215 PMLIVVGVIAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSL--YFVLQAMLDK 272

Query: 296 YKYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           + YL+      +  + V M L  T  +IP I++ T   +++  ++ +S+ 
Sbjct: 273 FVYLKPALSVIMMFIGVKMLLVGTEYEIPTIWSLTFLILVMTSAVVASVY 322


>gi|163841031|ref|YP_001625436.1| tellurium resistance protein [Renibacterium salmoninarum ATCC
           33209]
 gi|162954507|gb|ABY24022.1| tellurium resistance protein [Renibacterium salmoninarum ATCC
           33209]
          Length = 360

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/360 (13%), Positives = 98/360 (27%), Gaps = 90/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     W         +  + +               +I       E SLS +
Sbjct: 46  KRPHEPSMKESGLWIAFYVGLALIFAVLMFVFTGVEHGSQFLAGWIT------EYSLSID 99

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    L +      +Q+  L  GI+IA+  +R IF ++   ++              
Sbjct: 100 NLFVFIIVLTRFSVPRKYQQEALMVGIIIALI-LRGIFILLGSAVI-------------- 144

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +    +    G FL+  +     +S                         
Sbjct: 145 ----------ENFSWVFYIFGLFLLYTAWQQARDSGEDEGHAG----------------- 177

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   + S       F G      V      +        L +
Sbjct: 178 ---------------DNALIRKLRSVLPISKDFDGAKVRTVV------DGQKMWTPMLIV 216

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+ L + D   ++D + + F +TK  FI+        + +R +    L   +L +  +L+
Sbjct: 217 FIALGLTDLLFAVDSIPAIFGLTKEPFIVFTANIFALMGLRQL--YFLLGCLLQRLVFLK 274

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           H     +  + V +    +                  +IP   +       I ++  +S+
Sbjct: 275 HALLIILGFIGVKLIFHAMHVNELPFINGGKGIDWAPEIPIWLSLAVILGTIVVATVASL 334


>gi|329848857|ref|ZP_08263885.1| integral membrane protein TerC family protein [Asticcacaulis
           biprosthecum C19]
 gi|328843920|gb|EGF93489.1| integral membrane protein TerC family protein [Asticcacaulis
           biprosthecum C19]
          Length = 372

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 55/353 (15%), Positives = 118/353 (33%), Gaps = 74/353 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYI------CIILAVV 55
           +  +   SL     W+ +   A       + W+            +        +   +V
Sbjct: 61  RQGAHKVSLGEAALWSFIWIAASMAFMAFLWWRMGGGSGDAALEAFAQHKALEFLTGYLV 120

Query: 56  EISLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIE 113
           E +L+ +N  +           + +QKR L  GIL A   +R    ++   +++      
Sbjct: 121 EKALAVDNIFVFLMLFTYFAVPAEFQKRALMIGIL-AALVLRGALILVGAWLIN------ 173

Query: 114 AMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLS 173
                                 +    G FL+   +  +  +  +               
Sbjct: 174 ------------------EFHWVLYLFGAFLVFTGIKMWLAAGKEAD------------- 202

Query: 174 KIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH 233
                               L +N   ++V  S A    + G  F   V      N  T 
Sbjct: 203 --------------------LDSNPALNWVRKSFAISPTYDGEKFFTRV------NRKTM 236

Query: 234 GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
               L + L + I+D   ++D + + FAIT + FI++    +  + +R+M    L  G+ 
Sbjct: 237 ATPLLVVVLLIGIVDVVFAVDSIPAIFAITTDPFIVLTSNVMAILGLRAM--YFLLAGVH 294

Query: 294 NKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
            ++  L +G    + ++   M L  +  IP  ++  ++ +++ L++  S+  K
Sbjct: 295 ERFHLLPYGLAMVLVLIGAKMLLIDLYKIPIQWSLGATAVILTLTVLLSLMIK 347


>gi|284993359|ref|YP_003411914.1| Integral membrane protein TerC [Geodermatophilus obscurus DSM
           43160]
 gi|284066605|gb|ADB77543.1| Integral membrane protein TerC [Geodermatophilus obscurus DSM
           43160]
          Length = 344

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 44/346 (12%), Positives = 104/346 (30%), Gaps = 75/346 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +    +     W+ +  + G   G  +  ++   L       Y+       E SL+ +
Sbjct: 27  RRAHVIGVREAAAWSAVWVLIGVGFGAWVWSRYGAELGQQYFAGYLI------EKSLAVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A  L         +   L  G+L A+  +R +F      ++S+            
Sbjct: 81  NVFVWAIVLTFFAVPREHEHWVLFLGVLGAL-VLRGLFIAGGAVLISSFG---------- 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +      FL+             +                     
Sbjct: 130 --------------WVLFLFAAFLLWTGYRMIRQRDEHIDP------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           +               ++G  FL         + V      L +
Sbjct: 157 --------------QRSRALRLFRRYVPMTDAYHGQRFLVRR------DGVLLATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E+ D   ++D + + FA+T   F++        + +R+M    L   +++++ +L+
Sbjct: 197 LVLVEVTDVVFAVDSIPAIFAVTDEPFLVFTANAFAVLGLRAM--YFLLADLVHRFVHLK 254

Query: 301 HGSYYSIFVLSVIMFLQT-IVDIPEIFTGTSSTILIFLSIYSSIKN 345
            G    +  + V M L+  +  IP   +      ++ ++I +S++ 
Sbjct: 255 VGLALVLMWVGVKMLLKIDVYYIPTAVSLAVIATILVVAIAASLRA 300


>gi|220911782|ref|YP_002487091.1| integral membrane protein TerC [Arthrobacter chlorophenolicus A6]
 gi|219858660|gb|ACL39002.1| Integral membrane protein TerC [Arthrobacter chlorophenolicus A6]
          Length = 399

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 44/359 (12%), Positives = 102/359 (28%), Gaps = 91/359 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   +L     W+ +      L GLG+      T+       Y+       E +LS +
Sbjct: 28  RKAHTPTLKESSIWSAIYVGIALLFGLGVLLFGGPTMGTEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ ++   R  F  +   +++             
Sbjct: 82  NLFVFLIIMASFKVPRADQQKVLLFGIVFSLIA-RTAFIFLGAALIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      +   +    G  L++ +        +                       
Sbjct: 128 -----------SFAWVFYIFGLILLITAGNLLKPDDHDDD-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             +         A   + G             N        L +
Sbjct: 157 --------------SEGFVVRLAKKFLPASEHYDGDKLFTM------ENGKKVLTPMLLV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+N FI+        + +R +    L  G+L++  +L 
Sbjct: 197 MVAIGGTDILFALDSIPAIFGLTQNVFIVFTATAFSLMGLRQL--FFLIDGLLDRLIFLS 254

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +                 ++    + +    ++ L+I +SI
Sbjct: 255 YGLAVILGFIGVKLILHALHENTLPFINDGEHVNVVEVSTGLSLSVILGVLVLTILASI 313


>gi|268590700|ref|ZP_06124921.1| protein Alx [Providencia rettgeri DSM 1131]
 gi|291313468|gb|EFE53921.1| protein Alx [Providencia rettgeri DSM 1131]
          Length = 319

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 53/343 (15%), Positives = 108/343 (31%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           K      S+     W+I+      L   G  W     +    +       L   ++E +L
Sbjct: 30  KHKGQAMSMKQAAAWSIVWVTLSLLFAAGFWWYLNENVGREFADSQTMAFLTGYLLEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +V+  +       
Sbjct: 90  AVDNVFVWLMLFSYFAIPATLQRRVLVYGVLGA-IVLRTIMIFAGSWLVTQFS------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   L   F  ++                    
Sbjct: 142 -----------------WILYVFGLFLLFTGLKMAFAKEDD------------------- 165

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                         + +    +  +V S        +G  F          N V      
Sbjct: 166 --------------SPITDKPLVKWVRSHLRMTDELHGEKFFIKR------NGVLFATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +EI D   ++D + + FA+T + FI++       + +R+M    L  G+  K+ 
Sbjct: 206 ILVLILVEISDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSGVAEKFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M L  I  IP   +      ++ +++ 
Sbjct: 264 MLKYGLAVILSFIGIKMLLIDIFHIPTPISLGVIASILVVTLI 306


>gi|188535021|ref|YP_001908818.1| membrane protein alx [Erwinia tasmaniensis Et1/99]
 gi|188030063|emb|CAO97949.1| membrane protein alx [Erwinia tasmaniensis Et1/99]
          Length = 326

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 109/343 (31%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+++      L      W  T T+   ++       L   ++E +L
Sbjct: 30  RRGAHTMSMKQAAAWSLVWVTLSLLFNAAFWWYLTDTVGREVADTQALAFLTGYLIEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +V+  +       
Sbjct: 90  AVDNVFVWLMLFGYFAVPAALQRRVLIYGVLGA-IVLRTIMIFAGSWLVTQFS------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +    + ++                    
Sbjct: 142 -----------------WLLYLFGAFLLFTGIKMALSKEDD------------------- 165

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                         + +    +  ++           G +F          N + +    
Sbjct: 166 --------------SAIGDKPLVRWLRGKMRMTDKIEGEHFFVR------QNGLLYATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 206 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + V M +     IP   +      ++ L++ 
Sbjct: 264 MLKYGLSVILVFIGVKMLIVDFYHIPIAVSLGIVGGILALTLL 306


>gi|119952422|ref|YP_950139.1| tellurium resistance protein TerC [Arthrobacter aurescens TC1]
 gi|119951552|gb|ABM10462.1| putative Tellurium resistance protein, TerC-family [Arthrobacter
           aurescens TC1]
          Length = 358

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 46/360 (12%), Positives = 99/360 (27%), Gaps = 92/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+    RW+        L G+GIG     T  G     Y+       E +LS +
Sbjct: 28  RKPHEPSIAESARWSAFYIGLALLFGVGIGTVSGWTFGGEYFAGYLT------EKALSID 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI+IA+  +R  F  +                   
Sbjct: 82  NLFVFLIVMAGFAVPKKYQQKVLMIGIIIALI-LRGGFIAIGAA---------------- 124

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    +    G  L++++    F+S                         
Sbjct: 125 --------LIENFSWVFYIFGALLLVLAYRQAFSSHE----------------------- 153

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                            +  + V         ++                       L  
Sbjct: 154 -----------ANPANGKFMTLVRRVLPVTDEYHQDKLTVR------QGGKRFVTPMLLT 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +  +D   ++D + + + +T   +I+        + +R +    L  G+L +  YL 
Sbjct: 197 IVAIGFVDLIFAVDSIPAIYGLTNEAYIVFTANAFALMGLRQL--FFLIGGLLERLVYLA 254

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V +    +                  +IP  F+       I ++  +S+
Sbjct: 255 QGLAVILGFIGVKLVFHALHVNELPFVNGGEPLLWVPEIPIWFSLLFIAATIVVATVASL 314


>gi|213053189|ref|ZP_03346067.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
          Length = 322

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 103/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+IL      L      W    T    ++       L   ++E SL
Sbjct: 30  RRGAHAMSMKQAAGWSILWVTLSLLFNAAFWWYLAETQGREVADPQALAFLTGYLIEKSL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G+L A   +R I       +++          
Sbjct: 90  AVDNVFVWLMLFSYFSVPPALQRRVLVYGVLGA-IVLRTIMIFAGTWLITQFE------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      +++                   
Sbjct: 142 -----------------WLLYVFGAFLLFTGVKMALAKEDESG----------------- 167

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    M  ++             +F          N + +    
Sbjct: 168 ----------------IGEKPMVRWLRGHLRMTDTIENEHFFVR------KNGLLYATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E  D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 206 LLVLIMVEFSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSGVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ +++ 
Sbjct: 264 MLKYGLAVILVFIGIKMLIVDFYHIPIAISLGVVFGILTITLV 306


>gi|116754768|ref|YP_843886.1| integral membrane protein TerC [Methanosaeta thermophila PT]
 gi|116666219|gb|ABK15246.1| Integral membrane protein TerC [Methanosaeta thermophila PT]
          Length = 318

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 50/343 (14%), Positives = 109/343 (31%), Gaps = 74/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             S   ++     W+ + T    +  + I +      +      Y+       E SLS +
Sbjct: 29  RRSSVITVKESLIWSGIWTAIALVFNIIIFFWHGQDRAIEFLAGYLI------ERSLSVD 82

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +              Q + L WGI++A+  MR +F    + ++              
Sbjct: 83  NLFVFLMIFSYFQVPETHQYKVLFWGIVVALL-MRALFIATGLTLI-------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +    I    G FL++  +      ++K+                     
Sbjct: 128 ----------EHFDWIIYLFGIFLIITGIKMALQRESKVQP------------------- 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +     S   A   + G  F+            T     L +
Sbjct: 159 --------------DRNPVVRMFRSVVPATDHYDGGRFITRAY------GRTMATPLLIV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E+ D   ++D + + FA+T + F++        + +R++          + + YL 
Sbjct: 199 LIAVEVTDLVFAVDSIPAVFAVTVDPFVVYTSNVFAVLGLRAL--YFALAACAHMFHYLN 256

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           HG    +  + + M L  + +IP  F      +++ +S+ +S+
Sbjct: 257 HGVILILIFVGIKMLLSDLYEIPVTFALGFVALVLLVSMLASL 299


>gi|16761996|ref|NP_457613.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|29143483|ref|NP_806825.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|213427201|ref|ZP_03359951.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|213584058|ref|ZP_03365884.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
 gi|213859672|ref|ZP_03385376.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
 gi|289825891|ref|ZP_06545051.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|38604678|sp|Q8Z3L5|ALX_SALTI RecName: Full=Inner membrane protein alx
 gi|25349064|pir||AF0894 probable drug efflux protein [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16504299|emb|CAD07748.1| possible drug efflux protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139117|gb|AAO70685.1| possible drug efflux protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 322

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 103/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+IL      L      W    T    ++       L   ++E SL
Sbjct: 30  RRGAHAMSMKQAAGWSILWVTLSLLFNAAFWWYLAETQGREVADPQALAFLTGYLIEKSL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G+L A   +R I       +++          
Sbjct: 90  AVDNVFVWLMLFSYFSVPPALQRRVLVYGVLGA-IVLRTIMIFAGTWLITQFE------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      +++                   
Sbjct: 142 -----------------WLLYVFGAFLLFTGVKMALAKEDESG----------------- 167

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    M  ++             +F          N + +    
Sbjct: 168 ----------------IGEKPMVRWLRGHLRMTDTIENEHFFVR------KNGLLYATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E  D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 206 LLVLIMVEFSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSGVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ +++ 
Sbjct: 264 MLKYGLAVILVFIGIKMLIVDFYHIPIAISLGVVFGILTITLV 306


>gi|192361260|ref|YP_001983010.1| Alx protein [Cellvibrio japonicus Ueda107]
 gi|190687425|gb|ACE85103.1| Alx protein [Cellvibrio japonicus Ueda107]
          Length = 365

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 55/345 (15%), Positives = 112/345 (32%), Gaps = 70/345 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLS 60
                 SL     W+++      L G G+ W      +   +           ++E SL+
Sbjct: 78  GKQHRVSLKEAATWSMIWVSLASLFGAGLWWYLDLEYTREFANTKTLEYFTGYLIEKSLA 137

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +              QKR LT+G+L A+  +R I     V +++           
Sbjct: 138 VDNVFVWLMLFNFFAIPFELQKRVLTYGVLGAII-LRTIMIFAGVWLIA----------- 185

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL++  +  ++ +                       
Sbjct: 186 -------------HFHWLLYLFGAFLLITGIKMWWIADK--------------------- 211

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                       +  L  N +  +V +  +      G  F          N V       
Sbjct: 212 ------------APDLEHNPLIRWVRNHFSISATLQGERFFVV------ENGVKMMTPLF 253

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +EI D   ++D + + FAIT + FI++       + +R+M    L   +  ++ Y
Sbjct: 254 LALIMVEISDIIFAVDSIPAIFAITSDPFIVLTSNLFAILGLRAM--YFLLADMAGRFAY 311

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           +++G    +  + + M L  +  IP  ++     +LI  S+  S+
Sbjct: 312 IKYGLSLVLVFIGIKMLLIDLYKIPVGWSLLVVAVLIGGSVLISL 356


>gi|149925425|ref|ZP_01913689.1| hypothetical protein LMED105_04357 [Limnobacter sp. MED105]
 gi|149825542|gb|EDM84750.1| hypothetical protein LMED105_04357 [Limnobacter sp. MED105]
          Length = 332

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 52/346 (15%), Positives = 108/346 (31%), Gaps = 69/346 (19%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +  +     +      +     A  L G  I +           T +       +E SLS
Sbjct: 34  LHKDDHEIGVKESLLLSGGYITAACLFGAWIWYYLGSESGMNYFTGF------AIEKSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A           +Q R L WGIL  V  +R I   +   +V            
Sbjct: 88  MDNVFVIAMIFSFFAIPRQYQHRVLFWGILG-VIVLRAIMIGLGAALV------------ 134

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                       +    +    G FL++  +  +F + ++                    
Sbjct: 135 ------------KEFSWVLYLFGAFLVITGIKMWFMADSEPD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N +  F+           G  F+ +     +   V      L
Sbjct: 165 ---------------IENNAILKFLRKRMRVTEGLRGNAFVVNEPDPKTGKVVRFATPLL 209

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E +D   ++D V + FAIT + FI+        + +R++        +++++ Y
Sbjct: 210 LALVLIEFVDLIFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAAMIHRFHY 267

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
           L++     +  +   +FL   +   P  F+ + +  LI   +  S+
Sbjct: 268 LKYALAMVLVFIGSKIFLVNFIGKFPPAFSLSVTLGLIAGGVVFSL 313


>gi|323357319|ref|YP_004223715.1| hypothetical protein MTES_0871 [Microbacterium testaceum StLB037]
 gi|323273690|dbj|BAJ73835.1| membrane protein TerC, possibly [Microbacterium testaceum StLB037]
          Length = 340

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 47/361 (13%), Positives = 101/361 (27%), Gaps = 92/361 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 ++    RW+        L G+G+G     T  G     Y+       E +LS +
Sbjct: 28  RKPHEPTIGESARWSAFYIGLALLFGVGVGVFSGWTFGGEYFAGYLT------EKALSID 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI+IA+  MR  F  +                   
Sbjct: 82  NLFVFLIIMTGFAVPKKYQQKVLMIGIVIALI-MRGAFIAVGAA---------------- 124

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    I    G  L++++    F+                          
Sbjct: 125 --------LIENFSWIFYLFGALLLVLAYRQAFSHGES---------------------- 154

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                            +   FV         +               +        L +
Sbjct: 155 ------------DPANGKFMQFVRRILPVSEEYNSDKLTVR------KDGKRFVTPMLLV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +  ID   ++D + + + +TK  +I+        + +R +    L  G+L +  YL 
Sbjct: 197 IVAIGFIDLVFAVDSIPAIYGLTKEAYIVFTANAFALMGLRQL--YFLIGGLLERLVYLA 254

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V +    +                  +IP  F+       + ++ + S+
Sbjct: 255 QGLAVILAFIGVKLVFHALHVNEVPFINGGEPLLWVPEIPIWFSLLFIAATVAVATWLSL 314

Query: 344 K 344
           +
Sbjct: 315 R 315


>gi|163847764|ref|YP_001635808.1| integral membrane protein TerC [Chloroflexus aurantiacus J-10-fl]
 gi|222525631|ref|YP_002570102.1| Integral membrane protein TerC [Chloroflexus sp. Y-400-fl]
 gi|163669053|gb|ABY35419.1| Integral membrane protein TerC [Chloroflexus aurantiacus J-10-fl]
 gi|222449510|gb|ACM53776.1| Integral membrane protein TerC [Chloroflexus sp. Y-400-fl]
          Length = 334

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 52/355 (14%), Positives = 108/355 (30%), Gaps = 80/355 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEIS 58
            ++   SL     W+++      +  LG+   +      +           +   ++E +
Sbjct: 28  RDAHEVSLREAAIWSVVWISLALVFNLGLYLFWDQIMPGSSLSAGEAGLAFLTGYLIEKA 87

Query: 59  LSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMN 116
           LS +N  +           + +Q R L WGIL A+  MR                     
Sbjct: 88  LSVDNIFVFVLIFSYFAVPAKYQHRVLFWGILGALI-MRGTMIAAGAA------------ 134

Query: 117 LAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
                       + +    I    G FL+   +    +   ++                 
Sbjct: 135 ------------LIKQFHWIIWVFGAFLIFTGIRMATSQHEEVEP--------------- 167

Query: 177 GIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH 236
                               N +             + G  FL         N V     
Sbjct: 168 ------------------DKNPVVRLFRRFMPISDRYDGQKFLTR------QNGVLMATP 203

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
            L + + +E  D   ++D + + FA+T++ FI+        + +R++    +  G+++ +
Sbjct: 204 LLLVLVMVETTDLIFAVDSIPAIFAVTQDPFIVYTSNVFAILGLRAL--YFVLAGVVHLF 261

Query: 297 KYLEHGSYYSIFVLSVIMFLQTI--------VDIPEIFTGTSSTILIFLSIYSSI 343
            YL+ G    +  + V M L  +          IP   +      +I +SI +S+
Sbjct: 262 HYLKLGLSVVLAFVGVKMLLPDVSAALIGTSWKIPTGISLGVVATIITVSIVASL 316


>gi|260062860|ref|YP_003195940.1| membrane protein, TerC family protein [Robiginitalea biformata
           HTCC2501]
 gi|88784428|gb|EAR15598.1| membrane protein, TerC family protein [Robiginitalea biformata
           HTCC2501]
          Length = 333

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 49/350 (14%), Positives = 104/350 (29%), Gaps = 74/350 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTIS------TVYICIILAVV 55
                         W  L           + W F+  +    +       +   I   ++
Sbjct: 23  NKTDHIIRSKEAAAWTSLWVSVALGFSGVVYWLFSEGMVDNPTGLTPGNAMLKYITGYLI 82

Query: 56  EISLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIE 113
           E+SLS +N  + A          I+Q R L WGIL A+    I+    +           
Sbjct: 83  ELSLSIDNVFVIAVIFSSFSIPPIYQHRVLFWGILGAIVFRGIMIIFGVA---------- 132

Query: 114 AMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLS 173
                          +      I    G FL+  +     + + +      L        
Sbjct: 133 ---------------LINKFDWIIYVFGVFLLYTAYKMLRSHEQEFDPKKSL-------- 169

Query: 174 KIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH 233
                                    ++  V          +G +F    +       +  
Sbjct: 170 -------------------------VFRQVKRIFPVTSRTHGHDFFIRRM------GIRA 198

Query: 234 GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
                   + +E+ D   +LD + +  AIT + F++     +  + +RSM    L   +L
Sbjct: 199 ATPLFVALVVIELTDILFALDSIPAILAITADPFLVFSSNILAILGLRSM--YFLISRML 256

Query: 294 NKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            K++++ +     +  + + M     V++PE  + +   + +   I +S+
Sbjct: 257 QKFRHINYSLVVILAFVGLKMLFAHQVEVPEWISLSVIVVSLATGILTSV 306


>gi|284990475|ref|YP_003409029.1| Integral membrane protein TerC [Geodermatophilus obscurus DSM
           43160]
 gi|284063720|gb|ADB74658.1| Integral membrane protein TerC [Geodermatophilus obscurus DSM
           43160]
          Length = 369

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 49/360 (13%), Positives = 103/360 (28%), Gaps = 91/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     W         L GL +      T +      ++       E SLS +
Sbjct: 28  RRPHEPSVKEASIWVSFYVTLALLFGLLLLSFTNGTYATEFYAGWLT------EYSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + +       Q+  L  GI+IA+  +R IF ++   ++              
Sbjct: 82  NLFVFVIIMARFRVPRHLQQEALMVGIIIAL-VLRGIFILLGAAVI-------------- 126

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +  + +    G FL+  ++    +  +                       
Sbjct: 127 ----------ERFIWVFYIFGAFLVYTAINLVRHRGDDED-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N     +         F G           + N        + +
Sbjct: 157 -------------YEENAFIRRMRRVLPMTDDFQGAKV------RVTQNGKKLWTPMVIV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           FL L   D   +LD + + F +T+  FI+        + +R +    L  G+L +  YL 
Sbjct: 198 FLALGTTDLLFALDSIPAIFGLTREPFIVFTANVFALMGLRQL--YFLLGGLLKRLVYLS 255

Query: 301 HGSYYSIFVLSVIMFLQTIVD-----------------IPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V + L+ + +                 IP   + +    ++ ++  +S+
Sbjct: 256 LGLAVILAFIGVKLILEALHENNLPFINGGEHVDAVPTIPIWLSLSIILGVLLVATVASL 315


