RPSBLAST alignment for GI: 254780228 and conserved domain: PRK14013

>gnl|CDD|184451 PRK14013, PRK14013, hypothetical protein; Provisional. Length = 338
 Score =  409 bits (1054), Expect = e-115
 Identities = 147/339 (43%), Positives = 224/339 (66%), Gaps = 10/339 (2%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +FRW+ +VTV G +    +G          +S ++I  ILAV+EISLSF+NA++NA
Sbjct: 1   STLRYFRWSFIVTVIGLVLAAWLG---------GLSALFIVAILAVLEISLSFDNAVVNA 51

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++MS  WQKRFLTWGILIAVFGMR++FP++IV + + + PIEA+ LA+  P +Y +I
Sbjct: 52  TVLKRMSPKWQKRFLTWGILIAVFGMRLVFPLLIVAVAAGLGPIEALKLALNDPDEYAEI 111

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+ FGGTFL+MV L FFF+ +  +HW+ ++E  ++ L K+ GI + + L ++ 
Sbjct: 112 LTDAHPQIAAFGGTFLLMVFLNFFFDEEKDVHWLGWIERPLAKLGKLDGISVIVALVLLL 171

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSS-NNVTHGKHGLNLFLYLEII 247
             S +LP +E  + + +    ++ +  +  L  +   +        GK GL  FLYLE++
Sbjct: 172 IFSLLLPADEALTVLIAGLLGLLTYLIVEGLGGLFEEEEEDAMTAVGKAGLGGFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT + FII +GL IGA++VRS+T+ ++++G L++Y YLEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAITNDIFIIALGLGIGAMFVRSLTIYLVEKGTLDEYVYLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L+VIM L   V IPE+ TG     LI L+ +SSI+  
Sbjct: 292 GALAVIMLLSIGVHIPEVITGLIGVALIGLAFWSSIRYN 330