RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780228|ref|YP_003064641.1| hypothetical protein
CLIBASIA_00565 [Candidatus Liberibacter asiaticus str. psy62]
         (346 letters)



>gnl|CDD|184451 PRK14013, PRK14013, hypothetical protein; Provisional.
          Length = 338

 Score =  409 bits (1054), Expect = e-115
 Identities = 147/339 (43%), Positives = 224/339 (66%), Gaps = 10/339 (2%)

Query: 9   SLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTISTVYICIILAVVEISLSFENAILNA 68
           S + +FRW+ +VTV G +    +G          +S ++I  ILAV+EISLSF+NA++NA
Sbjct: 1   STLRYFRWSFIVTVIGLVLAAWLG---------GLSALFIVAILAVLEISLSFDNAVVNA 51

Query: 69  KNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVCIVSTINPIEAMNLAIYSPQDYLKI 128
             L++MS  WQKRFLTWGILIAVFGMR++FP++IV + + + PIEA+ LA+  P +Y +I
Sbjct: 52  TVLKRMSPKWQKRFLTWGILIAVFGMRLVFPLLIVAVAAGLGPIEALKLALNDPDEYAEI 111

Query: 129 ISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIF 188
           ++ AH  I+ FGGTFL+MV L FFF+ +  +HW+ ++E  ++ L K+ GI + + L ++ 
Sbjct: 112 LTDAHPQIAAFGGTFLLMVFLNFFFDEEKDVHWLGWIERPLAKLGKLDGISVIVALVLLL 171

Query: 189 GISNILPTNEMYSFVSSSTAAIIIFYGINFLESVLSSDSS-NNVTHGKHGLNLFLYLEII 247
             S +LP +E  + + +    ++ +  +  L  +   +        GK GL  FLYLE++
Sbjct: 172 IFSLLLPADEALTVLIAGLLGLLTYLIVEGLGGLFEEEEEDAMTAVGKAGLGGFLYLEVL 231

Query: 248 DASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGSYYSI 307
           DAS S DGVI +FAIT + FII +GL IGA++VRS+T+ ++++G L++Y YLEHG++Y+I
Sbjct: 232 DASFSFDGVIGAFAITNDIFIIALGLGIGAMFVRSLTIYLVEKGTLDEYVYLEHGAHYAI 291

Query: 308 FVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIYSSIKNK 346
             L+VIM L   V IPE+ TG     LI L+ +SSI+  
Sbjct: 292 GALAVIMLLSIGVHIPEVITGLIGVALIGLAFWSSIRYN 330


>gnl|CDD|163428 TIGR03716, R_switched_YkoY, integral membrane protein, YkoY family.
            Rfam model RF00080 describes a structured RNA element
           called the yybP-ykoY leader, or SraF, which may precede
           one or several genes in a genome. Members of this highly
           hydrophobic protein family often are preceded by a
           yybP-ykoY leader, which may serve as a riboswitch. From
           the larger group of TerC homologs (pfam03741), this
           subfamily contains proteins YceF and YkoY from Bacillus
           subtilis. A transport function is proposed.
          Length = 215

 Score = 40.3 bits (95), Expect = 8e-04
 Identities = 22/101 (21%), Positives = 54/101 (53%), Gaps = 7/101 (6%)

Query: 244 LEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGILNKYKYLEHGS 303
           +E++D + S+D ++++ A++  F+++ +G  IG + +R    + +K  +L ++  LE  +
Sbjct: 102 VELMDIAFSVDSILAAVALSGQFWVVFLGGIIGILIMRFAATIFVK--LLERFPELETAA 159

Query: 304 YYSIFVLSVIMFLQTIVD-----IPEIFTGTSSTILIFLSI 339
           +  I  + V + L+T+       +   F  ++   LIF  +
Sbjct: 160 FLLIGWIGVKLLLETLAHPSIPILHIEFPHSALWKLIFWGV 200


>gnl|CDD|181900 PRK09487, sdhC, succinate dehydrogenase cytochrome b556 large
          membrane subunit; Provisional.
          Length = 129

 Score = 29.7 bits (67), Expect = 1.0
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 37 HTLSGTISTVYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVF 92
          H +SG I+ V + I+L ++  SLS       A  +  M S + K F+ WGIL A+ 
Sbjct: 30 HRVSGVITFVAVGILLWLLGTSLSSPEGFEQAAAI--MDSFFVK-FIMWGILTALA 82


>gnl|CDD|181596 PRK08961, PRK08961, bifunctional aspartate kinase/diaminopimelate
           decarboxylase protein; Provisional.
          Length = 861