>gi|167553268|ref|ZP_02347018.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168237926|ref|ZP_02662984.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194737550|ref|YP_002116181.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|194713052|gb|ACF92273.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197289061|gb|EDY28430.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|205322249|gb|EDZ10088.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|322613627|gb|EFY10568.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322621220|gb|EFY18078.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624283|gb|EFY21117.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627979|gb|EFY24768.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633097|gb|EFY29839.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636326|gb|EFY33034.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643501|gb|EFY40063.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647608|gb|EFY44096.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322648590|gb|EFY45037.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653642|gb|EFY49968.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657750|gb|EFY54018.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663851|gb|EFY60050.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669138|gb|EFY65289.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322672869|gb|EFY68976.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322678141|gb|EFY74204.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681317|gb|EFY77350.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322687753|gb|EFY83720.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195565|gb|EFZ80742.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199754|gb|EFZ84844.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202498|gb|EFZ87538.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208014|gb|EFZ92960.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212434|gb|EFZ97251.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215084|gb|EFZ99832.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323222814|gb|EGA07179.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323224105|gb|EGA08398.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230429|gb|EGA14547.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235219|gb|EGA19305.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239260|gb|EGA23310.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244382|gb|EGA28388.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323246999|gb|EGA30965.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254068|gb|EGA37888.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256175|gb|EGA39911.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262649|gb|EGA46205.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323267255|gb|EGA50739.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269343|gb|EGA52798.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 322

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 104/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+IL      L      W    T    ++       L   ++E SL
Sbjct: 30  RRGAHAMSMKQAAGWSILWVTLSLLFNAAFWWYLAETQGREVADPQALAFLTGYLIEKSL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G+L A   +R I       +++          
Sbjct: 90  AVDNVFVWLMLFSYFSVPPALQRRVLVYGVLGA-IVLRTIMIFAGTWLITQFE------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      +++                   
Sbjct: 142 -----------------WLLYVFGAFLLFTGVKMALAKEDESG----------------- 167

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    M  ++             +F          N + +    
Sbjct: 168 ----------------IGEKPMVRWLRGHLRMTDTIENEHFFVR------KNGLLYATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 206 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSGVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ +++ 
Sbjct: 264 MLKYGLAVILVFIGIKMLIVDFYHIPIAISLGVVFGILTITLV 306


>gi|296393349|ref|YP_003658233.1| integral membrane protein TerC [Segniliparus rotundus DSM 44985]
 gi|296180496|gb|ADG97402.1| Integral membrane protein TerC [Segniliparus rotundus DSM 44985]
          Length = 347

 Score =  150 bits (378), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 42/333 (12%), Positives = 98/333 (29%), Gaps = 50/333 (15%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S      W  +  +     G G+   ++   +      Y+       E+SLS +
Sbjct: 27  RKPHEPSAREAAVWCGVYVLLALAFGAGMAVWWSVGRATEFVAGYVT------ELSLSVD 80

Query: 63  NAILNAKNL--QKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    L   ++    Q++ L +G+ +A+   R +F  +   ++   +          
Sbjct: 81  NLFVFLLILNKGRVPREHQQKVLLFGVALALLA-RAVFIFLGSAVIGMFS---------- 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                               G +L+ V++      +          +         G K+
Sbjct: 130 --------------WTFYLFGAYLVYVAIRLAVQKEEPKEGAPPQLLPEEEHQLHGGGKM 175

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                      + +        ++ +      F+G             +           
Sbjct: 176 PPQAQEEPARESFVA-----RLLAKTLPTTSDFHGGRLFAR------EHGKLLATPLFAA 224

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + L   D   +LD + + + +T   +I+        + +  + L  L  G+L++  +L 
Sbjct: 225 LVTLGFTDVLFALDSIPAIYGLTSEAYIVFTANAFALMGL--LQLYFLVGGLLDRLVHLS 282

Query: 301 HGSYYSIFVLSVIMFLQTIV----DIPEIFTGT 329
            G    +  + V + L         +PEI T  
Sbjct: 283 KGLSAVLAFIGVKLILHAAHESGAHVPEISTPL 315


>gi|242089337|ref|XP_002440501.1| hypothetical protein SORBIDRAFT_09g002050 [Sorghum bicolor]
 gi|241945786|gb|EES18931.1| hypothetical protein SORBIDRAFT_09g002050 [Sorghum bicolor]
          Length = 380

 Score =  150 bits (378), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 42/321 (13%), Positives = 89/321 (27%), Gaps = 75/321 (23%)

Query: 27  CGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--SSIWQKRFLT 84
            G+ I  +     +      Y+      +E SLS +N  +     +       +Q R L+
Sbjct: 123 FGVSIALRDGAEKASEYFAGYL------LEQSLSVDNLFVFVLVFKYFQVPKEYQNRVLS 176

Query: 85  WGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFL 144
           +GI  AV   R +  I+    +     +  +   I                         
Sbjct: 177 YGIAGAV-VFRAVMIILGTATIQKFEAVNLLLALILL----------------------- 212

Query: 145 MMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVS 204
              S   F   + +                                   L  N +     
Sbjct: 213 -FTSYKLFAKEEEESD---------------------------------LSDNFIVKTCQ 238

Query: 205 SSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITK 264
                   + G  F          + +      L     +E+ D + ++D + + F +T+
Sbjct: 239 KFIPVTDYYDGDQFFI------IQDGLWKATPLLLTLAVIELSDIAFAIDSIPAVFGVTR 292

Query: 265 NFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTI-VDIP 323
           +  II+         +RS+   +L    + + +YL+      +  +   M        IP
Sbjct: 293 DPLIILSSNIFAIAGLRSL--YVLISESMGELEYLQPAIGIVLGFIGTKMTFDFFGYHIP 350

Query: 324 EIFTGTSSTILIFLSIYSSIK 344
              +    T  +   +  S++
Sbjct: 351 TEASLAIVTTCLSGGVILSLR 371


>gi|168262769|ref|ZP_02684742.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168463559|ref|ZP_02697476.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194443470|ref|YP_002042491.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194402133|gb|ACF62355.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|195633727|gb|EDX52141.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|205348598|gb|EDZ35229.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 322

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 103/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+IL      L      W    T    ++       L   ++E SL
Sbjct: 30  RRGAHAMSMKQAAGWSILWVTLSLLFNAAFWWYLAETQGREVADPQALAFLTGYLIEKSL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G+L A   +R I       +++          
Sbjct: 90  AVDNVFVWLMLFSYFSVPPALQRRVLVYGVLGA-IVLRTIMIFAGTWLITQFE------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      +++                   
Sbjct: 142 -----------------WLLYVFGAFLLFTGVKMALAKEDESG----------------- 167

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    M  ++              F          N + +    
Sbjct: 168 ----------------IGEKPMVRWLRGHLRMTDTIENERFFVR------KNGLLYATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 206 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSGVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ +++ 
Sbjct: 264 MLKYGLAVILVFIGIKMLIVDFYHIPIAISLGVVFGILTITLV 306


>gi|56415163|ref|YP_152238.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197364093|ref|YP_002143730.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56129420|gb|AAV78926.1| possible drug efflux protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095570|emb|CAR61135.1| possible drug efflux protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 322

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 46/343 (13%), Positives = 103/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+IL      L      W    T    ++       L   ++E SL
Sbjct: 30  RRGAHAMSMKQAAGWSILWVTLSLLFNAAFWWYLAETQGREVADPQALAFLTGYLIEKSL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G L A   +R I       +++          
Sbjct: 90  AVDNVFVWLMLFSYFSVPPTLQRRVLVYGALGA-IVLRTIMIFAGTWLITQFE------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      +++                   
Sbjct: 142 -----------------WLLYVFGAFLLFTGVKMALAKEDESG----------------- 167

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    M  ++             +F          N + +    
Sbjct: 168 ----------------ISEKPMVRWLRGHLRMTDTIENEHFFVR------KNGLLYATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E  DA  ++D + + FA+T N FI++       + +R+M    L  G+  ++ 
Sbjct: 206 LLVLIMVEFSDAIFAVDSIPAIFAVTTNPFIVLTSNLFAILGLRAM--YFLLSGVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ +++ 
Sbjct: 264 MLKYGLAVILVFIGIKMLIVDFYHIPIAISLGVVFGILTITLV 306


>gi|123443887|ref|YP_001007858.1| putative drug efflux protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090848|emb|CAL13730.1| putative drug efflux protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 328

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 48/343 (13%), Positives = 111/343 (32%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  S   +L     W+++      L   G  W  T T+   I+       L   ++E +L
Sbjct: 31  RRGSQTMTLRQAACWSLVWVSLSLLFNAGFWWYLTETMGREIADKQALAFLTGYLIEKAL 90

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +VS  +       
Sbjct: 91  AVDNVFVWLMLFSYFAVPANLQRRVLIYGVLGA-IVLRTIMIFAGSWLVSQFS------- 142

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      ++                    
Sbjct: 143 -----------------WILYLFGAFLLFTGIKMALAKEDN------------------- 166

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++ +        +G  F          N + +    
Sbjct: 167 --------------TPIGEKPLVRWIRNHLRMTDELHGDRFTVR------KNGLLYATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 207 VLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + V M +  +  IP   + +    ++ L++ 
Sbjct: 265 MLKYGLSVILVFIGVKMMIIDLFHIPIGISLSVVAGILALTLL 307


>gi|296533670|ref|ZP_06896225.1| TerC family membrane protein [Roseomonas cervicalis ATCC 49957]
 gi|296265997|gb|EFH12067.1| TerC family membrane protein [Roseomonas cervicalis ATCC 49957]
          Length = 346

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 44/354 (12%), Positives = 103/354 (29%), Gaps = 73/354 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTH------TLSGTISTVYICIILAVVE 56
             +           + +    G L G  + + F H            +   +     +VE
Sbjct: 41  RETREIGARESLVLSAVYIGLGLLFGGWVWYSFDHLRPPLEGALDGATAAQLYWTGFIVE 100

Query: 57  ISLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEA 114
            +L+ +N  + A          ++Q R L WGIL  V  +R +   +   IV        
Sbjct: 101 KTLAMDNVFVIAMIFGYFAVPRLYQHRVLFWGILG-VIVLRALMIGLGASIVQQFG---- 155

Query: 115 MNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSK 174
                                +      FL+   +  +  +                   
Sbjct: 156 --------------------WVLYLFAAFLIFTGVKMWRMAD------------------ 177

Query: 175 IKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHG 234
                              +  N + +F+          +G  F        +       
Sbjct: 178 ---------------AKPDIAGNPLLAFIRRRFRVTEELHGERFFIRRPDPQTGRAAWFM 222

Query: 235 KHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILN 294
                  + +E+ D   ++D V + FAIT + FI+        + +R++        +++
Sbjct: 223 TPLFLALILVEVADVIFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAAMVH 280

Query: 295 KYKYLEHGSYYSIFVLSVIMFLQTIV-----DIPEIFTGTSSTILIFLSIYSSI 343
           ++ YL++     +  +   +F+  ++      +P   +   +  ++   I  S+
Sbjct: 281 RFHYLKYALSLLLVFIGSKIFVADLLFPETGKVPPSLSLGVTFAILAAGIVWSL 334


>gi|16766523|ref|NP_462138.1| tellurite resistance protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|62181741|ref|YP_218158.1| putative resistance protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167990217|ref|ZP_02571317.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168243058|ref|ZP_02667990.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168819706|ref|ZP_02831706.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194449030|ref|YP_002047261.1| hypothetical protein SeHA_C3519 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197264853|ref|ZP_03164927.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198242140|ref|YP_002217205.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200388272|ref|ZP_03214884.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204928164|ref|ZP_03219364.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205354137|ref|YP_002227938.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207858481|ref|YP_002245132.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|224585027|ref|YP_002638826.1| drug efflux protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|238910026|ref|ZP_04653863.1| possible drug efflux protein [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|38604680|sp|Q8ZLX2|ALX_SALTY RecName: Full=Inner membrane protein alx
 gi|16421781|gb|AAL22097.1| putative resistance protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|62129374|gb|AAX67077.1| putative resistance protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|194407334|gb|ACF67553.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197243108|gb|EDY25728.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197936656|gb|ACH73989.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199605370|gb|EDZ03915.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204322486|gb|EDZ07683.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205273918|emb|CAR38921.1| possible drug efflux protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205331095|gb|EDZ17859.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205337891|gb|EDZ24655.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205343369|gb|EDZ30133.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|206710284|emb|CAR34642.1| possible drug efflux protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224469555|gb|ACN47385.1| possible drug efflux protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261248391|emb|CBG26228.1| possible drug efflux protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995422|gb|ACY90307.1| putative tellurite resistance protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159776|emb|CBW19295.1| possible drug efflux protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914251|dbj|BAJ38225.1| putative drug efflux protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320087678|emb|CBY97442.1| Inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321225907|gb|EFX50961.1| Integral membrane protein TerC [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322716227|gb|EFZ07798.1| putative tellurite resistance protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323131584|gb|ADX19014.1| putative tellurite resistance protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|326624981|gb|EGE31326.1| putative tellurite resistance protein [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 322

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 103/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+IL      L      W    T    ++       L   ++E SL
Sbjct: 30  RRGAHAMSMKQAAGWSILWVTLSLLFNAAFWWYLAETQGREVADPQALAFLTGYLIEKSL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G+L A   +R I       +++          
Sbjct: 90  AVDNVFVWLMLFSYFSVPPALQRRVLVYGVLGA-IVLRTIMIFAGTWLITQFE------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      +++                   
Sbjct: 142 -----------------WLLYVFGAFLLFTGVKMALAKEDESG----------------- 167

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    M  ++             +F          N + +    
Sbjct: 168 ----------------IGEKPMVRWLRGHLRMTDTIENEHFFVR------KNGLLYATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E  D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 206 LLVLIMVEFSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSGVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ +++ 
Sbjct: 264 MLKYGLAVILVFIGIKMLIVDFYHIPIAISLGVVFGILTITLV 306


>gi|148273952|ref|YP_001223513.1| putative exporter [Clavibacter michiganensis subsp. michiganensis
           NCPPB 382]
 gi|147831882|emb|CAN02852.1| conserved membrane protein, putative exporter [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
          Length = 342

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 46/360 (12%), Positives = 96/360 (26%), Gaps = 92/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 ++    RW+        + G+GIG+       G     Y+       E +LS +
Sbjct: 28  RKPHEPTIGESARWSAFYIGLALIFGVGIGFTSGWDFGGQYFAGYLT------EKALSID 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI+IA+  MR  F  +                   
Sbjct: 82  NLFVFLLIMTGFAVPRKYQQKVLMIGIVIALI-MRAGFIALGAA---------------- 124

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    +    G  L +++                                
Sbjct: 125 --------LIENFSWVFYIFGALLFVLAYQQLKGDH------------------------ 152

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N               F G  F   +      +        L  
Sbjct: 153 ----------GGNAADNMFVRIARRILPVHDEFVGDRFTTKI------DGKRFVTPLLLC 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +  +D   +LD + + + +T   +I+        + +R +    L  G+L +  YL 
Sbjct: 197 VIAIGFVDLVFALDSIPAIYGLTNEAYIVFTANAFALMGLRQL--YFLIGGLLERLVYLS 254

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  +   + L  +                  +IP  F+       I ++  +S+
Sbjct: 255 QGLAVILAFIGAKLVLHAMHVNELPFINGGEPMLWAPEIPIWFSLLFIGATITVATVASL 314


>gi|297741505|emb|CBI32637.3| unnamed protein product [Vitis vinifera]
          Length = 365

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 43/341 (12%), Positives = 103/341 (30%), Gaps = 75/341 (21%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           + +   R   L      + G+G+G++     +      Y+      +E SLS +N  +  
Sbjct: 95  TYVSSIRTVALWVCMAVIFGVGVGFKDGVGKASEFFAGYL------LEQSLSVDNLFVFV 148

Query: 69  KNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYL 126
              +     +++Q R L++GI  A+   R+   ++    +                    
Sbjct: 149 LIFKYFQVPTMYQGRVLSYGIAGAII-FRLSLILLGTATL-------------------- 187

Query: 127 KIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSI 186
               Q    ++      L+  S   F   +++                            
Sbjct: 188 ----QRFEAVNLLFAAILLFSSFKLFAADEDETD-------------------------- 217

Query: 187 IFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEI 246
                  L  N +             + G  F+         + V      L   + +E+
Sbjct: 218 -------LSNNFVVKTCQKFIPVTANYDGNLFVT------IQDGVWKATPLLLTVVVIEL 264

Query: 247 IDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYS 306
            D + ++D + + F +T++ FI+        + +RS+    L    +++ +YL+      
Sbjct: 265 SDIAFAVDSIPAVFGVTRDPFIVFTSNLFAILGLRSL--YTLISESMSELEYLQPSIGVV 322

Query: 307 IFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIKNK 346
           +  +   M        +    +       +   +  S+  K
Sbjct: 323 LGFIGCKMISDFFGFHVSTEASLGFVATSLGAGVLLSLMKK 363


>gi|315498126|ref|YP_004086930.1| integral membrane protein terc [Asticcacaulis excentricus CB 48]
 gi|315416138|gb|ADU12779.1| Integral membrane protein TerC [Asticcacaulis excentricus CB 48]
          Length = 327

 Score =  149 bits (377), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 47/348 (13%), Positives = 97/348 (27%), Gaps = 71/348 (20%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +   +   S+      +          G  + W           T +I       E +L+
Sbjct: 35  LHRKTHEVSIRESLWMSAFYIAIALAFGGWVWWSLGDQAGKEYLTGFIV------EKTLA 88

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + +          ++Q R L WGIL  V  +R I   +   +VS           
Sbjct: 89  LDNVFVISLIFTYFAIPPLYQHRVLFWGILG-VIVLRGIMIALGATLVSQ---------- 137

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                         +  +      FL+   +   F                         
Sbjct: 138 --------------YSWVLYVFAVFLIFTGIKMLFVGDKHPD------------------ 165

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N +   +           G  FL       +    T+    L
Sbjct: 166 ---------------IGNNPLLKLMRRIFPISAGLDGQKFLTRQPDPKTGKWRTYATPLL 210

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
                +E +D   ++D V + F IT + FI+        + +R++        I+++++Y
Sbjct: 211 VALALIEFVDLIFAVDSVPAIFTITLDPFIVFTSNIFAILGLRAL--YFALAAIIHRFRY 268

Query: 299 LEHGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSIYSSI 343
           L+      +  +    F+     +   P   +   +  LI   +  S+
Sbjct: 269 LKPALAIVLIFIGSKTFIADAMGLEKFPSNISLGVTLGLIAAGVLISL 316


>gi|227542320|ref|ZP_03972369.1| tellurium resistance protein [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227181920|gb|EEI62892.1| tellurium resistance protein [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 360

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 47/359 (13%), Positives = 105/359 (29%), Gaps = 87/359 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            +    S+     W         L  + + + +TH  +      YI       E+SLS +
Sbjct: 28  KSPHEPSMKEAGGWMAFYMSLAGLFTIFLWFIWTHEHALEFFNGYIT------ELSLSID 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A  +        +Q++ L  GI +A+  MR+IF ++    ++             
Sbjct: 82  NLFIFALIIGSFKIPRAYQQKVLLIGIALAL-AMRLIFILLGAAAIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   +    G FL+  ++    +                          
Sbjct: 128 -----------AWSWVFYIFGAFLLYTAVKLVVDEVKGEED------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                        +    +             F+G +           N        +  
Sbjct: 158 -----------TNIDDMFVVKTARKVIPVSSHFHGDHLFTV------ENGKKMVTPLMLA 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +  ID   + D + + F +T+  +I+        + +R M    L  G+L +  YL 
Sbjct: 201 LISIGFIDLMFAFDSIPAIFGLTQEPYIVFAANAFALMGLRQM--FFLLDGLLERLVYLP 258

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + + + L  +                 +I  I +      ++ ++  +S+
Sbjct: 259 YGLATILAFIGIKLVLHALHENKLPFINGGEGVSVPEIGNITSLFVIVGVLAITAIASV 317


>gi|330469188|ref|YP_004406931.1| integral membrane protein terc [Verrucosispora maris AB-18-032]
 gi|328812159|gb|AEB46331.1| integral membrane protein terc [Verrucosispora maris AB-18-032]
          Length = 332

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 44/362 (12%), Positives = 106/362 (29%), Gaps = 90/362 (24%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+     W         L G+G+      +++G   T ++       E SLS
Sbjct: 26  IGRRPHEPSVRESSLWVAFYVGLALLFGVGLWLTAGGSVAGQFYTGWLT------EYSLS 79

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + +      +Q++ L  GI++A+  MR  F  +   ++S  +        
Sbjct: 80  VDNLFVFMIIMARFAVPRQYQQKVLLVGIVLALI-MRGGFIALGAALISQFS-------- 130

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL+  ++      ++                     
Sbjct: 131 ----------------WVFYIFGAFLIYTAINLARQGESAED------------------ 156

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N +  +   +      +                        L
Sbjct: 157 --------------EFQENVLIRWSRRALPISRGYDAARLTTR------EQGRRMFTPML 196

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + +   D   +LD + + F IT   +++        + +R +    L  G+L++  Y
Sbjct: 197 IVMIAIGTTDLLFALDSIPAIFGITHEPYLVFTANVFALMGLRQL--YFLLGGLLSRLIY 254

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYS 341
           L +G    +  + V + L+ +                   IP   +  +   ++ ++  +
Sbjct: 255 LSYGLAVVLGFIGVKLILEALAENSLFFLNGGQPVGWAPHIPIWLSLLAIVGILAVATVA 314

Query: 342 SI 343
           S+
Sbjct: 315 SL 316


>gi|161506212|ref|YP_001573324.1| hypothetical protein SARI_04404 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867559|gb|ABX24182.1| hypothetical protein SARI_04404 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 322

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 45/343 (13%), Positives = 103/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+IL      L      W    T    ++       L   ++E SL
Sbjct: 30  RRGAHAMSMKQAAGWSILWVTLSLLFNAAFWWYLAETQGREVADPQALAFLTGYLIEKSL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G+L A   +R I       +++          
Sbjct: 90  AVDNVFVWLMLFSYFSVPPALQRRVLVYGVLGA-IVLRTIMIFAGTWLIAQFE------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      ++K                   
Sbjct: 142 -----------------WLLYVFGAFLLFTGVKMALAKEDKSG----------------- 167

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    M  ++             +F          N + +    
Sbjct: 168 ----------------IGEKPMVRWLRGHLRMTDTIENEHFFVR------KNGLLYATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E  D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 206 LLVLIMVEFSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSGVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ +++ 
Sbjct: 264 MLKYGLAVILVFIGIKMLIVDFYHIPIAVSLGVVFGILTITLV 306


>gi|217968720|ref|YP_002353954.1| integral membrane protein TerC [Thauera sp. MZ1T]
 gi|217506047|gb|ACK53058.1| Integral membrane protein TerC [Thauera sp. MZ1T]
          Length = 320

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 51/345 (14%), Positives = 111/345 (32%), Gaps = 70/345 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLS 60
                 SL     W++       L   G+ W    TL   ++       +   +VE SL+
Sbjct: 31  GKQHRVSLKEAAGWSLAWVTVAMLFAAGLWWYLDGTLGRALANEQATAFVTGYLVEKSLA 90

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +              Q+R L +GI+ A   +R I       +++           
Sbjct: 91  VDNVFVWMMIFSFFAVPLELQRRVLLYGIVGA-IVLRTIMIFAGSWLIN----------- 138

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL++  +   + S++                     
Sbjct: 139 -------------EFHWLLYVFGAFLIVTGIKMAWFSEHDPD------------------ 167

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +  ++ +         G  F          + V       
Sbjct: 168 ---------------LEKNPLIRWIRNHYPVTEKLEGERFFVMR------DGVRMMTPLF 206

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +EI D   ++D + + FAIT + FI++       + +R+M    L   + ++++ 
Sbjct: 207 LALVLVEISDVIFAVDSIPAIFAITTDPFIVLTSNLFAILGLRAM--YFLLADLGDRFEL 264

Query: 299 LEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L++G    +  +   M +   V IP + + +    ++  S+++S+
Sbjct: 265 LKYGLAAILVFIGTKMLIVEWVKIPVLVSLSVVATILACSVFASL 309


>gi|326629257|gb|EGE35600.1| putative tellurite resistance protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 323

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 103/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+IL      L      W    T    ++       L   ++E SL
Sbjct: 31  RRGAHAMSMKQAAGWSILWVTLSLLFNAAFWWYLAETQGREVADPQALAFLTGYLIEKSL 90

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G+L A   +R I       +++          
Sbjct: 91  AVDNVFVWLMLFSYFSVPPALQRRVLVYGVLGA-IVLRTIMIFAGTWLITQFE------- 142

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      +++                   
Sbjct: 143 -----------------WLLYVFGAFLLFTGVKMALAKEDESG----------------- 168

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    M  ++             +F          N + +    
Sbjct: 169 ----------------IGEKPMVRWLRGHLRMTDTIENEHFFVR------KNGLLYATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E  D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 207 LLVLIMVEFSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSGVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ +++ 
Sbjct: 265 MLKYGLAVILVFIGIKMLIVDFYHIPIAISLGVVFGILTITLV 307


>gi|254822661|ref|ZP_05227662.1| putative TerC family integral membrane protein [Mycobacterium
           intracellulare ATCC 13950]
          Length = 409

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 39/321 (12%), Positives = 93/321 (28%), Gaps = 73/321 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   +L     W+++      L G+G+     H         Y+       E +LS +
Sbjct: 28  RKAHAPTLREAALWSVVYVGIALLFGVGLLAFGGHEEGPEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ ++   R  F  +   +++             
Sbjct: 82  NLFVFLMIMASFRVPREDQQKVLLFGIVFSLIA-RTGFIFLGATLIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G  L++ +       + +                      
Sbjct: 128 -----------TFAWVFYLFGLILLLAAGGVLRPDEREESRK------------------ 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +             + G      V      +        L +
Sbjct: 159 --------------ADNVVIRIAKKVLHTTEHYDGDRLFTMV------DGRRAMTPMLLV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+N +I+        + +R +    L +G+L++  YL 
Sbjct: 199 MVAIGGTDIFFALDSIPAIFGLTQNVYIVFTATAFSLLGLRQL--YFLIEGLLDRLVYLS 256

Query: 301 HGSYYSIFVLSVIMFLQTIVD 321
           +G    +  + V + L  + +
Sbjct: 257 YGLGAILGFIGVKLILHALHE 277


>gi|239942874|ref|ZP_04694811.1| putative integral membrane export protein [Streptomyces roseosporus
           NRRL 15998]
 gi|239989334|ref|ZP_04709998.1| putative integral membrane export protein [Streptomyces roseosporus
           NRRL 11379]
 gi|291446347|ref|ZP_06585737.1| integral membrane protein TerC [Streptomyces roseosporus NRRL
           15998]
 gi|291349294|gb|EFE76198.1| integral membrane protein TerC [Streptomyces roseosporus NRRL
           15998]
          Length = 325

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 47/353 (13%), Positives = 101/353 (28%), Gaps = 82/353 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ L      + G  +      T     +T ++      +E SLS +
Sbjct: 27  RKAHVIGFKEAGLWSALWVGLALIFGGVVFLTLGTTAGTEYTTAWL------LEKSLSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G++ A+   R +F    V +V+             
Sbjct: 81  NLFVFALIFAYFKVPREYQHRVLFFGVIGAL-VFRALFLTAGVAVVNRFTF--------- 130

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +       L   S       +                        
Sbjct: 131 ---------------VLFLFAAILFYSSYKILSGQEENFDPGKSF--------------- 160

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                                 +         + G +F+                  L +
Sbjct: 161 ------------------AVRLLRKIMPVQDEYSGTHFVVH------KEGRRIATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
              +E  D   ++D V +  A++ + FI+        + +R++    L  G+L+++ YL 
Sbjct: 197 VAAIEAADLIFAVDSVPAVLAVSDDLFIVYTSNAFAILGLRAL--YFLLAGLLDRFHYLS 254

Query: 301 HGSYYSIFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSIKN 345
           HG    +  ++V + LQ           +IP   +     +++ +S+  S++ 
Sbjct: 255 HGLAIILAFIAVKLVLQACHKMISTSIPEIPSPISLAVIVVILAVSVTLSMRR 307


>gi|296139486|ref|YP_003646729.1| integral membrane protein TerC [Tsukamurella paurometabola DSM
           20162]
 gi|296027620|gb|ADG78390.1| Integral membrane protein TerC [Tsukamurella paurometabola DSM
           20162]
          Length = 332

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 47/356 (13%), Positives = 106/356 (29%), Gaps = 83/356 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +L     W  +      + G+G+         G     ++       E +LS +
Sbjct: 28  RTPHEPTLKESGFWTAVYIGLAVVFGIGVWVVSGPQYGGEFFAGFVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + K     I+Q++ L  GI++A+  MR IF  +    +S             
Sbjct: 82  NLFVFVIIMAKFAVPKIYQQKVLLIGIVMAL-VMRGIFIAVGAAAIS------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   +    G FL+  +      +                         
Sbjct: 128 -----------AFSWVFYLFGIFLLYTAYKLVKEAAEGP--------------------- 155

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           + + +           + G   +  +      +        L  
Sbjct: 156 --------VEDEEKRESRVAALFKKVVPTTDQYDGDKLVTKI------DGKKVATPLLLA 201

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   + D + + + +T+  +++ +      + +R +    L  G+L +  YL 
Sbjct: 202 LVVIGFTDLLFAFDSIPAIYGLTQEPYLVFMANAFALMGLRQL--YFLIGGLLGRLVYLS 259

Query: 301 HGSYYSIFVLSVIMFLQTIVD-------------IPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  + +             +PEI TG S  ++I +   ++I
Sbjct: 260 YGLSIVLGFIGVKLVLHALHENTLPFINGGEHVAVPEISTGLSLAVIIGVLAVTTI 315


>gi|126173791|ref|YP_001049940.1| integral membrane protein TerC [Shewanella baltica OS155]
 gi|125996996|gb|ABN61071.1| Integral membrane protein TerC [Shewanella baltica OS155]
          Length = 328

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 50/352 (14%), Positives = 107/352 (30%), Gaps = 76/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       ++    + +      G L G  + W    T      T Y+       E SLS
Sbjct: 34  LHKEQHEITVAESLKLSAFYICMGLLFGAWLWWYKGSTAGMEYLTGYLI------EKSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A     +    ++Q R L WGIL  V  +R I   +   +V+           
Sbjct: 88  MDNVFVIALIFSSLGIPRLYQHRVLFWGILG-VIVLRAIMIGLGAVLVAQ---------- 136

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                         +  +    G FL+   +   F++                       
Sbjct: 137 --------------YQGVLVLFGLFLIFTGVKMLFSNDEHSD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N+ Y ++ +        +   F         S          
Sbjct: 165 ---------------IQDNKFYKWLRTKMRFTPTLHKEKFWVRGEDHQLSKG-WWATPLF 208

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E  D   ++D + + FAIT++ FI+        + +R++        ++++++Y
Sbjct: 209 LALILVETADLVFAVDSIPAIFAITQDPFIVYTSNIFAILGLRAL--YFALAAMVHRFEY 266

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD-------IPEIFTGTSSTILIFLSIYSSI 343
           L++     +  + V + L            IP   +   +  L+   +  S+
Sbjct: 267 LKYALSVVLVFIGVKVGLVYFNHEGIVDFTIPTALSLGVTFGLLVAGVLYSL 318


>gi|317049687|ref|YP_004117335.1| Integral membrane protein TerC [Pantoea sp. At-9b]
 gi|316951304|gb|ADU70779.1| Integral membrane protein TerC [Pantoea sp. At-9b]
          Length = 323

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 45/343 (13%), Positives = 105/343 (30%), Gaps = 69/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S      W+++      L      W    T+   ++T      L   ++E +L
Sbjct: 30  RRGAQTMSFKQAAIWSLVWVSLSLLFSAAFWWYLNGTVGREVATAQTLAFLTGYILEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +V+  +       
Sbjct: 90  AVDNVFVWLMLFSYFAIPAQLQRRVLVYGVLGA-IVLRTIMIFGGSWLVTQFS------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   L      ++                    
Sbjct: 142 -----------------WILYLFGAFLLFTGLKMALAKEDDD------------------ 166

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                         + +    +  ++           G  F          N V      
Sbjct: 167 --------------SAVGDKPLVRWLRKHLRMTDSLEGEKFFTR------KNGVLFATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 207 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +     +++  ++ 
Sbjct: 265 MLKYGLAIVLVFIGIKMLIVEFWHIPVGVSLAVVGVILGGTLL 307


>gi|238799368|ref|ZP_04642805.1| Inner membrane protein alx [Yersinia mollaretii ATCC 43969]
 gi|238716781|gb|EEQ08660.1| Inner membrane protein alx [Yersinia mollaretii ATCC 43969]
          Length = 331

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 46/343 (13%), Positives = 108/343 (31%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  S   +L     W+++      L   G  W    T+   ++       L   ++E +L
Sbjct: 31  RRGSQTMTLRQAACWSLVWVSLSLLFNAGFWWYLAETVGREVADKQALAFLTGYLIEKAL 90

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +VS  +       
Sbjct: 91  AVDNVFVWLMLFSYFAVPANLQRRVLIYGVLGA-IVLRTIMIFAGSWLVSQFS------- 142

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      ++                    
Sbjct: 143 -----------------WILYLFGAFLLFTGIKMALAKEDD------------------- 166

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++ +        +G  F          N + +    
Sbjct: 167 --------------TPIGEKPLVRWIRNHLRMTDELHGDRFTVR------KNGLLYATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 207 VLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLASVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  +   M L  +  IP   +      ++ L++ 
Sbjct: 265 MLKYGLSVILVFIGTKMMLIDLFHIPIGISLGVVAGILALTLL 307


>gi|168231831|ref|ZP_02656889.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194471158|ref|ZP_03077142.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194457522|gb|EDX46361.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205333736|gb|EDZ20500.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 322

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 104/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+IL      L      W    T    ++       L   ++E SL
Sbjct: 30  RRGAHAMSMKQAAGWSILWVTLSLLFNAAFWWYLAETQGREVADPQALAFLTGYLIEKSL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +            + Q+R L +G+L A   +R I       +++          
Sbjct: 90  AVDNVFVWLMLFSYFSVPPVLQRRVLVYGVLGA-IVLRTIMIFAGTWLITQFE------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      +++                   
Sbjct: 142 -----------------WLLYVFGAFLLFTGVKMALAKEDESG----------------- 167

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    M  ++             +F          N + +    
Sbjct: 168 ----------------IGEKPMVRWLRGHLRMTDTIENEHFFVR------KNGLLYATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E  D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 206 LLVLIMVEFSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSGVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ +++ 
Sbjct: 264 MLKYGLAVILVFIGIKMLIVDFYHIPIAISLGVVFGILTITLV 306


>gi|227488682|ref|ZP_03918998.1| tellurium resistance protein [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227091343|gb|EEI26655.1| tellurium resistance protein [Corynebacterium glucuronolyticum ATCC
           51867]
          Length = 360

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 47/359 (13%), Positives = 105/359 (29%), Gaps = 87/359 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            +    S+     W         L  + + + +TH  +      YI       E+SLS +
Sbjct: 28  KSPHEPSMKEAGGWMAFYMSLAGLFTIFLWFIWTHEHALEFFNGYIT------ELSLSID 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A  +        +Q++ L  GI +A+  MR+IF ++    ++             
Sbjct: 82  NLFIFALIIGSFKIPRAYQQKVLLIGIALAL-AMRLIFILLGAAAIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A   +    G FL+  ++    +                          
Sbjct: 128 -----------AWSWVFYIFGAFLLYTAVKLVVDEVKGEED------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                        +    +             F+G +           N        +  
Sbjct: 158 -----------TNIDDMFVVKTARKVIPVSSHFHGDHLFTV------ENGKKMVTPLMLA 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +  ID   + D + + F +T+  +I+        + +R M    L  G+L +  YL 
Sbjct: 201 LISIGFIDLMFAFDSIPAIFGLTQEPYIVFATNAFALMGLRQM--FFLLDGLLERLVYLP 258

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + + + L  +                 +I  I +      ++ ++  +S+
Sbjct: 259 YGLATILAFIGIKLVLHALHENKLPFINGGEGVSVPEIGNITSLFVIVGVLAITAIASV 317


>gi|256379517|ref|YP_003103177.1| integral membrane protein TerC [Actinosynnema mirum DSM 43827]
 gi|255923820|gb|ACU39331.1| Integral membrane protein TerC [Actinosynnema mirum DSM 43827]
          Length = 330

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 52/361 (14%), Positives = 99/361 (27%), Gaps = 90/361 (24%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +  +    SL    RW +       L G GI +    T +G     YI       E SLS
Sbjct: 26  VDRHPHEVSLAEAGRWVVFYVAMAVLFGAGIWYFEGGTPAGEFFAGYIT------EYSLS 79

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    +      +I Q + L  GIL+A+  +R  F                    
Sbjct: 80  VDNLFIFLIIMTTFKVPAIHQHKVLLIGILMAL-VLRGGFIAAGAA-------------- 124

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                     + +    +    G FL+                                 
Sbjct: 125 ----------LIERFSAVFYLFGAFLIYTGYKLARGEDEDEE------------------ 156

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N     V         ++G      +      +   H     
Sbjct: 157 ---------------FKENAGLRMVRRVLPVTDEYHGSKSFTRI------DGKRHVTPMF 195

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + +   D   +LD + + F +TK  F++        + +R +    L  G+L K  Y
Sbjct: 196 IVMIAIGSTDLLFALDSIPAIFGLTKEPFLVFTANAFALMGLRQL--YFLLGGLLAKLVY 253

Query: 299 LEHGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSS 342
           L  G    +  + V + L+ +                  I    + +    ++ ++  +S
Sbjct: 254 LSIGLSVILGFIGVKLILEALHTNSLPFLNGGEPFGVPTIGIGLSLSVIVGVLVITTVAS 313

Query: 343 I 343
           +
Sbjct: 314 L 314


>gi|284991354|ref|YP_003409908.1| Integral membrane protein TerC [Geodermatophilus obscurus DSM
           43160]
 gi|284064599|gb|ADB75537.1| Integral membrane protein TerC [Geodermatophilus obscurus DSM
           43160]
          Length = 337

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 44/348 (12%), Positives = 97/348 (27%), Gaps = 82/348 (23%)

Query: 6   LYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAI 65
                     W++         G+     +           Y+       E SLS +N  
Sbjct: 32  HRVGFREATAWSVFYIAVAVAFGVWFTVAYGGGPGTEYFAGYVV------EKSLSVDNLF 85

Query: 66  LNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQ 123
           +    +         Q R LT+GI++A+  MR IF  +   ++S  + +  +   +    
Sbjct: 86  VFVIIMTTFSVPEEHQHRALTFGIVLALI-MRAIFIALGATLLSLFSFMFLLFGLLL--- 141

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV 183
                                +  ++  F +                             
Sbjct: 142 ---------------------IYTAVQLFRHRDEDPD----------------------- 157

Query: 184 LSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLY 243
                     +  N M             + G      V                 + + 
Sbjct: 158 ----------IEDNAMVKAARRFLPVTPDYVGGRLTTRV------QGRRMVTPLFVVLIA 201

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           +  ID   +LD + + F +T   +I+        + +R++    L +G+L++  YL  G 
Sbjct: 202 IGSIDLLFALDSIPAVFGVTSEPYIVFTANAFALLGLRAL--FFLVKGLLDRLVYLSAGL 259

Query: 304 YYSIFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSI 343
              +  + V + L            +IP   +     +++ +   +S+
Sbjct: 260 AIILAFIGVKLILHWAHVDIDPRVPEIPTPLSLGVIVVVLAVVTVASL 307


>gi|229491586|ref|ZP_04385407.1| tellurium resistance protein TerC [Rhodococcus erythropolis SK121]
 gi|229321267|gb|EEN87067.1| tellurium resistance protein TerC [Rhodococcus erythropolis SK121]
          Length = 361

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 47/352 (13%), Positives = 97/352 (27%), Gaps = 82/352 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +          W+ L      +  + +            +T ++      +E SLS +
Sbjct: 27  RGAHVIGFKEAAWWSALWVGLSLVFAVVVTLTLGVNSGVEFTTAWL------LEKSLSVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G++ A+   R IF    V +VS             
Sbjct: 81  NLFVFALIFGYFKVPREYQHRVLFFGVIGALI-FRGIFLAAGVAVVSKFT---------- 129

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +       L+  +     +          L               
Sbjct: 130 --------------AVLFVFAAILLYSAYKLLKDDDENFDPGTSL--------------- 160

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                                 +         + G  F                     +
Sbjct: 161 ------------------AVRLLRKIMPVREEYAGTKFFV------KEAGKRVATPLFAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E  D   ++D V +  A++ + FI+        + +R++    L  G+L K+ YL 
Sbjct: 197 VVAIEAADLVFAVDSVPAVLAVSDDPFIVYSSNAFAILGLRAL--YFLLSGLLEKFHYLS 254

Query: 301 HGSYYSIFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSIK 344
            G    +  + V + +Q           +IP + +     +++  SI  S+K
Sbjct: 255 KGLSIILAFIGVKLIMQASHKVISTSIPEIPSLVSLAVIIVVLAGSIILSLK 306


>gi|253699602|ref|YP_003020791.1| integral membrane protein TerC [Geobacter sp. M21]
 gi|251774452|gb|ACT17033.1| Integral membrane protein TerC [Geobacter sp. M21]
          Length = 306

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 51/344 (14%), Positives = 100/344 (29%), Gaps = 74/344 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
              S          W  +          GI +      +    T Y+       E SLS 
Sbjct: 27  NRKSHEIKFREALAWTCVWVGLAMAFNAGIWYFMGPAKALEFFTGYLI------EESLSV 80

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  +          S   Q + L WGI+ A+  MR IF ++ +                
Sbjct: 81  DNLFVFIMIFSYFKISKAQQPKILKWGIIGAL-VMRGIFILVGI---------------- 123

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                    + +    +    G  L+   +   F   +++                    
Sbjct: 124 --------ELIERFHWMIYIFGGILIYTGIKMAFGGDDEVEP------------------ 157

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                            N +   V          +G  F          + V        
Sbjct: 158 ---------------EKNPLVRLVRRFMPITKRTWGDRFFIKR------HGVWAATPLFL 196

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + +E  D   ++D + +  A+T + FI+        + +RS+    L   ++  + YL
Sbjct: 197 TLVVVESSDVIFAVDSIPAVLAVTHDPFIVYSSNVFAIMGLRSL--YYLLAHVMEMFVYL 254

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + G  + +  +   M L  +V+IP   +       + +SI +S+
Sbjct: 255 KLGVSFILAFVGAKMLLVDVVEIPLQLSLGFIIGTLVISILTSV 298


>gi|317403907|gb|EFV84377.1| integral membrane protein TerC [Achromobacter xylosoxidans C54]
          Length = 332

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 53/346 (15%), Positives = 105/346 (30%), Gaps = 69/346 (19%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +        +      +     A  L G  + WQ          T ++       E SLS
Sbjct: 38  LHKEDREIGVRESLLLSAGYISAALLFGGWVWWQMGPASGMAYYTGFLI------EKSLS 91

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A           +Q R L WGIL  V  +R I   +   +VS           
Sbjct: 92  LDNVFVIALIFSFFAIPRQFQHRVLFWGILG-VIVLRAIMIGLGAALVSNFG-------- 142

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL+   +  +  +  +                    
Sbjct: 143 ----------------WLMYLFGAFLVFTGIKMWMIADQEPD------------------ 168

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          + TN +  F+           G  F      + +   V       
Sbjct: 169 ---------------IATNPILKFLKRRMRVTDGLRGNAFWVREPDAATGKTVRWATPLF 213

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E +D   ++D V + FAIT + FI+        + +R++        +++++ Y
Sbjct: 214 LALVLIEFVDLLFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAAMIHRFHY 271

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSSTILIFLSIYSSI 343
           L++     +  +   +FL   +  IP + + + +  LI   +  S+
Sbjct: 272 LKYALSLVLVFIGTKIFLVGFIGKIPAVVSLSVTFGLIGGGVLFSL 317


>gi|170742494|ref|YP_001771149.1| integral membrane protein TerC [Methylobacterium sp. 4-46]
 gi|168196768|gb|ACA18715.1| Integral membrane protein TerC [Methylobacterium sp. 4-46]
          Length = 341

 Score =  149 bits (375), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 45/347 (12%), Positives = 96/347 (27%), Gaps = 69/347 (19%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
           + ++    +             G L G  I W              +       E SLS 
Sbjct: 37  RDSNREIGVKESLLLTAFYLSLGLLFGGWIWWYLGPQAGQEYIAGLVV------EKSLSM 90

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  + A     +    + Q R L WGIL A   +R +   +   +V             
Sbjct: 91  DNVFVIAVIFGFLGIPRVAQHRVLLWGIL-AAVLLRGLMIGLGAALV------------- 136

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                           +  F   FL+       F+   +                     
Sbjct: 137 -----------HEAEWVLTFFAAFLIYAGARMLFSGAEEDDEGE---------------- 169

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                            N   +F+          +G  F   +    +   V        
Sbjct: 170 ---------------TANRFAAFMRCRFRVTPDLHGHRFTVRLPDPKTGRMVRWFTPLAL 214

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + +   D   ++D V + FAIT + +++        + +R++        +++++ YL
Sbjct: 215 ALVLVNGADVIFAVDSVPAIFAITTDTYVVYTSNIFAILGLRAL--YFALAAMVDRFAYL 272

Query: 300 EHGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSIYSSI 343
           +      +  +   + +      +DI    +   +  L+ + I  S+
Sbjct: 273 KTALALILIFIGTKIVVADTFGWIDIEPWVSLVVTVSLLAVGIAYSL 319


>gi|50086606|ref|YP_048116.1| hypothetical protein ACIAD3666 [Acinetobacter sp. ADP1]
 gi|49532580|emb|CAG70294.1| conserved hypothetical protein; putative membrane protein
           [Acinetobacter sp. ADP1]
          Length = 326

 Score =  149 bits (375), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 54/348 (15%), Positives = 112/348 (32%), Gaps = 69/348 (19%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  S    +     W+I       L   G+     HT +  I+       LA  ++E SL
Sbjct: 37  QKKSDDVPIRQALIWSIAWVTVAMLFAGGLWLYLQHTATLAIANQKTMEYLAGYLLEKSL 96

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q++ L +G+L A   +R IF  +    V           
Sbjct: 97  AIDNVFVWLMIFAAFAVPAGLQRKILLYGVLGA-IVLRSIFIFIGAWFV----------- 144

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                        Q    +    G FL+     F      +                   
Sbjct: 145 -------------QEFSWVLYIFGAFLVYTGFKFLKGQGEED------------------ 173

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +   ++  ++ S       F+G  F          N V      
Sbjct: 174 --------------PNIEDMKLLKWLRSRMRITQSFHGDRFFV------KENGVLWATPL 213

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
             + + +E  D   ++D + + FA+T + FI++    +  + +R+M    L  G  +K  
Sbjct: 214 FIVLILVEFSDVIFAVDSIPAIFAVTTDPFIVLTANLMAILGLRAM--FFLLAGAASKMH 271

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           YL +G    +  +   M +  +  +P   +     I++ ++ + S+++
Sbjct: 272 YLPYGLGIILVFIGFKMLMLDVFHMPIWVSLGFIVIVLGITAWLSVRH 319


>gi|325963173|ref|YP_004241079.1| membrane protein TerC, possibly involved in tellurium resistance
           [Arthrobacter phenanthrenivorans Sphe3]
 gi|323469260|gb|ADX72945.1| membrane protein TerC, possibly involved in tellurium resistance
           [Arthrobacter phenanthrenivorans Sphe3]
          Length = 342

 Score =  148 bits (374), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 48/360 (13%), Positives = 105/360 (29%), Gaps = 91/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     W         L    +         G     ++       E SLS +
Sbjct: 29  RRPHEPSMKEAGLWVAFYVSLALLFAGAMFAFTGPEYGGQFVAGWVT------EYSLSID 82

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + +      +Q+  L  GI+IA+  +R IF ++   ++              
Sbjct: 83  NLFVFIIIMARFSVPRKYQQEVLMVGIIIALI-LRGIFILLGAIVI-------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +    +    G FL+  +                                
Sbjct: 128 ----------EQFSWVFYIFGAFLLWTAWKQ----------------------------- 148

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
               +   G       N + + +         F G     +V      N        L +
Sbjct: 149 ----AQDEGEDEEDRENPLIAKIRKVIPMSEKFDGGKLRTTV------NGKKVFTPMLIV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+ + + D   ++D + + F +T++ FI+        + +R +    L  G++N+  YL+
Sbjct: 199 FITIGLTDLLFAVDSIPAIFGLTQSPFIVFTANLFALMGLRQL--YFLLGGLMNRLIYLK 256

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           H   + +  + V + L  +                  +IP   +       I +++ +S+
Sbjct: 257 HALSFILAFIGVKLVLHAMHVNELPFINGGQHIEWAPEIPTFVSLAVIVGTIIIAVVASL 316


>gi|269793948|ref|YP_003313403.1| membrane protein TerC [Sanguibacter keddieii DSM 10542]
 gi|269096133|gb|ACZ20569.1| membrane protein TerC, possibly involved in tellurium resistance
           [Sanguibacter keddieii DSM 10542]
          Length = 333

 Score =  148 bits (374), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 43/360 (11%), Positives = 101/360 (28%), Gaps = 90/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 ++     W+        + GL + W +  T  G     Y+       E SLS +
Sbjct: 28  RTPHAPTIREAAWWSAAYVGVAVVFGLIVWWVWGGTYGGEYFAGYVT------EKSLSID 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +       I Q++ L  GI IA+  +R  F                      
Sbjct: 82  NLFVFVLIISAFRVPPIMQQKVLLIGITIAL-VLRTAFIFAGAA---------------- 124

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    +    G FL+  +     ++  +                      
Sbjct: 125 --------MIENFSWVFYIFGAFLVYTAWAQVKHASEETK-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   V         + G      +      +   +    L +
Sbjct: 157 ------------EFSENGLLRLVRRIFPTTDTYVGDKLTTKI------DGRRYITPMLIV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   ++D V + F +T+  +++        + +R +    L  G+L++  YL 
Sbjct: 199 MIAIGSADLLFAVDSVPAIFGLTQETYLVFAANAFSLLGLRQL--YFLIDGLLDRLVYLA 256

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  +   + +  +                  +IP   +     + + ++  +S+
Sbjct: 257 YGLAAILGFIGAKLLIHALHKNEVPFINGGEHITVIPEIPTALSLGFILVTLAVTTVASL 316


>gi|296129799|ref|YP_003637049.1| Integral membrane protein TerC [Cellulomonas flavigena DSM 20109]
 gi|296021614|gb|ADG74850.1| Integral membrane protein TerC [Cellulomonas flavigena DSM 20109]
          Length = 352

 Score =  148 bits (374), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 42/360 (11%), Positives = 102/360 (28%), Gaps = 90/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            +    +L     W+I       + G+ +   +  T        Y+       E SLS +
Sbjct: 28  RSPHEPTLRESAAWSIGYVGVALVFGVLVWAVWGSTYGAEYFAGYVT------EKSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +       ++Q++ L  GI IA+  +R +F  +   ++  ++          
Sbjct: 82  NLFVFVLIMASFRVPRLYQQKVLLIGITIAL-VLRTVFIFIGAAMIENLS---------- 130

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          I    G FL+  + T                              
Sbjct: 131 --------------WIFYIFGLFLLYTAWTQVKAGSEAED-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +  +          + G   +         +        L +
Sbjct: 157 ------------EYHENAVLRWTRRVFPTTDDYVGDKMVVRR------DGRRLLTPMLIV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   ++D + + F +T+  +++        + +R +    L  G+L+K  YL 
Sbjct: 199 MIAIGTADIIFAVDSIPAIFGLTQETYLVFTANAFSLLGLRQL--FFLIDGLLDKLVYLA 256

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + + + +  +                  +I    +     + + L+   S+
Sbjct: 257 YGLGAILGFIGIKLVIHALHTNEVPFINGGEHVTAIPEINTWVSLAFIVLTLALTTVLSL 316


>gi|269124913|ref|YP_003298283.1| Integral membrane protein TerC [Thermomonospora curvata DSM 43183]
 gi|268309871|gb|ACY96245.1| Integral membrane protein TerC [Thermomonospora curvata DSM 43183]
          Length = 348

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/321 (12%), Positives = 84/321 (26%), Gaps = 74/321 (23%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                  L     W++         G  +      T        ++       E SLS +
Sbjct: 29  RRPHAVHLREATFWSVFYVALAVGFGFVLWAVSGPTAGTEYFAGWVV------EKSLSVD 82

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +      +      +Q++ L +GI  A   +R +   +    VS  +          
Sbjct: 83  NLFVFVIIFARFAVPEEYQQKTLLFGI-GAALLLRSVLIAVGAAAVSMFS---------- 131

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                               G  L+  ++    N   +                      
Sbjct: 132 --------------WTFLLFGLILLWTAVQLIRNRDKEPD-------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                        +  N +              +G   +            T     L +
Sbjct: 158 -------------VDDNFLVRHSRKVLPVTDDLHGGRLVT------KEAGRTVVTPLLLV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+ +   D   +LD + + F +T   FI+        + +R++    L +G+L +  YL 
Sbjct: 199 FIAIGSTDLMFALDSIPAVFGVTSEPFIVFTANAFALLGLRAL--YFLVEGLLERLVYLA 256

Query: 301 HGSYYSIFVLSVIMFLQTIVD 321
            G    +  + V + L    +
Sbjct: 257 IGLSAILAFIGVKLLLHFAHE 277


>gi|153010316|ref|YP_001371530.1| integral membrane protein TerC [Ochrobactrum anthropi ATCC 49188]
 gi|151562204|gb|ABS15701.1| Integral membrane protein TerC [Ochrobactrum anthropi ATCC 49188]
          Length = 339

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 51/347 (14%), Positives = 105/347 (30%), Gaps = 69/347 (19%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +  +                 +     G  + WQ          T Y+       E SL+
Sbjct: 38  LHRDEHEIEAKESLLLYGFYVLIALAFGGWVWWQRGAESGLEFYTGYLI------EQSLA 91

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A     +    ++Q R L WGIL  V   R I   +   +V            
Sbjct: 92  MDNMFVIATIFGFLGIPRLYQHRVLFWGILG-VIAFRAILIGLGAALV------------ 138

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            I    G FL+      F +                        
Sbjct: 139 ------------HEFNWILFLFGAFLVFTGFKMFGHQDE--------------------- 165

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                       +  +  N ++ F+          +G NF        +   VT      
Sbjct: 166 ------------TPDIEQNAVFKFLRRRFNITRELHGRNFTVKQPHPKTGKMVTWLTPLA 213

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E +D   ++D V + FA+T++ FI+        + +R++         +N+++Y
Sbjct: 214 VALIMVETVDLIFAVDSVPAVFAVTQDTFIVYTSNIFAVLGLRAL--YFALAAAMNRFRY 271

Query: 299 LEHGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSIK 344
           L+      + ++ + +FL  + V I  + +   +  ++   +  S+ 
Sbjct: 272 LQVSLAIILVLIGIKIFLVPLGVHINTLLSLVVTLAILASGVLYSLY 318


>gi|238785425|ref|ZP_04629411.1| Inner membrane protein alx [Yersinia bercovieri ATCC 43970]
 gi|238713690|gb|EEQ05716.1| Inner membrane protein alx [Yersinia bercovieri ATCC 43970]
          Length = 328

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/343 (13%), Positives = 109/343 (31%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  S   +L     W+++      L   G  W    T+   I+       L   ++E +L
Sbjct: 31  RRGSQTMTLRQAACWSLVWVSLSLLFNAGFWWYLAETVGREIADKQALAFLTGYLIEKAL 90

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +VS  +       
Sbjct: 91  AVDNVFVWLMLFSYFAVPANLQRRVLIYGVLGA-IVLRTIMIFAGSWLVSQFS------- 142

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      ++                    
Sbjct: 143 -----------------WILYLFGAFLLFTGIKMAMAKEDD------------------- 166

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++ +        +G  F          N + +    
Sbjct: 167 --------------TPIGEKPLVRWIRNHLRMTDELHGDRFTVR------KNGLLYATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 207 VLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + V M +  +  IP   +      ++ L++ 
Sbjct: 265 MLKYGLSVILVFIGVKMMIIDLFHIPIGISLGVVAGILALTLL 307


>gi|319441551|ref|ZP_07990707.1| tellurium resistance membrane protein [Corynebacterium variabile
           DSM 44702]
          Length = 351

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/365 (11%), Positives = 102/365 (27%), Gaps = 93/365 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT-----HTLSGTISTVYICIILAVVEI 57
                 S+     W +   +     G+ +   +      H       + Y+       E 
Sbjct: 28  RTPHAPSMKESGFWTLFYVLLSVAFGVFLWVTWGEPGDPHAHGMEFFSGYVT------EK 81

Query: 58  SLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           +LS +N  + A  +        +Q++ L  GI +++   R +F  M   I+         
Sbjct: 82  ALSVDNLFVFALIMGSFKVPPKYQQKVLLIGIALSL-VFRGLFIAMGAAII--------- 131

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          +A   +    G FL++++     +    +                
Sbjct: 132 ---------------EAWSDVFYLFGLFLLIIAAKTVLDEVRDV---------------- 160

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                 ++  F+         +                      
Sbjct: 161 --------------PETDPNDMKIIKFIRKVIPVSEGYESDKLTLRR------AGRIMLT 200

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
                 + + + D   +LD + + + IT+  +I+     +  + +R M    L  G+L +
Sbjct: 201 PLAVCLVAIGLTDVMFALDSIPAIYGITQEPYIVFTTNALSLLGLRQM--YFLLGGLLER 258

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVD-----------------IPEIFTGTSSTILIFLS 338
             YL +G    +  + V M L  + +                 I    +      ++ ++
Sbjct: 259 LVYLPYGLGVILAFIGVKMVLHALHENNLPFINGGEGIHGAPDISTSASLLVIVSVLVIT 318

Query: 339 IYSSI 343
           + +S+
Sbjct: 319 VVASL 323


>gi|292898222|ref|YP_003537591.1| protein Alx ( high pH-induced membrane-bound redox modulator)
           [Erwinia amylovora ATCC 49946]
 gi|291198070|emb|CBJ45173.1| protein Alx ( putative high pH-induced membrane-bound redox
           modulator) [Erwinia amylovora ATCC 49946]
          Length = 326

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 108/343 (31%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+++      L      W  T T+   ++       L   ++E +L
Sbjct: 30  RRGAHTMSMKQAAVWSLVWVTLSLLFNAAFWWYLTGTVGREVADTQALAFLTGYLIEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +V+  +       
Sbjct: 90  AVDNVFVWLMLFGYFAVPAALQRRVLIYGVLGA-IVLRTIMIFAGSWLVTQFS------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +    ++++                    
Sbjct: 142 -----------------WLLYLFGAFLLFTGIKMALSNEDDSD----------------- 167

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++           G +F          N +      
Sbjct: 168 ----------------IGDKPLVRWLRGRLRMTDKIEGEHFFVRR------NGLLFATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 206 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + V M +     IP   +      ++ L++ 
Sbjct: 264 MLKYGLSLILVFIGVKMLIVDFYHIPIAISLGIVGGILALTLL 306


>gi|183597912|ref|ZP_02959405.1| hypothetical protein PROSTU_01253 [Providencia stuartii ATCC 25827]
 gi|188022678|gb|EDU60718.1| hypothetical protein PROSTU_01253 [Providencia stuartii ATCC 25827]
          Length = 319

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 55/343 (16%), Positives = 110/343 (32%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           K      S+     W+ +      +   G  W    T+S   +       L   V+E +L
Sbjct: 30  KHKDQVMSMKQAAIWSTVWVTLALMFAGGFWWYLKDTVSLEFANSQTTAFLTGYVLEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A+  +R I       +VS  +       
Sbjct: 90  AVDNVFVWLMLFSYFAIPANLQRRVLVYGVLGAII-LRTIMIFAGSWLVSQFS------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +   F  ++                    
Sbjct: 142 -----------------WILYIFGLFLLFTGIKMAFTKEDD------------------- 165

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                         + +    +  +V S        +G  F          N +      
Sbjct: 166 --------------SPITDKPLVKWVRSHLRMTDELHGEKFFIKR------NGLLFATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
             + + +EI D   ++D + + FA+T + FI++       + +R+M    L  G+  K+ 
Sbjct: 206 FLVLILVEISDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLAGVAEKFT 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + V M L  I  IP I +  +   ++  ++ 
Sbjct: 264 MLKYGLAVILTFIGVKMLLMDIYHIPTIISLGTVATILVATLV 306


>gi|329849923|ref|ZP_08264769.1| integral membrane protein TerC family protein [Asticcacaulis
           biprosthecum C19]
 gi|328841834|gb|EGF91404.1| integral membrane protein TerC family protein [Asticcacaulis
           biprosthecum C19]
          Length = 330

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 49/348 (14%), Positives = 100/348 (28%), Gaps = 71/348 (20%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +   +   S+      +          G  + W           T +I       E +L+
Sbjct: 34  LHRKTHEISIRESLWMSAFYIAMAMAFGGWVWWSLGDQAGKEYLTGFIV------EKTLA 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  L +          ++Q R L WGIL  V  +R I   +   +V+           
Sbjct: 88  MDNVFLISLIFTYFAIPPLYQHRVLFWGILG-VIVLRGIMIALGATLVAQYG-------- 138

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            I      FL+   +   F                         
Sbjct: 139 ----------------WILYIFAVFLIFTGVKMLFMGDKHPD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          + +N +   +           G  FL       +     +    L
Sbjct: 165 ---------------IASNPLLKLMRKVFPISDKLDGQKFLTRQADPVTGKWRLYATPLL 209

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              L +E +D   ++D V + F IT + FI+        + +R++        I++++KY
Sbjct: 210 VALLLIEFVDLIFAVDSVPAIFTITLDPFIVFTSNIFAILGLRAL--YFALAAIIHRFKY 267

Query: 299 LEHGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSIYSSI 343
           L+    + +  +   +F+     +   P   +   +  LI + +  S+
Sbjct: 268 LKPALAFVLIFIGAKVFIADALGLEKFPANISLAVTLGLIAIGVIVSL 315


>gi|329940831|ref|ZP_08290111.1| integral membrane export protein [Streptomyces griseoaurantiacus
           M045]
 gi|329300125|gb|EGG44023.1| integral membrane export protein [Streptomyces griseoaurantiacus
           M045]
          Length = 337

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/354 (15%), Positives = 106/354 (29%), Gaps = 78/354 (22%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       SL     W I+  V   L GLG+        SG     +I       E SLS
Sbjct: 25  IGRKPHEVSLKEAGVWTIVWIVLAALFGLGLLVFGGGEPSGEFFAGFIT------EKSLS 78

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + K    S +Q+R L  G+LIA+                         L 
Sbjct: 79  VDNLFVFVLIMAKFSVPSKYQQRVLLVGVLIAL-------------------------LL 113

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
             +       I  +   +    G FL+  +      ++                      
Sbjct: 114 RAAFIAAGAAILASFAWVFYLFGAFLIWTAWKLIQEARADHED----------------- 156

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N++   V         ++G             N        L
Sbjct: 157 -------------EEFEENKLLKAVERRFGVADRYHGTKLWIR------QNGKRVMTPML 197

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +   D   +LD + + F +T++ +I+        + +R +    L  G+L K  +
Sbjct: 198 VVMLAIGTTDVLFALDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLIGGLLRKLVH 255

Query: 299 LEHGSYYSIFVLSVIMFLQTIV----DIPEI---FTGTSSTILIFLSIYSSIKN 345
           L +G    +  + V + L  +      +PEI    +      ++ ++  +S+  
Sbjct: 256 LSYGLSVILGFIGVKLVLHALHESGVHVPEISIPVSLGVICGVLIVTTITSLMA 309


>gi|91226172|ref|ZP_01261062.1| putative transmembrane transport protein [Vibrio alginolyticus
           12G01]
 gi|91189406|gb|EAS75684.1| putative transmembrane transport protein [Vibrio alginolyticus
           12G01]
          Length = 339

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/349 (12%), Positives = 109/349 (31%), Gaps = 74/349 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEI 57
           ++     ++     W++   +  F+    I   +     H+           +   ++E 
Sbjct: 40  QTRGGVITMKKAIVWSVFWFLLAFVFAGSIYLFWDFYAPHSAYTNDKATISFLTGYLLEK 99

Query: 58  SLSFENAILNAKNLQK--MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SLS +N  + A    +  +    + R L WG++ A+    ++  +               
Sbjct: 100 SLSVDNLFVFAIIFAQYSVPEHLRPRALLWGVIGALVLRAVMIAV--------------- 144

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                        +   +  +      FL+   +    +         + E         
Sbjct: 145 ----------GAQLLSQYHWVLYLFAAFLIWTGVKLARDKGEAEEVNPYPE--------- 185

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                      +         + G + +                
Sbjct: 186 -------------------------QLIRKVLPVTDDYQGNHLI------LKQAGKWVAT 214

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L +   + ++D   +LD + + FA+T+  F+++       + +RS+    + Q +L+K
Sbjct: 215 PMLIVVGVIAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSL--YFVLQAMLDK 272

Query: 296 YKYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + YL+      +  + V M L  T  +IP  ++ T   +++  ++ +S+
Sbjct: 273 FVYLKPALSVIMMFIGVKMLLVGTEYEIPTTWSLTFLVVVMTSAVVASL 321


>gi|119718102|ref|YP_925067.1| integral membrane protein TerC [Nocardioides sp. JS614]
 gi|119538763|gb|ABL83380.1| Integral membrane protein TerC [Nocardioides sp. JS614]
          Length = 352

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 44/367 (11%), Positives = 101/367 (27%), Gaps = 93/367 (25%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQ-----FTHTLSGTISTVYICIILAVV 55
           +       ++    R          L G  +         +          ++       
Sbjct: 34  IARRPHEPTMPEVSRHLAFFIGLAVLFGAALWLFAEPHALSPNPGPEFFAGWLT------ 87

Query: 56  EISLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIE 113
           E SLS +N  +    +        +Q+  L  GI++A+  MR IF ++    ++  +   
Sbjct: 88  EYSLSIDNLFIFIIIMANFSVPRQYQQTALMIGIVLAL-VMRAIFIVVGAAAINEFS--- 143

Query: 114 AMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLS 173
                                 +    G FL+  ++        +               
Sbjct: 144 ---------------------WVFYVFGAFLLWTAVKLAKQGSTEDD------------- 169

Query: 174 KIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH 233
                            +     N +  F      A   ++G   L        +N    
Sbjct: 170 -----------------AEEYEENRLVRFAEKHLPATSEWHGTKLLT------KTNGKRL 206

Query: 234 GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
                 + L L   D   +LD + + + +T++ +++        + +R +    L  G+L
Sbjct: 207 ITPMFLVVLTLGTTDLLFALDSIPAIYGLTRDPYLVFTANVFALMGLRQL--YFLIGGLL 264

Query: 294 NKYKYLEHGSYYSIFVLSVIMFLQTIVD-----------------IPEIFTGTSSTILIF 336
            +  YL +G    +  + V + L  + +                 IP   +       + 
Sbjct: 265 QRLIYLSYGLAVLLGFIGVKLVLHAMHENELPFINGGEHIGWAPDIPIWLSLAVIIGTLA 324

Query: 337 LSIYSSI 343
           ++   S+
Sbjct: 325 ITAVVSL 331


>gi|119963252|ref|YP_946939.1| membrane protein, tellurium resistance [Arthrobacter aurescens TC1]
 gi|119950111|gb|ABM09022.1| putative membrane protein, tellurium resistance [Arthrobacter
           aurescens TC1]
          Length = 395

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 43/359 (11%), Positives = 98/359 (27%), Gaps = 90/359 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   SL     W+ +      L G+ +       +       YI       E +LS +
Sbjct: 28  RKAHVPSLKEAAIWSSIYVGLAVLFGVLVLIFGGGQMGSEYFAGYIT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +         Q++ L +GI+ ++   R  F  +                   
Sbjct: 82  NLFVFLIIMASFRVPREDQQKVLLFGIVFSLIA-RTGFIFLGAA---------------- 124

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   +  +   +    G  L++ +        +                       
Sbjct: 125 --------LINSFAWVFYIFGLILLLTAGNLLKPGDHGDG-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +             + G      V      N        L +
Sbjct: 157 -------------QANNFIIRMAKKLFHTTDKYDGDKLFTMV------NGKRALTPMLLV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + F +T+N FI+        + +R +    L  G+L++  YL 
Sbjct: 198 MVAIGGTDILFALDSIPAIFGLTQNVFIVFTATAFSLMGLRQL--YFLIDGLLDRLIYLS 255

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +                 +I    + +    ++ +++  S+
Sbjct: 256 YGLAAILAFIGVKLILHALHENNLPFINDGEHVNVIEITTGLSLSVIIGVLIITVVLSL 314


>gi|197249570|ref|YP_002148155.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197213273|gb|ACH50670.1| inner membrane protein alx [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 337

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 103/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+IL      L      W    T    ++       L   ++E SL
Sbjct: 45  RRGAHAMSMKQAAGWSILWVTLSLLFNAAFWWYLAETQGREVADPQALAFLTGYLIEKSL 104

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G+L A   +R I       +++          
Sbjct: 105 AVDNVFVWLMLFSYFSVPPALQRRVLVYGVLGA-IVLRTIMIFAGTWLITQFE------- 156

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      +++                   
Sbjct: 157 -----------------WLLYVFGAFLLFTGVKMALAKEDESG----------------- 182

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    M  ++             +F          N + +    
Sbjct: 183 ----------------IGEKPMVRWLRGHLRMTDTIENEHFFVR------KNGLLYATPL 220

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E  D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 221 LLVLIMVEFSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSGVAERFS 278

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ +++ 
Sbjct: 279 MLKYGLAVILVFIGIKMLIVDFYHIPIAISLGVVFGILTITLV 321


>gi|113970878|ref|YP_734671.1| integral membrane protein TerC [Shewanella sp. MR-4]
 gi|114048102|ref|YP_738652.1| integral membrane protein TerC [Shewanella sp. MR-7]
 gi|113885562|gb|ABI39614.1| Integral membrane protein TerC [Shewanella sp. MR-4]
 gi|113889544|gb|ABI43595.1| Integral membrane protein TerC [Shewanella sp. MR-7]
          Length = 327

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 50/352 (14%), Positives = 106/352 (30%), Gaps = 76/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       ++    + +      G L G  + W    T      T Y+       E SLS
Sbjct: 34  LHKEQHEITVAESLKLSAFYICMGLLFGAWLWWYKGSTAGMEYLTGYLI------EKSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A     +    ++Q R L WGI+  V  +R I   +   +V+           
Sbjct: 88  MDNVFVIALIFSSLGIPRLYQHRVLFWGIMG-VIVLRAIMIGLGAALVAQ---------- 136

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                         +  +    G FL+   +   F+                        
Sbjct: 137 --------------YQGVLVLFGLFLIFTGIKMLFSDDEHGD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N+ Y ++ S        +   F         S          
Sbjct: 165 ---------------IQDNKFYKWLRSKMRFTPSLHKEKFWVRGEEHQLSKG-WWATPLF 208

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E  D   ++D + + FAIT++ FI+        + +R++        ++++++Y
Sbjct: 209 LALILVETADLVFAVDSIPAIFAITQDPFIVYTSNIFAILGLRAL--YFALAAMVHRFEY 266

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD-------IPEIFTGTSSTILIFLSIYSSI 343
           L++     +  + V + L            IP   +   +  L+   +  S+
Sbjct: 267 LKYALSVVLVFIGVKVGLVYFNHEGIVDFKIPTALSLGVTFGLLLAGVLFSL 318


>gi|238764223|ref|ZP_04625175.1| Inner membrane protein alx [Yersinia kristensenii ATCC 33638]
 gi|238697504|gb|EEP90269.1| Inner membrane protein alx [Yersinia kristensenii ATCC 33638]
          Length = 328

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/343 (13%), Positives = 110/343 (32%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  S   +L     W+++      L   G  W  T T+   I+       L   ++E +L
Sbjct: 31  RRGSQTMTLRQAACWSLVWVSLSLLFNAGFWWYLTETMGREIADKQALAFLTGYLIEKAL 90

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +VS  +       
Sbjct: 91  AVDNVFVWLMLFSYFAVPANLQRRVLIYGVLGA-IVLRTIMIFAGSWLVSQFS------- 142

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      ++                    
Sbjct: 143 -----------------WILYLFGAFLLFTGIKMALAKEDN------------------- 166

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++ +        +G  F          N + +    
Sbjct: 167 --------------TPIGEKPLVRWIRNHLRMTDELHGDRFTVR------KNGLLYATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 207 VLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + V M +  +  IP   +      ++ L++ 
Sbjct: 265 MLKYGLSVILVFIGVKMMIIDLFHIPIGISLGVVAGILALTLL 307


>gi|220912567|ref|YP_002487876.1| integral membrane protein TerC [Arthrobacter chlorophenolicus A6]
 gi|219859445|gb|ACL39787.1| Integral membrane protein TerC [Arthrobacter chlorophenolicus A6]
          Length = 342

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/360 (13%), Positives = 105/360 (29%), Gaps = 91/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     W         L    +     H   G     ++       E SLS +
Sbjct: 29  RRPHEPSMKEAGLWVAFYVTLALLFAGAMFIFAGHEYGGQFVAGWVT------EYSLSID 82

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + +      +Q+  L  GI+IA+  +R IF ++   ++              
Sbjct: 83  NLFVFIIIMARFSVPRKYQQEVLMVGIIIAL-VLRGIFILLGAIVI-------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +    +    G FL+  +                                
Sbjct: 128 ----------EQFSWVFYIFGAFLLWTAWKQ----------------------------- 148

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
               +   G       N + + +         F       +V      N        L +
Sbjct: 149 ----AQDEGEDEEDKENPLIARIRKVIPMSEKFDEGKLRTTV------NGKKVFTPMLIV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+ + + D   ++D + + F +T++ FI+        + +R +    L  G++N+  YL+
Sbjct: 199 FITIGLTDLLFAVDSIPAIFGLTQSPFIVFTANLFALMGLRQL--YFLLGGLMNRLVYLK 256

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           H   + +  + V + L  +                  +IP   +       I +++ +S+
Sbjct: 257 HALSFILAFIGVKLVLHAMHVNELPFINGGKHIEWAPEIPTFVSLAVIVGTIVIAVVASL 316


>gi|269102555|ref|ZP_06155252.1| membrane protein TerC [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268162453|gb|EEZ40949.1| membrane protein TerC [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 324

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/349 (11%), Positives = 93/349 (26%), Gaps = 72/349 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEI 57
           ++     S+     W++   V   L  + I   +      +           +   ++E 
Sbjct: 23  QTRGGAVSIKKAAIWSLFWVVLALLFSVFIYHYWPLMAPDSTYTNAQATTAFLTGYLLEK 82

Query: 58  SLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SLS +N  + A    +       + R L  G++ A+     +  +               
Sbjct: 83  SLSVDNLFVFALIFGQFMVPERLRPRVLMLGVVGALILRGFMIAV--------------- 127

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                        +      +      FL+      +     +                 
Sbjct: 128 ----------GAELLDQFHWVLYIFAAFLLYTGFKLWKEGDEEP---------------- 161

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                +     V         +                      
Sbjct: 162 ----------------EDFSNSLPVRVVKRFFRVTDDYQEQKMFV------KDKKGWLAT 199

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L +   + + D   +LD + + FA+T+  F++        + +RS+    + +G+L +
Sbjct: 200 PLLVVVAVIALTDVMFALDSIPAIFAVTREPFLVYTANVFALLGLRSL--YFVLEGMLTR 257

Query: 296 YKYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + YL     + +  + V M L  T   IP   +     + I  +I  S+
Sbjct: 258 FCYLRVALAFILSFIGVKMLLVGTAWAIPTAVSLCVIALTITAAIVGSL 306


>gi|238756207|ref|ZP_04617525.1| Inner membrane protein alx [Yersinia ruckeri ATCC 29473]
 gi|238705564|gb|EEP97963.1| Inner membrane protein alx [Yersinia ruckeri ATCC 29473]
          Length = 358

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 45/343 (13%), Positives = 109/343 (31%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  S   +L     W+++      L   G  W  + ++   I+       L   ++E +L
Sbjct: 61  RRGSQTMTLRQAAAWSLVWVSLAMLFNAGFWWYLSESVGRDIADKQALAFLTGYLIEKAL 120

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R         +VS  +       
Sbjct: 121 AVDNVFVWLMLFSYFAVPANLQRRVLIYGVLGA-IVLRTGMIFAGSWLVSQFS------- 172

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   L      ++                    
Sbjct: 173 -----------------WILYVFGAFLLFTGLKMALAKEDN------------------- 196

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                         + +    +  ++ S         G  F+         N + +    
Sbjct: 197 --------------SPIGDKPLVRWIRSHLRMTDELQGDRFVIR------KNGLLYATPL 236

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 237 VLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFT 294

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  +   M +  +  IP   +      ++ +++ 
Sbjct: 295 MLKYGLAIILVFIGTKMMIIDLFHIPIGISLGVVAGILVVTLM 337


>gi|291086536|ref|ZP_06356095.2| protein Alx [Citrobacter youngae ATCC 29220]
 gi|291067721|gb|EFE05830.1| protein Alx [Citrobacter youngae ATCC 29220]
          Length = 343

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 43/343 (12%), Positives = 105/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+I+      L      W  T T    ++       L   ++E SL
Sbjct: 51  RRGAHTMSMKQAATWSIVWVTLSLLFNAAFWWYLTQTQGRAVADPQALAFLTGYLIEKSL 110

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G+L A   +R I       +++          
Sbjct: 111 AVDNVFVWLMLFSYFSVPPALQRRVLVYGVLGA-IVLRTIMIFAGSWLIAQFE------- 162

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      ++                    
Sbjct: 163 -----------------WLLYVFGAFLLFTGVKMALAKED-------------------- 185

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                        ++ +    +  ++              F          N +      
Sbjct: 186 -------------ASGIGDRPLVRWLRGHLRMTDTIEDEKFFVR------KNGLLFVTPL 226

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 227 MLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLAGVAERFS 284

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++F+++ 
Sbjct: 285 MLKYGLSVILVFIGIKMLIVDFYHIPIAISLGVVFGILFVTLI 327


>gi|161616221|ref|YP_001590186.1| hypothetical protein SPAB_04025 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161365585|gb|ABX69353.1| hypothetical protein SPAB_04025 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 287

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 44/337 (13%), Positives = 101/337 (29%), Gaps = 70/337 (20%)

Query: 8   ASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLSFENAI 65
            S+     W+IL      L      W    T    ++       L   ++E SL+ +N  
Sbjct: 1   MSMKQAAGWSILWVTLSLLFNAAFWWYLAETQGREVADPQALAFLTGYLIEKSLAVDNVF 60

Query: 66  LNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQ 123
           +              Q+R L +G+L A   +R I       +++                
Sbjct: 61  VWLMLFSYFSVPPALQRRVLVYGVLGA-IVLRTIMIFAGTWLITQFE------------- 106

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV 183
                       +    G FL+   +      +++                         
Sbjct: 107 -----------WLLYVFGAFLLFTGVKMALAKEDESG----------------------- 132

Query: 184 LSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLY 243
                     +    M  ++             +F          N + +    L + + 
Sbjct: 133 ----------IGEKPMVRWLRGHLRMTDTIENEHFFVR------KNGLLYATPLLLVLIM 176

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           +E  D   ++D + + FA+T + FI++       + +R+M    L  G+  ++  L++G 
Sbjct: 177 VEFSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLSGVAERFSMLKYGL 234

Query: 304 YYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
              +  + + M +     IP   +      ++ +++ 
Sbjct: 235 AVILVFIGIKMLIVDFYHIPIAISLGVVFGILTITLV 271


>gi|322831251|ref|YP_004211278.1| Integral membrane protein TerC [Rahnella sp. Y9602]
 gi|321166452|gb|ADW72151.1| Integral membrane protein TerC [Rahnella sp. Y9602]
          Length = 324

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 45/343 (13%), Positives = 104/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W+++      L   G  W         ++     + L   ++E +L
Sbjct: 31  RKGAQTMSMKSAAMWSLVWIGLSLLFNFGFWWYLNGEFGREVADAKATMFLTGYLLEKAL 90

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R         +V   +       
Sbjct: 91  AVDNVFVWLILFSYFSIPASLQRRVLVYGVLGA-IVLRTGMIFAGSWLVGQFS------- 142

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      +                     
Sbjct: 143 -----------------WILYVFGAFLLFTGIKMALAKEED------------------- 166

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    M  ++ S         G  F          N +      
Sbjct: 167 --------------GEVGEKPMIRWLRSKMRMTDELQGEKFFVRR------NGILFATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 207 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLAGVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M L  +  IP   +      ++ +++ 
Sbjct: 265 MLKYGLAVILIFIGIKMLLLDVFHIPVGISLGVIASILIITLL 307


>gi|220911830|ref|YP_002487139.1| integral membrane protein TerC [Arthrobacter chlorophenolicus A6]
 gi|219858708|gb|ACL39050.1| Integral membrane protein TerC [Arthrobacter chlorophenolicus A6]
          Length = 360

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/361 (13%), Positives = 98/361 (27%), Gaps = 92/361 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+    RW+        L G+GIG  F     G     Y+       E +LS +
Sbjct: 28  RKPHEPSIGESARWSAFYIGLALLFGVGIGMVFGWNFGGEYFAGYLT------EKALSID 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI+IA+  +R  F  +                   
Sbjct: 82  NLFVFLIVMSGFAVPKKYQQKVLMIGIVIALI-LRGGFIAIGA----------------- 123

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    I    G  L+ ++    F S                         
Sbjct: 124 -------GLIENFSWIFYIFGALLLFLAYKQAFGSHES---------------------- 154

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                            +    V         ++G             +        +  
Sbjct: 155 ------------NPADGKFMQLVRRVLPVTDEYHGDKLTV------KKDGSRFFTPMMLT 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +  +D   ++D + + + +T   +I+        + +R +    L  G+L +  YL 
Sbjct: 197 IIAIGFVDLIFAVDSIPAIYGLTNEAYIVFTANAFALMGLRQL--FFLIGGLLERLVYLA 254

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V +    +                  +IP  F+       I ++  +S+
Sbjct: 255 QGLAVILAFIGVKLVFHALHVNELSFINGGQPLLWVPEIPIWFSLVFIAATIAVATVASL 314

Query: 344 K 344
            
Sbjct: 315 M 315


>gi|310819583|ref|YP_003951941.1| membrane protein [Stigmatella aurantiaca DW4/3-1]
 gi|309392655|gb|ADO70114.1| Membrane protein, TerC family [Stigmatella aurantiaca DW4/3-1]
          Length = 316

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/344 (13%), Positives = 100/344 (29%), Gaps = 75/344 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +      W  +      L   GI +      +    T Y+       E SLS +
Sbjct: 28  RKDHAVTPKEAGAWTGVWISISLLFCGGIWYFSGPVPALQWFTAYVV------EYSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +          ++  Q R L WGI+ A F MR +  I    +V+             
Sbjct: 82  NLFVFLMVFSYFRVAAEHQHRVLFWGIVGA-FIMRAVLIIAGAALVTR------------ 128

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          I    G FL+  ++    +   ++                     
Sbjct: 129 ------------FHWIIYLFGAFLVFTAVKMLVSKDEEVDP------------------- 157

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                             +      +     +  G  F        + +          +
Sbjct: 158 --------------EQKWIVRMARKTLPVARLGEGSRFFV------TEDGRRKVTPLFVV 197

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +E  D   +LD + +   I+++ FII        + +RS+    +   +++K+ +L+
Sbjct: 198 LLVVEATDLLFALDSIPAVLGISQDAFIIYTSNVCAILGLRSL--FFVVASLMDKFHFLK 255

Query: 301 HGSYYSIFVLSVIMFLQTI-VDIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V M +    + +    +      ++  SI +S+
Sbjct: 256 LGLSGILGFVGVKMLITYFDIHVHIGLSLGIIAGILVASIVASL 299


>gi|190576470|ref|YP_001974315.1| putative efflux membrane protein [Stenotrophomonas maltophilia
           K279a]
 gi|254525109|ref|ZP_05137164.1| export protein [Stenotrophomonas sp. SKA14]
 gi|190014392|emb|CAQ48040.1| putative efflux membrane protein [Stenotrophomonas maltophilia
           K279a]
 gi|219722700|gb|EED41225.1| export protein [Stenotrophomonas sp. SKA14]
          Length = 320

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 46/344 (13%), Positives = 105/344 (30%), Gaps = 70/344 (20%)

Query: 6   LYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLSFEN 63
              +      W+I       L   G+ +    T    ++       L   +VE +L+ +N
Sbjct: 34  HKVTFKEALWWSIGWVALALLFNAGLWYYLNETAGQVVANKVGLEFLTGYLVEKALAVDN 93

Query: 64  AILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYS 121
             +    +         +++ L  GIL A+    I+                        
Sbjct: 94  IFVFLMIMSYFAVPEEQRQKVLIIGILGAIVLRTIMIFA--------------------- 132

Query: 122 PQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIF 181
                 ++      +    G FL+      +F +  +                       
Sbjct: 133 ----GSVLISQFHWLLYVFGAFLLFTGWKMWFAAGQEPD--------------------- 167

Query: 182 IVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLF 241
                       L TN    ++      +  + G         S   + V        + 
Sbjct: 168 ------------LETNPALRWMRKHLRLLPDYAGNAL------SVKRDGVRWFTPLFAVL 209

Query: 242 LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEH 301
           + + + D   ++D + + FAIT + FI++       + +R+M    L  G+ +++  L +
Sbjct: 210 ILIAVTDVIFAVDSIPAIFAITTDPFIVLTSNVFAVLGLRAM--FFLLAGMADRFHLLPY 267

Query: 302 GSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           G    +  + + M +  +  IP   +     ++I  ++  S+K 
Sbjct: 268 GLALVLGFIGIKMMIIDLFKIPTPVSLGVVAVIIAATVVLSLKY 311


>gi|262395488|ref|YP_003287341.1| membrane protein TerC [Vibrio sp. Ex25]
 gi|262339082|gb|ACY52876.1| membrane protein TerC [Vibrio sp. Ex25]
          Length = 339

 Score =  147 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 45/349 (12%), Positives = 113/349 (32%), Gaps = 74/349 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEI 57
           ++     ++     W++   +  F+    I   +     H+           +   ++E 
Sbjct: 40  QTRGGVITMKKAILWSVFWFLLAFVFAGSIYLFWDFYAPHSTYTNDKATVSFLTGYLLEK 99

Query: 58  SLSFENAILNAKNLQK--MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SLS +N  + A    +  +    + R L WG++ A+  +R I   +   +++        
Sbjct: 100 SLSVDNLFVFAIIFAQYSVPEHLRPRALLWGVIGAL-VLRAIMIAVGAQLLAQ------- 151

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                            +  +      FL+   +    +         + E         
Sbjct: 152 -----------------YHWVLYLFAAFLIWTGIKLARDKGEAEEVNPYPE--------- 185

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                     F+         + G + +                
Sbjct: 186 -------------------------QFIRRILPVTDDYQGNHLI------LKQAGKWVAT 214

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L +   + ++D   +LD + + FA+T+  F+++       + +RS+    + Q +L+K
Sbjct: 215 PMLIVVGVIAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSL--YFVLQAMLDK 272

Query: 296 YKYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + YL+      +  + V M L  T  +IP  ++ T   +++  ++ +S+
Sbjct: 273 FVYLKPALSVIMMFIGVKMLLVGTEYEIPTTWSLTFLIVVMTSAVVASL 321


>gi|217973952|ref|YP_002358703.1| Integral membrane protein TerC [Shewanella baltica OS223]
 gi|217499087|gb|ACK47280.1| Integral membrane protein TerC [Shewanella baltica OS223]
          Length = 328

 Score =  147 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/352 (14%), Positives = 107/352 (30%), Gaps = 76/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       ++    + +      G L G  + W    T      T Y+       E SLS
Sbjct: 34  LHKEQHEITVAESLKLSAFYICMGLLFGAWLWWYKGSTAGMEYLTGYLI------EKSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A     +    ++Q R L WGIL  V  +R I   +   +V+           
Sbjct: 88  MDNVFVIALIFSSLGIPRLYQHRVLFWGILG-VIVLRAIMIGLGAVLVAQ---------- 136

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                         +  +    G FL+   +   F++                       
Sbjct: 137 --------------YQGVLVLFGLFLIFTGVKMLFSNDEHSD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N+ Y ++ +        +   F         S          
Sbjct: 165 ---------------IQDNKFYKWLRTKMRFTPTLHKEKFWVRGEDHQLSKG-WWATPLF 208

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E  D   ++D + + FAIT++ FI+        + +R++        ++++++Y
Sbjct: 209 LALILVETADLVFAVDSIPAIFAITQDPFIVYTSNIFAILGLRAL--YFALAAMVHRFEY 266

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD-------IPEIFTGTSSTILIFLSIYSSI 343
           L++     +  + V + L            IP   +   +  L+   +  S+
Sbjct: 267 LKYALSVVLVFIGVKVGLVYFNHEGIVDFTIPTALSLGVTFGLLVAGVLFSL 318


>gi|108801748|ref|YP_641945.1| integral membrane protein TerC [Mycobacterium sp. MCS]
 gi|119870899|ref|YP_940851.1| integral membrane protein TerC [Mycobacterium sp. KMS]
 gi|108772167|gb|ABG10889.1| Integral membrane protein TerC [Mycobacterium sp. MCS]
 gi|119696988|gb|ABL94061.1| Integral membrane protein TerC [Mycobacterium sp. KMS]
          Length = 346

 Score =  147 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/362 (11%), Positives = 99/362 (27%), Gaps = 91/362 (25%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+        +        G+ +               ++       E SLS
Sbjct: 26  IARRPHEPSMKECSIALSVYVSLAIAFGVWVWVFHGGDYGLEFFAGWLT------EYSLS 79

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    +        +Q+  L  GI++A+   R IF  +    ++  +        
Sbjct: 80  VDNLFIFIIIMASFNVPRKYQQEALMVGIILALI-FRGIFIALGAVAINQFS-------- 130

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL+  +     ++ ++                    
Sbjct: 131 ----------------WVFYIFGLFLVYTAWNLARDTDHEDDG----------------- 157

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N +  F  +       + G+            +         
Sbjct: 158 -----------------DNAVVKFARNHLTLTDKWDGLKLWI------KQDGKRLMTPMF 194

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + L   D   +LD + + F +T+  +++        + +R +    L  G+L +  Y
Sbjct: 195 LVIVALGTTDLIFALDSIPAIFGLTQEPYLVFTANVFALMGLRQLFF--LLGGLLKRLVY 252

Query: 299 LEHGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSS 342
           L  G  + +  + V +FL  +                 +IP + +     + + ++   S
Sbjct: 253 LSQGLAFILLFIGVKLFLHALHENELPFINGGEHVKVPEIPTLLSLGVIVVTLVITTVLS 312

Query: 343 IK 344
           + 
Sbjct: 313 LM 314


>gi|153000082|ref|YP_001365763.1| integral membrane protein TerC [Shewanella baltica OS185]
 gi|304409668|ref|ZP_07391288.1| Integral membrane protein TerC [Shewanella baltica OS183]
 gi|307304026|ref|ZP_07583779.1| Integral membrane protein TerC [Shewanella baltica BA175]
 gi|151364700|gb|ABS07700.1| Integral membrane protein TerC [Shewanella baltica OS185]
 gi|304352186|gb|EFM16584.1| Integral membrane protein TerC [Shewanella baltica OS183]
 gi|306912924|gb|EFN43347.1| Integral membrane protein TerC [Shewanella baltica BA175]
          Length = 328

 Score =  147 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/352 (14%), Positives = 107/352 (30%), Gaps = 76/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       ++    + +      G L G  + W    T      T Y+       E SLS
Sbjct: 34  LHKEQHEITVAESLKLSAFYICMGLLFGAWLWWYKGSTAGMEYLTGYLI------EKSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A     +    ++Q R L WGIL  V  +R I   +   +V+           
Sbjct: 88  MDNVFVIALIFSSLGIPRLYQHRVLFWGILG-VIVLRAIMIGLGAVLVAQ---------- 136

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                         +  +    G FL+   +   F++                       
Sbjct: 137 --------------YQGVLVLFGLFLIFTGVKMLFSNDEHSD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N+ Y ++ +        +   F         S          
Sbjct: 165 ---------------IQDNKFYKWLRTKMRFTPTLHQEKFWVRGEDHQLSKG-WWATPLF 208

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E  D   ++D + + FAIT++ FI+        + +R++        ++++++Y
Sbjct: 209 LALILVETADLVFAVDSIPAIFAITQDPFIVYTSNIFAILGLRAL--YFALAAMVHRFEY 266

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD-------IPEIFTGTSSTILIFLSIYSSI 343
           L++     +  + V + L            IP   +   +  L+   +  S+
Sbjct: 267 LKYALSVVLVFIGVKVGLVYFNHEGIVDFTIPTALSLGVTFGLLVAGVLFSL 318


>gi|308188199|ref|YP_003932330.1| TerC family protein ygjT [Pantoea vagans C9-1]
 gi|308058709|gb|ADO10881.1| Putative TerC family protein ygjT [Pantoea vagans C9-1]
          Length = 322

 Score =  147 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 43/343 (12%), Positives = 101/343 (29%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S      W+++      L      W    +    ++       L   V+E +L
Sbjct: 30  RRGAQTMSFKQAAVWSLIWVSVSLLFSAAFWWYLEGSAGREVANTQTLAFLTGYVLEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +V+  +       
Sbjct: 90  AVDNVFVWLMLFSYFSIPANLQRRVLIYGVLGA-IVLRTIMIFAGSWLVTQFS------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      ++                    
Sbjct: 142 -----------------WILYVFGAFLLFTGVKMALAKEDD------------------- 165

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++           G  F          N V      
Sbjct: 166 --------------GAVGDKPVVRWLRKHLRMTDDLDGEKFFTR------KNGVLFATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 206 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  +   M +  +  IP   +      ++  ++ 
Sbjct: 264 MLKYGLAIVLVFIGFKMLIVDLYHIPVGISLGVVGAILASTLL 306


>gi|220915662|ref|YP_002490966.1| Integral membrane protein TerC [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219953516|gb|ACL63900.1| Integral membrane protein TerC [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 328

 Score =  147 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 49/340 (14%), Positives = 95/340 (27%), Gaps = 74/340 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +    +     W+++           + WQF         T Y+       E SL+ +
Sbjct: 31  RKAHVIRVREALGWSVVWVALALTFNALVWWQFGADRGLEFLTGYLI------EKSLAVD 84

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +       +    ++Q R L WGIL A+  +R         +++             
Sbjct: 85  NIFVFVIIFSALGVPPLYQHRVLFWGILSAL-VLRAGMIFAGTALLAR------------ 131

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                               G  L+   +  F                            
Sbjct: 132 ------------FHWTIYLFGALLVATGVKLFLGRNE----------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                     +       +   V     +     G +FL         N        L  
Sbjct: 157 ----------APDPTGGRLMRLVRRVIPSTHELRGAHFLT------IENGRRVATPLLLA 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +EI D   ++D + + FA+T + FI+        + +RSM    L  G++ ++  L+
Sbjct: 201 LVLVEISDVIFAVDSIPAIFAVTLDPFIVFTSNIFAILGLRSM--FFLLAGMVERFSGLK 258

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            G    +  + V M     V +P   +      L+   + 
Sbjct: 259 TGLSAVLVYVGVKMLAMDWVKVPPALSLAIVAALLVAPVL 298


>gi|126437735|ref|YP_001073426.1| integral membrane protein TerC [Mycobacterium sp. JLS]
 gi|126237535|gb|ABO00936.1| Integral membrane protein TerC [Mycobacterium sp. JLS]
          Length = 346

 Score =  147 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/362 (11%), Positives = 99/362 (27%), Gaps = 91/362 (25%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+        +        G+ +               ++       E SLS
Sbjct: 26  IARRPHEPSMKECSIALSVYVSLAIAFGVWVWVFHGGDYGLEFFAGWLT------EYSLS 79

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    +        +Q+  L  GI++A+   R IF  +    ++  +        
Sbjct: 80  VDNLFIFIIIMASFNVPRKYQQEALMVGIILALI-FRGIFIALGAVAINQFS-------- 130

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL+  +     ++ ++                    
Sbjct: 131 ----------------WVFYIFGLFLVYTAWNLARDTDHEDDG----------------- 157

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N +  F  +       + G+            +         
Sbjct: 158 -----------------DNAVVKFARNHLTLTDKWDGLKLWI------KQDGKRLMTPMF 194

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + L   D   +LD + + F +T+  +++        + +R +    L  G+L +  Y
Sbjct: 195 LVIVALGTTDLIFALDSIPAIFGLTQEPYLVFTANVFALMGLRQLFF--LLGGLLKRLVY 252

Query: 299 LEHGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSS 342
           L  G  + +  + V +FL  +                 +IP + +     + + ++   S
Sbjct: 253 LSQGLAFILLFIGVKLFLHALHENELPFINGGEHVKVPEIPTLLSLGVIVVTLVITTVLS 312

Query: 343 IK 344
           + 
Sbjct: 313 LM 314


>gi|194367808|ref|YP_002030418.1| Integral membrane protein TerC [Stenotrophomonas maltophilia
           R551-3]
 gi|194350612|gb|ACF53735.1| Integral membrane protein TerC [Stenotrophomonas maltophilia
           R551-3]
          Length = 320

 Score =  147 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 45/344 (13%), Positives = 105/344 (30%), Gaps = 70/344 (20%)

Query: 6   LYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISLSFEN 63
              +      W+I       L   G+ +    T    ++       L   +VE +L+ +N
Sbjct: 34  HKVTFKEALWWSIGWVALALLFNAGLWYYLNETAGQVVANKVGLEFLTGYLVEKALAVDN 93

Query: 64  AILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYS 121
             +    +         +++ L  GIL A   +R +       +++              
Sbjct: 94  IFVFLMIMSYFAVPEEQRQKVLIIGILGA-IVLRTVMIFAGSVLITQ------------- 139

Query: 122 PQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIF 181
                         +    G FL+      +F +  +                       
Sbjct: 140 -----------FHWLLYVFGAFLLFTGWKMWFAAGQEPD--------------------- 167

Query: 182 IVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLF 241
                       L  N    ++      +  + G         S   + V        + 
Sbjct: 168 ------------LEANPALRWMRKHLRLLPDYAG------NAMSVKRDGVRWFTPLFAVL 209

Query: 242 LYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEH 301
           + + + D   ++D + + FAIT + FI++       + +R+M    L  G+ +++  L +
Sbjct: 210 ILIAVTDVIFAVDSIPAIFAITTDPFIVLTSNVFAVLGLRAM--FFLLAGMADRFHLLPY 267

Query: 302 GSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           G    +  + + M +  +  IP   +     ++I  ++  S+K 
Sbjct: 268 GLALVLGFIGIKMMIIDLFKIPTPVSLGVVAVIIAATVVLSLKY 311


>gi|222054873|ref|YP_002537235.1| Integral membrane protein TerC [Geobacter sp. FRC-32]
 gi|221564162|gb|ACM20134.1| Integral membrane protein TerC [Geobacter sp. FRC-32]
          Length = 309

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 49/344 (14%), Positives = 101/344 (29%), Gaps = 74/344 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
              +          W I+      +   G+ +      +    T Y      V+E SLS 
Sbjct: 27  NRKTHEVKFREALTWTIIWISLAMIFNAGVYYFMGPVKALEFLTGY------VIEESLSV 80

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  +          +   Q + L WGIL A+  MR +F I+ + ++             
Sbjct: 81  DNLFVFIMIFSYFHVAKHHQPKILKWGILGAL-VMRGVFIILGIGLI------------- 126

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                      +    +    G  L++  +   F   + +                    
Sbjct: 127 -----------ERFHWMIYIFGGLLVVTGIKMAFGGDDHIEP------------------ 157

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                            N +   V           G  F                     
Sbjct: 158 ---------------EKNLLVRLVRKFVPVTKRVSGDRFFIRKC------GKIAATPLFL 196

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             L +E  D   ++D + +  A+T + FI+        + +RS+    L   +++ + YL
Sbjct: 197 TLLVVESSDVIFAVDSIPAVLAVTHDPFIVYTSNVFAIMGLRSL--YYLLAHVMDMFVYL 254

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + G  + +  +   M L  + ++P  F+       + ++I  S+
Sbjct: 255 KLGVSFILCFVGAKMLLGDVFEMPIYFSLGVIVGSLTIAILISV 298


>gi|117921151|ref|YP_870343.1| integral membrane protein TerC [Shewanella sp. ANA-3]
 gi|117613483|gb|ABK48937.1| Integral membrane protein TerC [Shewanella sp. ANA-3]
          Length = 325

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/352 (14%), Positives = 106/352 (30%), Gaps = 76/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       ++    + +      G L G  + W    T      T Y+       E SLS
Sbjct: 34  LHKEQHEITVAESLKLSAFYICMGLLFGAWLWWYKGSTAGMEYLTGYLI------EKSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A     +    ++Q R L WGI+  V  +R I   +   +V+           
Sbjct: 88  MDNVFVIALIFSSLGIPRLYQHRVLFWGIMG-VIVLRAIMIGLGAALVAQ---------- 136

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                         +  +    G FL+   +   F+                        
Sbjct: 137 --------------YQGVLVLFGLFLIFTGIKMLFSDDEHGD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N+ Y ++ S        +   F         S          
Sbjct: 165 ---------------IQDNKFYKWLRSKMRFTPSLHQEKFWVRGEEHQLSKG-WWATPLF 208

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E  D   ++D + + FAIT++ FI+        + +R++        ++++++Y
Sbjct: 209 LALILVETADLVFAVDSIPAIFAITQDPFIVYTSNIFAILGLRAL--YFALAAMVHRFEY 266

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD-------IPEIFTGTSSTILIFLSIYSSI 343
           L++     +  + V + L            IP   +   +  L+   +  S+
Sbjct: 267 LKYALSVVLVFIGVKVGLVYFNHEGIVDFKIPTALSLGVTFGLLLAGVLFSL 318


>gi|159038092|ref|YP_001537345.1| integral membrane protein TerC [Salinispora arenicola CNS-205]
 gi|157916927|gb|ABV98354.1| Integral membrane protein TerC [Salinispora arenicola CNS-205]
          Length = 335

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 54/347 (15%), Positives = 107/347 (30%), Gaps = 76/347 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +  ++          W+ +   AG L G+ +       ++GT    Y+       E +LS
Sbjct: 25  LHRDNHVIGFREAAIWSGIWIAAGLLFGVILWVWQGGEVAGTYYAGYLI------EKALS 78

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A         + +Q + L WG++ A+   R++F I+                 
Sbjct: 79  IDNVFIFALIFTYFAVPAAFQHKVLFWGVIGAL-VFRLVFIIVGA--------------- 122

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                     + +A    +   G FL+       F                         
Sbjct: 123 ---------ELLEAFFWTAYVFGVFLIYTGYQMAFRH----------------------- 150

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                     G       N +   V         ++G  F   +      N         
Sbjct: 151 ----------GGQTPPDQNPVVRLVRRLIPTDPRYHGDRFFTRI------NGKRVATLLF 194

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + +E  D   ++D V +  AIT + FI+        + +RS+       G+L ++ +
Sbjct: 195 VVLIAVEATDLIFAMDSVATILAITTSTFIVWTANAFAILGLRSL--YFCLAGLLRRFVH 252

Query: 299 LEHGSYYSIFVLSVIMFLQ--TIVDIPEIFTGTSSTILIFLSIYSSI 343
           L +G    +    V + L    +  +P   T       + +SI  S+
Sbjct: 253 LHYGLAALLTFAGVKLILSETPVGKLPIPVTLGVIVATLTVSIVWSL 299


>gi|145225744|ref|YP_001136422.1| integral membrane protein TerC [Mycobacterium gilvum PYR-GCK]
 gi|145218230|gb|ABP47634.1| Integral membrane protein TerC [Mycobacterium gilvum PYR-GCK]
          Length = 338

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 43/348 (12%), Positives = 95/348 (27%), Gaps = 82/348 (23%)

Query: 6   LYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAI 65
                     W++         G+                 YI       E SLS +N  
Sbjct: 32  HRVGFREATAWSVFYIAVAIGFGVWFAMTHGGDFGTEYFAGYIV------EKSLSVDNLF 85

Query: 66  LNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQ 123
           +    +         Q + LT+GI++A+  MR IF  +   ++S  + +  +   +    
Sbjct: 86  VFVIIMTTFAVPEEHQHKVLTFGIILALI-MRAIFIAVGATLLSLFSFMFLLFGLLL--- 141

Query: 124 DYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIV 183
                                +  ++  F +                             
Sbjct: 142 ---------------------IYTAIQLFRHRDEDPD----------------------- 157

Query: 184 LSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLY 243
                     +  N M             + G   L                  L + + 
Sbjct: 158 ----------VENNIMIRATRKVLPISDDYDGGRLLTRR------EGRRMATPLLAVLIA 201

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           +  +D   +LD + + F +T   +I+        + +R++    L +G+L++  YL  G 
Sbjct: 202 IGSVDLLFALDSIPAVFGVTNEPYIVFTANAFALLGLRAL--FFLVKGLLDRLVYLSTGL 259

Query: 304 YYSIFVLSVIMFLQTIV--------DIPEIFTGTSSTILIFLSIYSSI 343
              +  + V + L            +I    +      ++ +   +S+
Sbjct: 260 SIILAFIGVKLILHWGHVDINPQIPEINTYLSLVVIIGILTIVTVASL 307


>gi|149926320|ref|ZP_01914582.1| membrane protein, TerC family [Limnobacter sp. MED105]
 gi|149825138|gb|EDM84350.1| membrane protein, TerC family [Limnobacter sp. MED105]
          Length = 325

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/346 (14%), Positives = 107/346 (30%), Gaps = 69/346 (19%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +  +S    +      +        L G  + W           T +       +E SLS
Sbjct: 35  LHKDSREIEVKESLFLSAGYIGMACLFGAWVWWYLGSESGMAYFTGF------AIEKSLS 88

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A          ++Q R L WGIL  V  +R I   +   +V+  +        
Sbjct: 89  MDNVFVIAMIFTYFSIPRVYQHRVLFWGILG-VIVLRAIMIALGAALVTEFS-------- 139

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL++  +   F  ++                     
Sbjct: 140 ----------------WVLYLFGVFLVLTGIKMLFVGES--------------------- 162

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                       +  L  N +  F+           G  F     S  +           
Sbjct: 163 ------------TPDLENNPLLKFLRKRLPLTKELKGNAFWVHERSESTGKLQRVYTPLF 210

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              L +E +D   ++D V + FAIT + FI+        + +R++        ++++++Y
Sbjct: 211 LALLLIEFVDLIFAVDSVPAIFAITTDPFIVYTSNIFAILGLRAL--YFALAALIHRFRY 268

Query: 299 LEHGSYYSIFVLSVIM-FLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           L++     +  +   +  +  +  +P  F+ + +  LI   +  S+
Sbjct: 269 LKYALALVLVFIGGKIFLVNIVGKVPPEFSLSVTLGLIAGGVLFSL 314


>gi|148263215|ref|YP_001229921.1| integral membrane protein TerC [Geobacter uraniireducens Rf4]
 gi|146396715|gb|ABQ25348.1| Integral membrane protein TerC [Geobacter uraniireducens Rf4]
          Length = 310

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 56/344 (16%), Positives = 102/344 (29%), Gaps = 74/344 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
              S          W ++      L   G+ +    T +    T YI       E SLS 
Sbjct: 27  NRKSHEIRFREALTWTLVWVSLALLFNAGVYFYLGPTKALEFFTGYII------EESLSV 80

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  +          S I Q + L WGI+ A+  MR IF ++ +                
Sbjct: 81  DNLFVFIMIFSYFHISKIHQPKILKWGIIGALL-MRAIFILVGI---------------- 123

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                    + +    +    G  L++  +   F  + K+                    
Sbjct: 124 --------ELIERFHWMIYVFGGLLVITGIKMAFGGEEKIEP------------------ 157

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                            N +   V              F            +        
Sbjct: 158 ---------------EKNLLVRIVRKFVPITKRVRDDRFFIR------KGGILAATPLFL 196

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             L +E  D   ++D + +  A+T + FI+        + +RS+    L   ++  + YL
Sbjct: 197 TLLVVESSDVIFAVDSIPAVLAVTHDPFIVYTSNVFAIMGLRSL--YYLLAHVMEMFVYL 254

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + G  + +  + V M L  I  I   F+      ++ +SI +SI
Sbjct: 255 KLGISFILAFVGVKMLLTDIYHISIYFSLGMIVGVLTISILTSI 298


>gi|24373314|ref|NP_717357.1| hypothetical protein SO_1747 [Shewanella oneidensis MR-1]
 gi|24347561|gb|AAN54801.1|AE015619_3 membrane protein, putative [Shewanella oneidensis MR-1]
          Length = 325

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/352 (14%), Positives = 107/352 (30%), Gaps = 76/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       ++    + +      G L G  + W    T      T Y+       E SLS
Sbjct: 34  LHKEQHEITVAESLKLSAFYICMGLLFGAWLWWYKGSTAGMEYLTGYLI------EKSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A     +    ++Q R L WGI+  V  +R I   +   +V+           
Sbjct: 88  MDNVFVIALIFSSLGIPRLYQHRVLFWGIMG-VIVLRAIMIGLGAALVAQ---------- 136

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                         +  +    G FL+   +   F++                       
Sbjct: 137 --------------YQGVLVLFGLFLIFTGIKMLFSNDEHGD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N+ Y ++ S        +   F         S          
Sbjct: 165 ---------------IQDNKFYKWLRSKMRFTPSLHQEKFWVRGEDHQLSKG-WWATPLF 208

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E  D   ++D + + FAIT++ FI+        + +R++        ++++++Y
Sbjct: 209 LALILVETADLVFAVDSIPAIFAITQDPFIVYTSNIFAILGLRAL--YFALAAMVHRFEY 266

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD-------IPEIFTGTSSTILIFLSIYSSI 343
           L++     +  + V + L            IP   +   +  L+   +  S+
Sbjct: 267 LKYALSVVLVFIGVKVGLVYFNHEGIVDFKIPTALSLGVTFGLLLAGVLFSL 318


>gi|197119647|ref|YP_002140074.1| membrane protein [Geobacter bemidjiensis Bem]
 gi|197089007|gb|ACH40278.1| membrane protein, TerC family [Geobacter bemidjiensis Bem]
          Length = 307

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 52/344 (15%), Positives = 99/344 (28%), Gaps = 74/344 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSF 61
              S          W  +          GIG+      +    T YI       E SLS 
Sbjct: 27  NRKSHEIKFREALAWTTVWVGLALAFNAGIGYFMGPAKALEFFTGYII------EESLSV 80

Query: 62  ENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAI 119
           +N  +          S   Q + L WGI+ A+  MR IF ++ +                
Sbjct: 81  DNLFVFIMIFSYFKISKAQQPKILKWGIIGAL-VMRGIFILVGI---------------- 123

Query: 120 YSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIK 179
                    + +    +    G  L+   +   F   +++                    
Sbjct: 124 --------ELIERFHWMIYIFGGILIYTGIKMAFGGDDEVEP------------------ 157

Query: 180 IFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLN 239
                            N +   V          +   F            V        
Sbjct: 158 ---------------EKNPLVRLVRRFMPITKRIWRDRFFIKRH------GVWAATPLFL 196

Query: 240 LFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYL 299
             + +E  D   ++D + +  A+T + FI+        + +RS+    L   ++  + YL
Sbjct: 197 TLVVVESSDVIFAVDSIPAVLAVTHDPFIVYSSNIFAIMGLRSL--YYLLAHVMEMFVYL 254

Query: 300 EHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
           + G  + +  +   M L  +V+IP   +       + +SI +S+
Sbjct: 255 KLGVSFILAFVGAKMLLVDVVEIPLQLSLGFIIGTLVISILTSV 298


>gi|238753013|ref|ZP_04614471.1| Inner membrane protein alx [Yersinia rohdei ATCC 43380]
 gi|238708766|gb|EEQ01026.1| Inner membrane protein alx [Yersinia rohdei ATCC 43380]
          Length = 328

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 47/343 (13%), Positives = 110/343 (32%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  S   +L     W+++      L   G  W  T T+   ++       L   ++E +L
Sbjct: 31  RRGSQTMTLRQAACWSLVWVNLSLLFNAGFWWYLTETVGREMADKQALAFLTGYLIEKAL 90

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +VS  +       
Sbjct: 91  AVDNVFVWLMLFSYFAVPANLQRRVLIYGVLGA-IVLRTIMIFAGSWLVSQFS------- 142

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      ++                    
Sbjct: 143 -----------------WILYLFGAFLLFTGIKMAMAKEDD------------------- 166

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++ +        +G  F          N + +    
Sbjct: 167 --------------TPIGEKPLVRWIRNHLRMTDELHGDRFTVR------KNGLLYATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 207 VLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M L  +  IP   +      ++ L++ 
Sbjct: 265 MLKYGLSVILVFIGLKMMLIDLFHIPIGISLGVVAGILALTLL 307


>gi|28900711|ref|NP_800366.1| putative transmembrane transport protein [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|28809091|dbj|BAC62199.1| putative transmembrane transport protein [Vibrio parahaemolyticus
           RIMD 2210633]
          Length = 318

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 47/350 (13%), Positives = 114/350 (32%), Gaps = 74/350 (21%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFT----HTLSGTISTVYICIILAVVEI 57
           ++     ++     W+I   +  FL    I + +     H+           +   ++E 
Sbjct: 19  QTRGGAITMQKAIVWSIFWFLLAFLFAGSILFFWDVYAPHSAYSNEKATVSFLTGYLLEK 78

Query: 58  SLSFENAILNAKNLQK--MSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SLS +N  + A    +  +    + R L WG++ A+  +R I   +   +++        
Sbjct: 79  SLSVDNLFVFAIIFAQYKVPEHLRPRALLWGVIGAL-VLRAIMIAVGAQLLAQ------- 130

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                            +  +      FL+   +    +   +     + E         
Sbjct: 131 -----------------YHWVLYLFAAFLIWTGIKLARDKGEEEEVNPYPE--------- 164

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                                      +         + G +                  
Sbjct: 165 -------------------------QVIRKLLPVTDEYQGNHMF------LKQAGKWVAT 193

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L +   + ++D   +LD + + FA+T+  F+++       + +RS+    + Q +L+K
Sbjct: 194 PMLIVVGVIAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSL--YFVLQAMLDK 251

Query: 296 YKYLEHGSYYSIFVLSVIMFL-QTIVDIPEIFTGTSSTILIFLSIYSSIK 344
           + YL+      +  + V M L  T  +IP I++ T   +++  ++ +S+ 
Sbjct: 252 FVYLKPALSVIMMFIGVKMLLVGTEYEIPTIWSLTFLILVMTSAVVASVY 301


>gi|300785089|ref|YP_003765380.1| tellurite resistance protein TerC [Amycolatopsis mediterranei U32]
 gi|299794603|gb|ADJ44978.1| tellurite resistance protein TerC [Amycolatopsis mediterranei U32]
          Length = 307

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/343 (13%), Positives = 108/343 (31%), Gaps = 74/343 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +    +     W+    V G   G  + W +    +G     Y      V+E SL+ +
Sbjct: 27  RKTPVVGVRSALAWSGAWVVLGLAFGAVVWWVWGAEFAGQYFAGY------VIEKSLAVD 80

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L +G++ A+   R +F      +++             
Sbjct: 81  NVFVFAIIFGYFAVPREYQHRILFYGVVGAL-VFRAVFIAAGSVLIA------------- 126

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      +   I    G FL++  +    +    +                     
Sbjct: 127 -----------SFAWILYVFGAFLVITGVRMALHRDETVD-------------------- 155

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +         +    +G  FL                  L +
Sbjct: 156 -------------YEQNVVLRAFRRIVPSTDGDHGGKFLVR------QAGRWVATPLLAV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E+ D   ++D + + FA+T+  F++        + +R+M    L   +++++ YL+
Sbjct: 197 LVLIEVTDVVFAVDSIPAIFAVTQEPFLVFTSNAFAVLGLRAM--YFLLADVMHRFVYLK 254

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSI 343
            G    +  + V M L  +  IP + +      ++  ++ +S+
Sbjct: 255 LGLALVLVWVGVKMLLLDVWKIPTVLSLGVVGAILATAVTASL 297


>gi|284799903|ref|ZP_05985164.2| protein Alx [Neisseria subflava NJ9703]
 gi|284796567|gb|EFC51914.1| protein Alx [Neisseria subflava NJ9703]
          Length = 314

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 47/350 (13%), Positives = 102/350 (29%), Gaps = 71/350 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEI 57
           K+ +   S+     W+ +           + ++     +                 V+E 
Sbjct: 23  KNGAHKVSIKEALAWSGIWVAVSCAFAGWLYFELAGNPTYGAVVAKEKVLEFFTGYVLEK 82

Query: 58  SLSFENAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAM 115
           SL+ +N  +             +Q R L +G+  A   +R I   +   +V         
Sbjct: 83  SLAVDNIFVFLMIFGYFKVEPKFQHRVLLYGVFGA-IVLRAIMIFIGAALV--------- 132

Query: 116 NLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKI 175
                          Q    I    G FL+   +                          
Sbjct: 133 ---------------QQFEWILYLFGAFLLYTGIHMMKPEAE------------------ 159

Query: 176 KGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGK 235
                             L  N++ + +         F G  F          N      
Sbjct: 160 --------------AEEDLSQNKILTLLKKVIPTSQQFDGEKFFT------LENGKRIAT 199

Query: 236 HGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNK 295
             L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L      +
Sbjct: 200 PLLLVLIMIELSDVIFAVDSIPAIFAVTTDPFIVLTSNIFAILGLRAM--YFLLADFAER 257

Query: 296 YKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           + +L++G  + +  + + M +   V I    + +     +  SI +S+  
Sbjct: 258 FIFLKYGLAFVLSFIGIKMLIMHWVHITISISLSVVFGALGASILTSLVY 307


>gi|104782098|ref|YP_608596.1| hypothetical protein PSEEN3035 [Pseudomonas entomophila L48]
 gi|95111085|emb|CAK15805.1| conserved hypothetical protein; putative membrane protein, TerC
           family [Pseudomonas entomophila L48]
          Length = 333

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/333 (14%), Positives = 97/333 (29%), Gaps = 68/333 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                  +             G L G  +  +     +    T ++       E SLS +
Sbjct: 40  RQEREIEMRESLLLYAGYFSVGVLFGAWVWHELGAQAALEFYTGFLV------EQSLSMD 93

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L WGIL  V  +R I   +   +V              
Sbjct: 94  NVFVMAMIFSFFAIPRRYQHRVLFWGILG-VVVLRAIMIGVGAALV-------------- 138

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     Q    +    G FL+   +       +                       
Sbjct: 139 ----------QHFAWVLYIFGAFLLFTGVKMALAKDD----------------------- 165

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                        L  N +  FV          +G  F   +    ++  + +       
Sbjct: 166 ---------AHPDLANNPVLRFVRRHMRVTEQIHGPRFFVRLTPPGATRAIRYATPLFLA 216

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +E+ D   ++D V + FAIT++ FI+        + +RS+        +++++ YL+
Sbjct: 217 LVLIELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRSL--YFALAALMHRFIYLK 274

Query: 301 HGSYYSIFVLSVIMFLQTIV-DIPEIFTGTSST 332
           +     +  +   +F   +V  +P   +   + 
Sbjct: 275 YALAMVLIFIGCKIFYHGLVGKVPAALSLGVTF 307


>gi|308177708|ref|YP_003917114.1| hypothetical protein AARI_19240 [Arthrobacter arilaitensis Re117]
 gi|307745171|emb|CBT76143.1| hypothetical membrane protein [Arthrobacter arilaitensis Re117]
          Length = 379

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 42/363 (11%), Positives = 100/363 (27%), Gaps = 95/363 (26%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+     +  +      + G  + WQ    L       +I       E +LS
Sbjct: 69  VTKRPHIPSMKEAGIFVSVYIGLAIVFGGLVWWQAGPQLGQEFYAGWIT------EYALS 122

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + +      +Q+  L +GI+IA+    I   +                  
Sbjct: 123 VDNLFVFIIIMARFSVPRKYQQEVLMFGIIIALILRAIFIVL------------------ 164

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                     I +    +    G FL+  +     +                        
Sbjct: 165 -------GAAIIEQWSWVFYIFGAFLLWTAWNQLKDEDED-------------------- 197

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             + +   +++       F G      V      +        +
Sbjct: 198 ----------------DESGLVKKLTAKMPISKEFDGAKLRTVV------DGKKLFTPMV 235

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            +F+ + + D   + D + + F +TK+ FI+        + +R +    L  G++N+  +
Sbjct: 236 LVFVTIGMTDLLFAFDSIPAIFGLTKSAFIVFTANIFALMGLRQL--YFLLGGLMNRLVF 293

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD------------------IPEIFTGTSSTILIFLSIY 340
           L+H   + +  + V +    + +                  I    +       I ++  
Sbjct: 294 LKHALSFILAFIGVKLVFHALHENNLPFINGGQPLDYAWLDISVGLSLLVILGAIVIATV 353

Query: 341 SSI 343
            S+
Sbjct: 354 MSL 356


>gi|260575495|ref|ZP_05843494.1| Integral membrane protein TerC [Rhodobacter sp. SW2]
 gi|259022415|gb|EEW25712.1| Integral membrane protein TerC [Rhodobacter sp. SW2]
          Length = 333

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 44/346 (12%), Positives = 102/346 (29%), Gaps = 71/346 (20%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
            +     +    + + L    G   G  +  Q     +    T ++       E +L+ +
Sbjct: 37  KSDHEIGVTESLKLSALYISLGVGFGGFVWLQLGAQPAAEYLTAFVV------EKTLALD 90

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L WGIL  V  +R +   +   +V+             
Sbjct: 91  NIFVIALIFSYFAIPRQYQHRVLFWGILG-VIVLRGLMIGLGATLVAQYG---------- 139

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +      FL+   +      +  +                     
Sbjct: 140 --------------WLLYVFAAFLIFTGVKMLVTDEEDMD-------------------- 165

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                        L  N +  F+          +G  F     ++ +   V         
Sbjct: 166 -------------LSANPVLRFMRKHFRVTPGLHGSRFFVKAPAAGTGAMVRQMTPLFLA 212

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +EI D   ++D V + FAIT + +I+        + +R++        +L+++ YL+
Sbjct: 213 LVLIEIADLVFAVDSVPAVFAITTDPYIVYTSNIFAILGLRAL--YFALAAVLHRFHYLK 270

Query: 301 HGSYYSIFVLSVIMFLQT---IVDIPEIFTGTSSTILIFLSIYSSI 343
           +     +  +   +F+         P  ++   +  ++   +  S+
Sbjct: 271 YALAILLVFIGSKIFVADMMGWQKFPASWSLGITFAILTAGVAVSL 316


>gi|226306223|ref|YP_002766183.1| hypothetical protein RER_27360 [Rhodococcus erythropolis PR4]
 gi|226185340|dbj|BAH33444.1| conserved hypothetical membrane protein [Rhodococcus erythropolis
           PR4]
          Length = 326

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 44/359 (12%), Positives = 107/359 (29%), Gaps = 87/359 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +      W+ +      + GL + W +  T  G     Y+       E +LS +
Sbjct: 28  RTPHAPTFRESAFWSTVYISIAIVFGLVVMWIWGTTYGGEYFAGYVT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI++A+  MR IF  +    ++             
Sbjct: 82  NLFVFVIIMSTFAVPREFQQKVLLIGIVLAL-VMRGIFIGVGAAAIN------------- 127

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A+  +    G FL+  + T   +  ++                      
Sbjct: 128 -----------AYSWVFYLFGAFLIYTAYTLIRDHGHEKE-------------------- 156

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                     +     + + S V         + G   +  +      +        L  
Sbjct: 157 ----------AEEKRDSRIISLVKRVLPTTEEYDGDKLITRI------DGRRVVTPLLLA 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + + +T+  +++        + +R +    L  G+L +  YL 
Sbjct: 201 LIAIGFADVLFALDSIPAIYGLTQEPYLVFTANAFALMGLRQL--YFLIGGLLERLVYLS 258

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +                 +I    +      ++ ++  +S+
Sbjct: 259 YGLSIILAFIGVKLVLHALHENTLSFVNGGEHVSVPEISTALSLGVIIGVLAVTTVASL 317


>gi|304396889|ref|ZP_07378769.1| Integral membrane protein TerC [Pantoea sp. aB]
 gi|304355685|gb|EFM20052.1| Integral membrane protein TerC [Pantoea sp. aB]
          Length = 322

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 43/343 (12%), Positives = 104/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S      W+++      L      W    ++   ++       L   V+E +L
Sbjct: 30  RRGAQTMSFKQAAVWSLIWVSVSLLFSAAFWWYLEGSVGREVANTQTLAFLTGYVLEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +V+  +       
Sbjct: 90  AVDNVFVWLMLFSYFSIPANLQRRVLIYGVLGA-IVLRTIMIFAGSWLVTQFS------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      ++                    
Sbjct: 142 -----------------WILYVFGAFLLFTGVKMALAKEDD------------------- 165

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                         + +    +  ++           G  F          N V      
Sbjct: 166 --------------SAVGDKPVVRWLRKHLRMTDDLDGEKFFTR------KNGVLFATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 206 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  +   M +  +  IP   +    + ++  ++ 
Sbjct: 264 MLKYGLAIVLVFIGFKMLIVDLYHIPVGISLGVVSAILASTLL 306


>gi|229490871|ref|ZP_04384706.1| putative membrane protein [Rhodococcus erythropolis SK121]
 gi|229322261|gb|EEN88047.1| putative membrane protein [Rhodococcus erythropolis SK121]
          Length = 324

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 44/359 (12%), Positives = 107/359 (29%), Gaps = 87/359 (24%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +      W+ +      + GL + W +  T  G     Y+       E +LS +
Sbjct: 26  RTPHAPTFRESAFWSTVYISIAIVFGLVVMWIWGTTYGGEYFAGYVT------EKALSVD 79

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI++A+  MR IF  +    ++             
Sbjct: 80  NLFVFVIIMSTFAVPREFQQKVLLIGIVLAL-VMRGIFIGVGAAAIN------------- 125

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      A+  +    G FL+  + T   +  ++                      
Sbjct: 126 -----------AYSWVFYLFGAFLIYTAYTLIRDHGHEKE-------------------- 154

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                     +     + + S V         + G   +  +      +        L  
Sbjct: 155 ----------AEEKRDSRIISLVKRVLPTTEEYDGDKLITRI------DGKRVVTPLLLA 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   +LD + + + +T+  +++        + +R +    L  G+L +  YL 
Sbjct: 199 LIAIGFADVLFALDSIPAIYGLTQEPYLVFTANAFALMGLRQL--YFLIGGLLERLVYLS 256

Query: 301 HGSYYSIFVLSVIMFLQTIV----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  + V + L  +                 +I    +      ++ ++  +S+
Sbjct: 257 YGLSIILAFIGVKLVLHALHENTLSFVNGGEHVSVPEISTALSLGVIIGVLAVTTVASL 315


>gi|223939076|ref|ZP_03630960.1| Integral membrane protein TerC [bacterium Ellin514]
 gi|223892236|gb|EEF58713.1| Integral membrane protein TerC [bacterium Ellin514]
          Length = 330

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/325 (15%), Positives = 96/325 (29%), Gaps = 74/325 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
             +   S+     W  +      L    + +      +    T Y       +E+SLS +
Sbjct: 32  KQAHVVSVKEALGWTAVWVTLALLFAFSLIFLRGRKEALEFFTGY------FIEVSLSMD 85

Query: 63  NAILNAKNLQKMS--SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  + A           +Q R L WGIL A+  MR +     V +++  +          
Sbjct: 86  NVFVIALIFGYFKVAPQFQHRVLFWGILGALI-MRGLMIWAGVELITRFD---------- 134

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL++  +    + +  +H                    
Sbjct: 135 --------------WLLYIFGAFLVLTGIKMLLSKEESVHP------------------- 161

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           + +             F G NFL  V      N          +
Sbjct: 162 --------------EKSWIVRGAKKLLPVSSDFDGQNFLTRV------NGRRMLTPLFLV 201

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +E  D   ++D + + F +T+  FI+        + +RSM    +  G +  ++YL+
Sbjct: 202 LLMVETTDLIFAVDSIPAIFGVTRKPFIVFTSNVFAILGLRSM--YFVLAGAIGLFRYLK 259

Query: 301 HGSYYSIFVLSVIMFLQTIVDIPEI 325
            G    +  + V M +      P  
Sbjct: 260 VGLSVVLVFIGVKMLIDPHDKPPHW 284


>gi|229820671|ref|YP_002882197.1| Integral membrane protein TerC [Beutenbergia cavernae DSM 12333]
 gi|229566584|gb|ACQ80435.1| Integral membrane protein TerC [Beutenbergia cavernae DSM 12333]
          Length = 330

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 44/360 (12%), Positives = 108/360 (30%), Gaps = 90/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +L     W++         GL +   +    +G     Y+       E SLS +
Sbjct: 28  RKPHAPTLRESAWWSVAYIAIALAFGLLVWIGWGAGFAGEYYAGYLT------EKSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q++ L  GI+IA+  +R +F ++   +V+  +          
Sbjct: 82  NLFVFVLIMGSFAVPREYQQKVLFVGIIIAL-VLRTVFILLGAELVNNFS---------- 130

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          I    G FL+  ++    ++ ++                      
Sbjct: 131 --------------WIFYVFGAFLIWTAVAQARHTGHEGDEQR----------------- 159

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   V         + G             ++  H    L +
Sbjct: 160 ---------------ENALVRVVRRLLPTTEDYVGDRIFVR------HDHRWHITPMLVV 198

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   ++D + + F +T+  ++I        + +R +    L  G+L++  YL 
Sbjct: 199 MVAIGSADILFAVDSIPAIFGLTQEVYLIFAANAFSLLGLRQL--FFLIDGLLDRLVYLN 256

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           +G    +  +   + +  +                  +IP   +     + + ++  +S+
Sbjct: 257 YGLAAILAFIGAKLVIHAMHENELPFINGGEHIEVIPEIPTALSLVFIVVTLAITTVASL 316


>gi|260578899|ref|ZP_05846804.1| tellurium resistance protein [Corynebacterium jeikeium ATCC 43734]
 gi|258602989|gb|EEW16261.1| tellurium resistance protein [Corynebacterium jeikeium ATCC 43734]
          Length = 348

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 41/323 (12%), Positives = 88/323 (27%), Gaps = 76/323 (23%)

Query: 6   LYASLIHHFRWAILVTVAGFLCGLGIGWQFT-----HTLSGTISTVYICIILAVVEISLS 60
              S+     W++       L G  +   +      H         YI       E +LS
Sbjct: 40  HEPSIKESALWSLFYVALACLFGGFLWLTWGEPGNPHQHGLEFFAGYIT------EKALS 93

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A  L        +Q++ L  GI +A+  +R IF  +   I+            
Sbjct: 94  MDNLFIFALILSSFKIPRKYQQKVLLIGIALALI-LRGIFIALGAAII------------ 140

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                       +A   +    G FL+  +    ++  +                     
Sbjct: 141 ------------EAWSDVFYLFGLFLLWTAAKLLWDEVSGEE------------------ 170

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                               +             +               N         
Sbjct: 171 ------------EKDPQDMMVIKMTRKFIHVSDHYESDRLWF------KENGKRVLTPLF 212

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +  +D   +LD + + + IT   +I+     +  + +R +    L  G+L +  Y
Sbjct: 213 IALVAIGFVDVLFALDSIPAIYGITSEPYIVFTTNALALMGLRQL--YFLLDGLLERLVY 270

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD 321
           L +G +  +  +   + L  + +
Sbjct: 271 LGYGLFIILAFIGTKLILHALHE 293


>gi|297204162|ref|ZP_06921559.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|197714157|gb|EDY58191.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 322

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/353 (15%), Positives = 111/353 (31%), Gaps = 78/353 (22%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+     W ++  V   L GLG+        +G     YI       E SLS
Sbjct: 25  IGRKPHDVSVKEAGVWTVVWVVLACLFGLGLLLFGGGKPTGEFFAGYIT------EKSLS 78

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + K    S +Q+R L  G+++A+                           
Sbjct: 79  VDNLFVFVLIMGKFAVPSQYQQRVLMVGVVMALVLR------------------------ 114

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                     I  A   +    G FL+  +     +++   H   + E            
Sbjct: 115 -AGFIAAGAAIISAFSWVFYLFGAFLIWTAWKLVQDARKDGHDEAYEE------------ 161

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                             N++   V         ++G             N        L
Sbjct: 162 ------------------NKLLKLVERRFGVADRYHGTKLWI------EQNGKRVMTPML 197

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +   D   +LD + + + +T++ +I+        + +R +    L  G+L K  +
Sbjct: 198 VVMLAIGSTDVLFALDSIPAIYGLTQDPYIVFTANAFALMGLRQL--YFLIGGLLKKLVH 255

Query: 299 LEHGSYYSIFVLSVIMFLQTIV----DIPEI---FTGTSSTILIFLSIYSSIK 344
           L +G    +  + V + L  +      +PEI   F+     +++ ++  +S++
Sbjct: 256 LSYGLSIILGFIGVKLVLHALHESGVHVPEISIPFSLGFIVLVLTVTTLTSLR 308


>gi|146292551|ref|YP_001182975.1| integral membrane protein TerC [Shewanella putrefaciens CN-32]
 gi|145564241|gb|ABP75176.1| Integral membrane protein TerC [Shewanella putrefaciens CN-32]
          Length = 328

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 49/352 (13%), Positives = 106/352 (30%), Gaps = 76/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       ++    + +      G L G  + W  + T      T Y+       E SLS
Sbjct: 34  LHKEQHEITVAESLKLSAFYICMGLLFGAWLWWYKSPTAGMEYLTGYLI------EKSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A     +    ++Q R L WGI+  V  +R I       +V+           
Sbjct: 88  MDNVFVIALIFSSLGIPRLYQHRVLFWGIMG-VIVLRAILIGFGAVLVAQ---------- 136

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                         +  +    G FL+   +   F+                        
Sbjct: 137 --------------YQAVLVLFGVFLIFTGVKMLFSKDEHRD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N+ Y ++ +        +   F         S          
Sbjct: 165 ---------------IADNKFYKWLRTKMRFTPTLHYEKFWVRGEDHQLSKG-WWATPLF 208

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E  D   ++D + + FAIT++ FI+        + +R++        ++++++Y
Sbjct: 209 LALILVETADLVFAVDSIPAIFAITQDPFIVYTSNIFAILGLRAL--YFALAAMVHRFEY 266

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD-------IPEIFTGTSSTILIFLSIYSSI 343
           L++     +  + V + L            IP   +   +  L+   +  S+
Sbjct: 267 LKYALSVVLVFIGVKVGLVYFNHEGIVDFTIPTAVSLGVTFGLLVAGVLYSL 318


>gi|146300098|ref|YP_001194689.1| integral membrane protein TerC [Flavobacterium johnsoniae UW101]
 gi|146154516|gb|ABQ05370.1| Integral membrane protein TerC [Flavobacterium johnsoniae UW101]
          Length = 324

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 53/351 (15%), Positives = 105/351 (29%), Gaps = 72/351 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYIC------IILAVV 55
                  S     +W ++     FL    I W +T         +         I   ++
Sbjct: 23  NKTPHIISTKEASKWTLIWVTLSFLFSGVIYWLYTTDYIENPDGLKPAVASMKFITGYLI 82

Query: 56  EISLSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIE 113
           E+SLS +N  + A           +Q R L WGIL A+    ++                
Sbjct: 83  ELSLSVDNIFVIAIIFASFKIPQKYQHRVLFWGILGAIVFRGLMIFF------------- 129

Query: 114 AMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLS 173
                         ++       +   G FL+  ++   F+ + +               
Sbjct: 130 ------------GVMLINKFAWTTYIFGIFLIFTAVKMLFSGEEED-------------- 163

Query: 174 KIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTH 233
                                  + +Y  +           G  F        +      
Sbjct: 164 ------------------FHPKDSFVYKALGKIIPITSEMDGEKFFI-----LTEKGKKA 200

Query: 234 GKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
                   + +E++D   ++D V +  AITK+ F++        + +RSM        +L
Sbjct: 201 ATPLFVALIVIEVMDVLFAVDSVPAILAITKDPFLVFSSNIFAILGLRSM--YFFLANML 258

Query: 294 NKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIK 344
            K+ YLE+     +  + + M L   + +PE  +     + + + I  S+K
Sbjct: 259 AKFSYLEYSLVAILAFVGLKMLLHDWIHVPEWASLGFIALSLLVGILVSLK 309


>gi|259907239|ref|YP_002647595.1| Membrane protein Alx [Erwinia pyrifoliae Ep1/96]
 gi|224962861|emb|CAX54335.1| Membrane protein Alx [Erwinia pyrifoliae Ep1/96]
 gi|283477050|emb|CAY72942.1| putative TerC family transporter [Erwinia pyrifoliae DSM 12163]
 gi|310765270|gb|ADP10220.1| Membrane protein Alx [Erwinia sp. Ejp617]
          Length = 326

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 45/343 (13%), Positives = 109/343 (31%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   S+     W++L      L      W  T T+   ++       L   ++E +L
Sbjct: 30  RRGAHTMSMKQAAAWSLLWVTLSLLFNAAFWWYLTGTVGREVADTQALAFLTGYLIEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A+  +R I       +V+  +       
Sbjct: 90  AVDNVFVWLMLFGYFAVPAALQRRVLIYGVLGAII-LRTIMIFAGSWLVTQFS------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +    + ++                    
Sbjct: 142 -----------------WLLYLFGAFLLFTGIKMALSKEDD------------------- 165

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                         + +    +  ++           G +F          N +      
Sbjct: 166 --------------SAIGDKPLVRWLRGRLRMTDKIEGEHFFVRR------NGLLFATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 206 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + V M +     IP   +      ++ L++ 
Sbjct: 264 MLKYGLSVILVFIGVKMLIVDFYHIPIAVSLGIVGGILALTLL 306


>gi|218886337|ref|YP_002435658.1| integral membrane protein TerC [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757291|gb|ACL08190.1| Integral membrane protein TerC [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 338

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 52/348 (14%), Positives = 105/348 (30%), Gaps = 77/348 (22%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       SL      ++         G G+             T Y+       E SLS
Sbjct: 25  LHRKDKEMSLSGALWMSLAYFALALAFGGGVFMFMGEQKGLEYITGYLI------EKSLS 78

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +           +  Q R L WGIL A+  MR    +    I++           
Sbjct: 79  VDNIFVFVLVFTHFAVPAALQYRVLFWGILGAL-AMRAGLILAGAAILN----------- 126

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                        A   +    G FL++  +     + ++                    
Sbjct: 127 -------------AFHWVIYVFGGFLVITGIKMLLAADSEPD------------------ 155

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          L  N +             + G +F+         N + H    L
Sbjct: 156 ---------------LSGNRVVRLFRRHFRLTEGYEGGHFVVR------KNGLLHATPLL 194

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + + +E  D   +LD + + FA++ + FI+        + +R++       G++++++Y
Sbjct: 195 VVLVIIEFSDLVFALDSIPAIFAVSTDPFIVYTSNVFAILGLRAL--YFALAGVIHRFRY 252

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD---IPEIFTGTSSTILIFLSIYSSI 343
           L++G    +  +   M +    D   I        +  +I  S+  S+
Sbjct: 253 LKYGLSLVLVFIGAKMIVNAAFDAKIISTGAALLVTFGIIAGSMLISM 300


>gi|319425853|gb|ADV53927.1| Integral membrane protein TerC [Shewanella putrefaciens 200]
          Length = 328

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 49/352 (13%), Positives = 106/352 (30%), Gaps = 76/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       ++    + +      G L G  + W  + T      T Y+       E SLS
Sbjct: 34  LHKEQHEITVAESLKLSAFYICMGLLFGAWLWWYKSPTAGMEYLTGYLI------EKSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A     +    ++Q R L WGI+  V  +R I       +V+           
Sbjct: 88  MDNVFVIALIFSSLGIPRLYQHRVLFWGIMG-VIVLRAILIGFGAVLVAQ---------- 136

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                         +  +    G FL+   +   F+                        
Sbjct: 137 --------------YQAVLVLFGVFLIFTGVKMLFSKDEHRD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N+ Y ++ +        +   F         S          
Sbjct: 165 ---------------IAENKFYKWLRTKMRFTPTLHYEKFWVRGEDHQLSKG-WWATPLF 208

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E  D   ++D + + FAIT++ FI+        + +R++        ++++++Y
Sbjct: 209 LALILVETADLVFAVDSIPAIFAITQDPFIVYTSNIFAILGLRAL--YFALAAMVHRFEY 266

Query: 299 LEHGSYYSIFVLSVIMFLQTIVD-------IPEIFTGTSSTILIFLSIYSSI 343
           L++     +  + V + L            IP   +   +  L+   +  S+
Sbjct: 267 LKYALSVVLVFIGVKVGLVYFNHEGIVDFTIPTAVSLGVTFGLLVAGVLYSL 318


>gi|238760545|ref|ZP_04621678.1| Inner membrane protein alx [Yersinia aldovae ATCC 35236]
 gi|238701226|gb|EEP93810.1| Inner membrane protein alx [Yersinia aldovae ATCC 35236]
          Length = 328

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 46/343 (13%), Positives = 109/343 (31%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  S   +L     W+++      L   G  W    T+   I+       L   ++E +L
Sbjct: 31  RRGSQTMTLRQAACWSLVWVSLSLLFNAGFWWYLAETVGREIADKQALAFLTGYLIEKAL 90

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +VS  +       
Sbjct: 91  AVDNVFVWLMLFSYFAVPANLQRRVLIYGVLGA-IVLRTIMIFAGSWLVSQFS------- 142

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      ++                    
Sbjct: 143 -----------------WILYLFGAFLLFTGIKMALAKEDD------------------- 166

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++ +        +G  F+         N + +    
Sbjct: 167 --------------TPIGEKPLVRWIRNHLRMTDELHGDRFIVR------KNGLIYATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 207 VLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  +   M +  +  IP   +      ++ L++ 
Sbjct: 265 MLKYGLAVILVFIGTKMMIIDLFHIPIGISLGVVAGILALTLL 307


>gi|170765628|ref|ZP_02900439.1| protein Alx [Escherichia albertii TW07627]
 gi|170124774|gb|EDS93705.1| protein Alx [Escherichia albertii TW07627]
          Length = 321

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 40/343 (11%), Positives = 105/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   ++     W+++      L      W    T    ++       L   ++E SL
Sbjct: 30  RRGAHAMTMKQAAAWSLVWVTLSLLFNAAFWWYLVQTQGREVADPQALAFLTGYLIEKSL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R +       ++S  +       
Sbjct: 90  AVDNVFVWLMLFSYFSVPAALQRRVLVYGVLGA-IVLRTVMIFTGSWLISQFD------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      +++                   
Sbjct: 142 -----------------WILYIFGAFLLFTGVKMALAHEDESG----------------- 167

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++             +F          N + +    
Sbjct: 168 ----------------IGDKPLVRWLRGHLRMTDTIDNEHFFVR------KNGLLYATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 206 MLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLAGVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ ++  
Sbjct: 264 MLKYGLAVILVFIGIKMLIVDFYHIPIAVSLGVVFGILVITFI 306


>gi|145221997|ref|YP_001132675.1| integral membrane protein TerC [Mycobacterium gilvum PYR-GCK]
 gi|315446263|ref|YP_004079142.1| hypothetical protein Mspyr1_47660 [Mycobacterium sp. Spyr1]
 gi|145214483|gb|ABP43887.1| Integral membrane protein TerC [Mycobacterium gilvum PYR-GCK]
 gi|315264566|gb|ADU01308.1| membrane protein TerC, possibly involved in tellurium resistance
           [Mycobacterium sp. Spyr1]
          Length = 348

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 39/344 (11%), Positives = 94/344 (27%), Gaps = 91/344 (26%)

Query: 19  LVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--SS 76
           +        G+                 ++       E SLS +N  +    +       
Sbjct: 44  IYIALAIAFGVWTWTFHGSEYGVEFFAGWLT------EYSLSVDNLFIFLIIMASFKVPR 97

Query: 77  IWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPI 136
           I+Q++ L  GI++A+   R IF  +    +                        +    +
Sbjct: 98  IYQQQALLVGIILALI-FRGIFIALGAVAI------------------------EQFSWV 132

Query: 137 SGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPT 196
               G FL+  ++                                    +     +    
Sbjct: 133 FYLFGAFLLYTAIKL----------------------------------VKDTDHDDDGD 158

Query: 197 NEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGV 256
           N +  F          + G+            N          + + L   D   +LD +
Sbjct: 159 NAVVRFAQKRMKFTDTWDGLRLWVH------ENGQRLMTPMFLVIVALGTTDLLFALDSI 212

Query: 257 ISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFL 316
            + + +T+  +++        + +R +    L   +L +  YL  G  + +F + V + L
Sbjct: 213 PAIYGLTQEPYLVFTANVFALMGLRQL--YFLLGDLLKRLVYLSQGLAFILFFIGVKLVL 270

Query: 317 QTIV----------------DIPEIFTGTSSTILIFLSIYSSIK 344
             +                 +IP + +     + + ++  +S+ 
Sbjct: 271 HALHENEVPFINGGENVPVPEIPTLLSLGVIIVTLLITTVASLY 314


>gi|238795170|ref|ZP_04638758.1| Inner membrane protein alx [Yersinia intermedia ATCC 29909]
 gi|238725492|gb|EEQ17058.1| Inner membrane protein alx [Yersinia intermedia ATCC 29909]
          Length = 328

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 44/343 (12%), Positives = 108/343 (31%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   +L     W+++      L   G  W    T+   ++       L   ++E +L
Sbjct: 31  RRGAQTMTLRQAACWSLVWVSLSLLFNAGFWWYLAETVGREVADKQALAFLTGYLIEKAL 90

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +VS  +       
Sbjct: 91  AVDNVFVWLMLFSYFAVPANLQRRVLIYGVLGA-IVLRTIMIFAGSWLVSQFS------- 142

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      ++                    
Sbjct: 143 -----------------WILYLFGAFLLFTGIKMALAKEDD------------------- 166

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++ +        +G  F          N + +    
Sbjct: 167 --------------TPIGEKPLVRWIRNHLRMTDELHGDRFTVR------KNGLLYATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 207 VLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  +   M +  +  IP   +      ++ L++ 
Sbjct: 265 MLKYGLSVILVFIGTKMMIIDLFHIPIGISLGVVAGILALTLL 307


>gi|93005908|ref|YP_580345.1| integral membrane protein TerC [Psychrobacter cryohalolentis K5]
 gi|92393586|gb|ABE74861.1| Integral membrane protein TerC [Psychrobacter cryohalolentis K5]
          Length = 315

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 54/349 (15%), Positives = 109/349 (31%), Gaps = 69/349 (19%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEIS 58
           +K+     S+     W+I       L   G+ W     L   ++       +   ++E S
Sbjct: 23  VKNQHQPVSIKLAALWSIAWVSVSALFAGGLWWYLNANLGTAVANQKTLEFVTGYLIEKS 82

Query: 59  LSFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMN 116
           L+ +N  +              Q+R L +G++ A   +R IF +    ++          
Sbjct: 83  LAIDNVFVWLMIFGAFAVPPALQRRILLYGVIGA-IVLRTIFILAGAWLI---------- 131

Query: 117 LAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIK 176
                         Q    I    G FL+     F     ++                  
Sbjct: 132 --------------QEFSWILYIFGAFLVYTGYKFLKGGHDEP----------------- 160

Query: 177 GIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKH 236
                            L   ++  ++           G  FL         N +     
Sbjct: 161 ---------------VDLEEMKLLKWLRRHMRITPTMRGEKFLVR------ENGLLWATP 199

Query: 237 GLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKY 296
            L + + +EI D   ++D + + FAIT + FI++       + +R+M    L  G     
Sbjct: 200 MLVVLILVEISDVIFAVDSIPAIFAITTDPFIVLSANLFAILGLRAM--FFLLAGAAATM 257

Query: 297 KYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
            YL +G    +  + + M L  +  +P   + +   I++ ++   S + 
Sbjct: 258 HYLPYGLGVIMTFIGIKMLLLEVYHVPIAASLSFIAIVLVITALMSWRY 306


>gi|116670618|ref|YP_831551.1| integral membrane protein TerC [Arthrobacter sp. FB24]
 gi|116610727|gb|ABK03451.1| Integral membrane protein TerC [Arthrobacter sp. FB24]
          Length = 362

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 46/360 (12%), Positives = 105/360 (29%), Gaps = 91/360 (25%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     W         +    +         G     ++       E SLS +
Sbjct: 49  RRPHEPSMKEAGLWVTFYVALALVFAGAMFAFTGPEFGGQFVAGWVT------EYSLSID 102

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + +      +Q+  L  GI+IA+  +R IF ++   ++              
Sbjct: 103 NLFVFIIIMARFSVPRKYQQEVLMVGIIIALI-LRGIFILLGAIVI-------------- 147

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                     +    +    G FL+  +                                
Sbjct: 148 ----------EQFSWVFYIFGAFLLWTAWKQ----------------------------- 168

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
               +   G       N + + +         F G     +V      +        L +
Sbjct: 169 ----AQDEGEDEEDKENPLIAKLRKVIPMSEKFDGGKLRTTV------DGKKVFTPMLIV 218

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
           F+ + + D   ++D + + F +T++ FI+        + +R +    L  G++N+  YL+
Sbjct: 219 FVTIGLTDLLFAVDSIPAIFGLTQSPFIVFTANLFALMGLRQL--YFLLGGLMNRLIYLK 276

Query: 301 HGSYYSIFVLSVIMFLQTIV-----------------DIPEIFTGTSSTILIFLSIYSSI 343
           H   + +  + V + L  +                  +IP   +       I +++ +S+
Sbjct: 277 HALSFILAFIGVKLVLHAMHVNELPFINGGKHIEWAPEIPTFVSLAVIVGTIIVAVIASL 336


>gi|325127267|gb|EGC50205.1| integral membrane protein TerC family protein [Neisseria
           meningitidis N1568]
          Length = 275

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 45/332 (13%), Positives = 100/332 (30%), Gaps = 71/332 (21%)

Query: 20  VTVAGFLCGLGIGWQFTHTLSGTISTV----YICIILAVVEISLSFENAILNAKNLQKMS 75
                 L    + ++         +             ++E SL+ +N  +         
Sbjct: 2   WVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEKSLAVDNIFVFLMIFGYFK 61

Query: 76  --SIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAH 133
               +Q R L +G+L A+  +R +   +   +V                        Q  
Sbjct: 62  VAPQFQHRVLLYGVLGAL-VLRTVMIFVGAALV------------------------QQF 96

Query: 134 VPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNI 193
             I    G FL+   +       ++                                   
Sbjct: 97  EWILYLFGAFLLYTGIHMMKPEGDEE--------------------------------GD 124

Query: 194 LPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSL 253
           L  + + + V         F+G  F          N          + + +E+ D   ++
Sbjct: 125 LANSRLLNAVKKVVPVGTEFHGEKFFTV------ENGKKIATPLFLVLVMIELSDVVFAV 178

Query: 254 DGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVI 313
           D + + FA+T + FI++       + +R+M    L   +  ++ +L++G  + +  + V 
Sbjct: 179 DSIPAVFAVTTDPFIVLTSNIFAILGLRAM--YFLLADVAERFIFLKYGLAFVLGFIGVK 236

Query: 314 MFLQTIVDIPEIFTGTSSTILIFLSIYSSIKN 345
           M +   V IP   + +     +  SI +S+  
Sbjct: 237 MLVMHWVHIPISVSLSVVFGALGASILTSLIY 268


>gi|182439978|ref|YP_001827697.1| putative integral membrane export protein [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|178468494|dbj|BAG23014.1| putative integral membrane export protein [Streptomyces griseus
           subsp. griseus NBRC 13350]
          Length = 336

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 47/353 (13%), Positives = 102/353 (28%), Gaps = 79/353 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 S+     W  +  V   L G G+        +G     Y+       E SLS +
Sbjct: 28  RKPHEVSIKEAGIWTTVWIVLAVLFGAGLLIWGNGQAAGEFFAGYVT------EKSLSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + K    +I+Q+R L  G+LIA+    +        I               
Sbjct: 82  NLFVFVLIMAKFAVPAIYQQRVLMIGVLIALVLRAVFIAAGAAAI--------------- 126

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                      +   +    G FL+  +                                
Sbjct: 127 ----------NSFAWVFFIFGAFLIWTAWKLIQE-------------------------- 150

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
               +             +   +     +   ++G             N        L +
Sbjct: 151 ----ARAGEEDEDWEEGRLMKAIERRLPSTDTWHGTKMFVR------ENGKRLATPMLLV 200

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L + + D   ++D + + F +T++ +I+        + +R +    L  G+L K  +L 
Sbjct: 201 MLAIGLTDVLFAVDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLIVGLLKKLVHLS 258

Query: 301 HGSYYSIFVLSVIMFLQTIV-----DIPEI---FTGTSSTILIFLSIYSSIKN 345
           +G    +  + V + L  +       +PE+    +      ++ ++  +S+  
Sbjct: 259 YGLSVILAFIGVKLVLHGLHETTSLHVPEVSLPVSLGVIFGVLIITTITSLMA 311


>gi|320195250|gb|EFW69879.1| Integral membrane protein TerC [Escherichia coli WV_060327]
          Length = 321

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 41/343 (11%), Positives = 105/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   ++     W+++      L      W    T    ++       L   ++E SL
Sbjct: 30  RRGAHAMTMKQAAAWSLVWVTLSLLFNAAFWWYLVQTQGREVADPQALAFLTGYLIEKSL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       ++S  +       
Sbjct: 90  AVDNVFVWLMLFSYFSVPAALQRRVLVYGVLGA-IVLRTIMIFTGSWLISQFD------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      +++                   
Sbjct: 142 -----------------WILYIFGAFLLFTGVKMALAHEDESG----------------- 167

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++             +F          N + +    
Sbjct: 168 ----------------IGDKPLVRWLRGHLRMTDTIDNEHFFVR------KNGLLYATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 206 MLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLAGVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++ ++  
Sbjct: 264 MLKYGLAVILVFIGIKMLIVDFYHIPIAVSLGVVFGILVMTFI 306


>gi|297161425|gb|ADI11137.1| integral membrane export protein [Streptomyces bingchenggensis
           BCW-1]
          Length = 351

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 57/352 (16%), Positives = 107/352 (30%), Gaps = 78/352 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 SL     W  +      L GLG+        SG     +I       E SLS +
Sbjct: 33  RKPHEVSLKEAGIWTAVWVALAGLFGLGLLVFAGGQPSGEFFAGFIT------EKSLSVD 86

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + K    +I+Q+R L  G+LIA+  +R IF      I+S  +          
Sbjct: 87  NLFVFVLIMAKFAVPTIYQQRVLMVGVLIAL-VLRAIFIGAGAAIISNFS---------- 135

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+  +                                
Sbjct: 136 --------------WVFYLFGAFLIWTAWKLIQE-------------------------- 155

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
               +           N +   V     +   ++G             N        L +
Sbjct: 156 ----ARAGEEEEEFEENRLLKAVEKRFPSTDKYHGTKLFIV------ENGKRLMTPMLIV 205

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +   D   +LD + + F +T++ +I+        + +R +    L  G+L K  +L 
Sbjct: 206 MLAIGTTDVLFALDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLIGGLLKKLVHLS 263

Query: 301 HGSYYSIFVLSVIMFLQTIV----DIPEI---FTGTSSTILIFLSIYSSIKN 345
           +G    +  + V + L  +      +PEI    +      ++ ++  +S+  
Sbjct: 264 YGLSVILGFIGVKLVLHALHESGVHVPEISIPVSLAVICAVLAITTVTSLYA 315


>gi|167957390|ref|ZP_02544464.1| hypothetical protein cdiviTM7_01901 [candidate division TM7
           single-cell isolate TM7c]
          Length = 270

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 83/255 (32%), Positives = 147/255 (57%), Gaps = 3/255 (1%)

Query: 92  FGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTF 151
           F +R + PI+IV   S +N  E +++A+ +P+ Y  ++  A   I+ FGG FL+M+ L++
Sbjct: 1   FAVRFLLPIVIVMFASGLNLGEVVSMALNNPERYGHVLHNASPMINAFGGIFLLMIGLSY 60

Query: 152 FFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAII 211
           F +   ++HW+  +E  ++   K +  +  ++L ++  +   +        + SS    +
Sbjct: 61  FVDYNKQIHWVRGVEPWLARAGKFENFRACLILLVMVVLYFTVEEKYKAMILISSVLGTL 120

Query: 212 IFYGINFLESVLSSDSSNNVTHGK--HGLNLFLYLEIIDASLSLDGVISSFAITKNFFII 269
           +  G+    S+  S SS ++           FLYLE++DAS S DGVI +FAIT +  +I
Sbjct: 121 LHIGLELFGSLFGSHSSKDIKLKTGWAAFAAFLYLEVLDASFSFDGVIGAFAITSSVILI 180

Query: 270 VIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIV-DIPEIFTG 328
             GL+ GAI+VRS+T+ +++ G L+KY+YLEHG++++I  L V+M  +    ++PE  TG
Sbjct: 181 TSGLSAGAIWVRSLTIYLMRSGTLSKYRYLEHGAHWAIVALGVMMLFKLFHVELPEWITG 240

Query: 329 TSSTILIFLSIYSSI 343
           +     I L+I SS+
Sbjct: 241 SLGLAFIILAIGSSV 255


>gi|156935634|ref|YP_001439550.1| hypothetical protein ESA_03499 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533888|gb|ABU78714.1| hypothetical protein ESA_03499 [Cronobacter sakazakii ATCC BAA-894]
          Length = 322

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 41/343 (11%), Positives = 104/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   ++     W+I+      L      W  T T    ++       L   ++E +L
Sbjct: 30  RRGAHAMTMKQAAAWSIVWVSLSLLFNAVFWWYLTGTAGREVADTQALAFLTGYLIEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G+L A   +R I       +++          
Sbjct: 90  AVDNVFVWLMLFSYFAVPPALQRRVLIYGVLGA-IVLRTIMIFAGSWLITQFE------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      +++                   
Sbjct: 142 -----------------WLLYVFGAFLLFTGVKMALAKEDE------------------- 165

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++             +F          N + +    
Sbjct: 166 --------------GGIGDKPLVRWLRGHLRMTDSIESEHFFVR------KNGLLYATPL 205

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           L + + +E+ D   ++D + + FA+T + FI++       + +R+M    L  G+  ++ 
Sbjct: 206 LLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLAGVAERFS 263

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +     IP   +      ++  ++ 
Sbjct: 264 MLKYGLSVILVFIGIKMLIVDFYHIPIAISLGVVGGILVTTLL 306


>gi|294811998|ref|ZP_06770641.1| putative integral membrane export protein [Streptomyces
           clavuligerus ATCC 27064]
 gi|294324597|gb|EFG06240.1| putative integral membrane export protein [Streptomyces
           clavuligerus ATCC 27064]
          Length = 341

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 54/352 (15%), Positives = 104/352 (29%), Gaps = 78/352 (22%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       S+     W I+  V   L G+G+    T   SG     +I       E SLS
Sbjct: 25  IGRKPHDVSIKEAGIWTIVWIVLAVLFGIGLAVWGTSQASGEFFAGFIT------EKSLS 78

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  +    + K    S  Q+R L  G+LIA+    I        I S           
Sbjct: 79  VDNLFVFVLIMAKFSVPSHLQQRVLLIGVLIALVLRGIFIAAGAAIIAS----------- 127

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                            +    G FL+  +                              
Sbjct: 128 --------------FSWVFYIFGAFLIYTAWKLIQE------------------------ 149

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                 +      +    N +   V         ++G             N        +
Sbjct: 150 ------ARSDEEEDDWDENRLLKSVEKKFGVADQYHGTKLFI------QKNGKRIMTPLM 197

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
            + L +   D   +LD + + F +T++ +I+        + +R +    L  G+L K  +
Sbjct: 198 VVMLAIGTTDILFALDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLIGGLLKKLVH 255

Query: 299 LEHGSYYSIFVLSVIMFLQTIV-------DIPEIFTGTSSTILIFLSIYSSI 343
           L +G    +  + V + L  +        +I   F+ +    ++ ++  +S+
Sbjct: 256 LSYGLSVILGFIGVKLILHALHESGVDVPEISIPFSLSVICGVLIITTITSL 307


>gi|238789217|ref|ZP_04633005.1| Inner membrane protein alx [Yersinia frederiksenii ATCC 33641]
 gi|238722749|gb|EEQ14401.1| Inner membrane protein alx [Yersinia frederiksenii ATCC 33641]
          Length = 328

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 46/343 (13%), Positives = 109/343 (31%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  S   +L     W+++      L   G  W    T+   I+       L   ++E +L
Sbjct: 31  RRGSQTMTLRQAACWSLVWVSLSLLFNAGFWWYLAETVGREIADKQALAFLTGYLIEKAL 90

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +           +  Q+R L +G+L A   +R I       +VS  +       
Sbjct: 91  AVDNVFVWLMLFSYFAVPANLQRRVLIYGVLGA-IVLRTIMIFAGSWLVSQFS------- 142

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             I    G FL+   +      ++                    
Sbjct: 143 -----------------WILYLFGAFLLFTGIKMAMAKEDN------------------- 166

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++ +        +G  F          N + +    
Sbjct: 167 --------------TPIGDKPLVRWIRNHLRMTDELHGDRFTVR------KNGLLYATPL 206

Query: 238 LNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYK 297
           + + + +E+ D   ++D + + FA+T + FI++       + +R+M    L   +  ++ 
Sbjct: 207 VLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAM--YFLLANVAERFS 264

Query: 298 YLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY 340
            L++G    +  + + M +  +  IP   +      ++ L++ 
Sbjct: 265 MLKYGLSVILVFIGIKMMIIDLFHIPIGISLGVVAGILALTLI 307


>gi|160874703|ref|YP_001554019.1| integral membrane protein TerC [Shewanella baltica OS195]
 gi|160860225|gb|ABX48759.1| Integral membrane protein TerC [Shewanella baltica OS195]
 gi|315266943|gb|ADT93796.1| Integral membrane protein TerC [Shewanella baltica OS678]
          Length = 328

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 50/352 (14%), Positives = 107/352 (30%), Gaps = 76/352 (21%)

Query: 1   MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLS 60
           +       ++    + +      G L G  + W    T      T Y+       E SLS
Sbjct: 34  LHKEQHEITVAESLKLSAFYICMGLLFGAWLWWYKGSTAGMEYLTGYLI------EKSLS 87

Query: 61  FENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLA 118
            +N  + A     +    ++Q R L WGIL  V  +R I   +   +V+           
Sbjct: 88  MDNVFVIALIFSSLGIPRLYQHRVLFWGILG-VIALRAIMIGLGAVLVAQ---------- 136

Query: 119 IYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGI 178
                         +  +    G FL+   +   F++                       
Sbjct: 137 --------------YQGVLVLFGLFLIFTGVKMLFSNDEHSD------------------ 164

Query: 179 KIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGL 238
                          +  N+ Y ++ +        +   F         S          
Sbjct: 165 ---------------IQDNKFYKWLRTKMRFTPTLHQEKFWVRGEDHQLSKG-WWATPLF 208

Query: 239 NLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKY 298
              + +E  D   ++D + + FAIT++ FI+        + +R++        ++++++Y
Sbjct: 209 LALILVETADLVFAVDSIPAIFAITQDPFIVYTSNIFAILGLRAL--YFALAAMVHRFEY 266

Query: 299 LEHGSYYSIFVLSVIMFLQTI-------VDIPEIFTGTSSTILIFLSIYSSI 343
           L++     +  + V + L            IP   +   +  L+   +  S+
Sbjct: 267 LKYALSVVLVFIGVKVGLVYFNYEGIVDFTIPTALSLGVTFGLLVAGVLFSL 318


>gi|219119512|ref|XP_002180515.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217407988|gb|EEC47923.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 275

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 48/329 (14%), Positives = 88/329 (26%), Gaps = 68/329 (20%)

Query: 21  TVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKM--SSIW 78
             A    G  +               Y+       E SLS +N  +     +       +
Sbjct: 1   VGAACTFGGVVWATMGSESGAEFFAGYLI------EQSLSVDNLFVFLLLFEYFKVPLAF 54

Query: 79  QKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKIISQAHVPISG 138
           Q R L WGI  A   MR I   +    +                        + +  I  
Sbjct: 55  QDRVLNWGIYGA-IVMRGIMIGLGAAAL------------------------EQYHGILL 89

Query: 139 FGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNE 198
                L+  S  FF                             +       +      N 
Sbjct: 90  VFAAILVYGSGKFF--------------------------WGLVTNDEDDEVEEDPGENT 123

Query: 199 MYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVIS 258
           +  F  S   +   + G  F   V      + +          + +EI D   ++D + +
Sbjct: 124 IVRFARSVFPSTEEYDGDRFFTQV------DGIRKATPLFVCMVAVEISDVVFAVDSIPA 177

Query: 259 SFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQT 318
            F +T++  I+        + +RS+    +        KYLE      +  +   M  + 
Sbjct: 178 VFGVTEDPIIVFTSNLFAIMGLRSL--YTILSKAATDLKYLEPAVALVLGFIGCKMIAEY 235

Query: 319 I-VDIPEIFTGTSSTILIFLSIYSSIKNK 346
               IP          L+   + +S+ +K
Sbjct: 236 FGYVIPTNVALLVVGSLLGTGVGASVYDK 264


>gi|227496066|ref|ZP_03926375.1| possible tellurium resistance protein [Actinomyces urogenitalis DSM
           15434]
 gi|226834394|gb|EEH66777.1| possible tellurium resistance protein [Actinomyces urogenitalis DSM
           15434]
          Length = 341

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 35/320 (10%), Positives = 88/320 (27%), Gaps = 69/320 (21%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 +L     W++       + G  +   +           YI       E +LS +
Sbjct: 28  RTPHEPTLKEAAWWSVGYIALAVIFGAIVWGVWGGQYGQEYFAGYIT------EKALSVD 81

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    +        +Q+  L  GI+IA+  +R++F ++                   
Sbjct: 82  NLFVFVIMISSFRVPRKYQQEVLLAGIVIAL-VLRLVFILLGAA---------------- 124

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                   + +    +    G +L+  + +       +                      
Sbjct: 125 --------LIENFSWVFYLFGAWLLWTAFSQAREGVQEPDHH------------------ 158

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                     S     +     +S        F G   +            T     L  
Sbjct: 159 ----------SEEYEPSGFVRLISRVVPMTDGFVGGKVI------HRHAGRTMITPMLLC 202

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            + +   D   ++D + + +++T   +++        + +R +    L  G+L++  YL 
Sbjct: 203 IIAIGTADVMFAIDSIPAIYSLTAEPYLVFAANAFSLLGLRQL--YFLIDGLLDRLVYLH 260

Query: 301 HGSYYSIFVLSVIMFLQTIV 320
           +G    +  +   +    + 
Sbjct: 261 YGLAVILAFIGFKLVNHALH 280


>gi|302546276|ref|ZP_07298618.1| TerC family membrane protein [Streptomyces hygroscopicus ATCC
           53653]
 gi|302463894|gb|EFL26987.1| TerC family membrane protein [Streptomyces himastatinicus ATCC
           53653]
          Length = 330

 Score =  146 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 55/352 (15%), Positives = 107/352 (30%), Gaps = 78/352 (22%)

Query: 3   SNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFE 62
                 SL     W  +  V   L GLG+        SG     +I       E SLS +
Sbjct: 24  RKPHEVSLKEAGIWTTVWIVLAGLFGLGLLVFAGGQPSGEFFAGFIT------EKSLSVD 77

Query: 63  NAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIY 120
           N  +    + K    +I+Q+R L  G+LIA+  +R +F      I+S             
Sbjct: 78  NLFVFVLIMAKFAVPTIYQQRVLMVGVLIAL-VLRAVFIAAGAAIIS------------- 123

Query: 121 SPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKI 180
                          +    G FL+  +      +++                       
Sbjct: 124 -----------TFAWVFYIFGAFLIWTAWKLIQEARSD---------------------- 150

Query: 181 FIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHGLNL 240
                           N +   V     +   ++G             N        L +
Sbjct: 151 --------EEEEEFEENRLLKAVEKRVPSTDQYHGTKLFIM------ENGKRLMTPMLIV 196

Query: 241 FLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLE 300
            L +   D   +LD + + F +T++ +I+        + +R +    L  G+L K  +L 
Sbjct: 197 MLAIGTTDVLFALDSIPAIFGLTQDPYIVFTANAFALMGLRQL--YFLIGGLLKKLVHLS 254

Query: 301 HGSYYSIFVLSVIMFLQTIVD-------IPEIFTGTSSTILIFLSIYSSIKN 345
           +G    +  + V + L  + +       I    +      ++ ++  +S+  
Sbjct: 255 YGLSVILGFIGVKLVLHALHESGVHVPQISIPVSLGVICAVLAVTTITSLYA 306


>gi|260596259|ref|YP_003208830.1| Inner membrane protein alx [Cronobacter turicensis z3032]
 gi|260215436|emb|CBA27516.1| Inner membrane protein alx [Cronobacter turicensis z3032]
          Length = 322

 Score =  146 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 40/343 (11%), Positives = 104/343 (30%), Gaps = 70/343 (20%)

Query: 2   KSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILA--VVEISL 59
           +  +   ++     W+++      L      W  T T    ++       L   ++E +L
Sbjct: 30  RRGAHAMTMKQAAVWSVVWVSLSLLFNAAFWWYLTGTAGREVADTQALAFLTGYLIEKAL 89

Query: 60  SFENAILNAKNLQKM--SSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNL 117
           + +N  +              Q+R L +G+L A   +R I       +++          
Sbjct: 90  AVDNVFVWLMLFSYFAVPPALQRRVLIYGVLGA-IVLRTIMIFAGSWLITQFE------- 141

Query: 118 AIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKG 177
                             +    G FL+   +      +++                   
Sbjct: 142 -----------------WLLYVFGAFLLFTGVKMALAKEDE------------------- 165

Query: 178 IKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSSNNVTHGKHG 237
                           +    +  ++