 Score = 29.7 bits (67), Expect = 1.3
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 15/57 (26%)

Query: 139 FGGTFLMMVSLTFFFNSQNKLH-WIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNIL 194
           FGGT            S ++ H W    +I    L++  G ++ +V+S + G+SN L
Sbjct: 14  FGGT------------SVSRRHRWDTIAKIVRKRLAE--GGRVLVVVSALSGVSNEL 56


>gnl|CDD|130586 TIGR01523, ATPase-IID_K-Na, potassium and/or sodium efflux P-type
            ATPase, fungal-type.  The Leishmania sequence
            (GP|3192903), which falls between trusted and noise in
            this model, may very well turn out to be an active
            potassium pump.
          Length = 1053

 Score = 29.6 bits (66), Expect = 1.3
 Identities = 17/76 (22%), Positives = 33/76 (43%), Gaps = 12/76 (15%)

Query: 40   SGTISTVYICIILAVVEISLSFENAILNAKNL--------QKMSSIWQKRFLTWGILIAV 91
            S   +T+  C ++  VE+   F+N+  N   +        +   SI + +FL W I    
Sbjct: 940  SAAFATMTFCALILAVEV-KDFDNSFFNLHGIPDGDSNFKEFFHSIVENKFLAWAI---A 995

Query: 92   FGMRIIFPIMIVCIVS 107
            F     FP + + +++
Sbjct: 996  FAAVSAFPTIYIPVIN 1011


>gnl|CDD|163108 TIGR03022, WbaP_sugtrans, Undecaprenyl-phosphate galactose
           phosphotransferase, WbaP.  This model includes the
           enterobacterial enzymes, where the function is presumed
           to be identical to the S. typhimurium enzyme as well as
           a somewhat broader group which are likely to catalyze
           the same or highly similar reactions based on a
           phylogenetic tree-building analysis of the broader sugar
           transferase family. Most of these genes are found within
           large operons dedicated to the production of complex
           exopolysaccharides such as the enterobacterial
           O-antigen. The most likely heterogeneity would be in the
           precise nature of the sugar molecule transferred.
          Length = 456

 Score = 28.1 bits (63), Expect = 3.7
 Identities = 8/34 (23%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 70  NLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIV 103
           NL   S+   KR L   +++++  + ++ P+++V
Sbjct: 249 NLLLPSARLIKRTLD--LVLSLLALPLLLPLLLV 280


>gnl|CDD|148653 pfam07168, FAE_3-kCoA_syn1, Fatty acid elongase 3-ketoacyl-CoA
           synthase 1.  This family contains fatty acid elongase
           3-ketoacyl-CoA synthase 1, a plant enzyme approximately
           350 residues long.
          Length = 336

 Score = 27.5 bits (61), Expect = 4.9
 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 3/20 (15%)

Query: 16  WAILVTVAGFLCGLGIGWQF 35
           WA+L   AG LCG G G QF
Sbjct: 305 WALL---AGLLCGFGNGLQF 321


>gnl|CDD|182951 PRK11085, PRK11085, magnesium/nickel/cobalt transporter CorA;
           Provisional.
          Length = 316

 Score = 27.0 bits (60), Expect = 7.1
 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 34/76 (44%)

Query: 143 FLMMVSLTFFFNSQNKLHWIHFLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSF 202
           FLM  ++ F    QN++                  IKIF V+S++F     LP     + 
Sbjct: 239 FLMQAAMGFINIEQNRI------------------IKIFSVVSVVF-----LPP----TL 271

Query: 203 VSSSTAAIIIFYGINF 218
           V+SS       YG+NF
Sbjct: 272 VASS-------YGMNF 280


>gnl|CDD|183799 PRK12862, PRK12862, malic enzyme; Reviewed.
          Length = 763

 Score = 27.2 bits (61), Expect = 7.3
 Identities = 11/39 (28%), Positives = 16/39 (41%)

Query: 255 GVISSFAITKNFFIIVIGLTIGAIYVRSMTLLMLKQGIL 293
           G    +     F + VIG   G     +M+LL+L    L
Sbjct: 560 GTEGRYERHLEFVLQVIGKRPGVRVYAAMSLLILPGRTL 598


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.329    0.141    0.414 

Gapped
Lambda     K      H
   0.267   0.0819    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 5,493,117
Number of extensions: 358064
Number of successful extensions: 1171
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1155
Number of HSP's successfully gapped: 77
Length of query: 346
Length of database: 5,994,473
Length adjustment: 94
Effective length of query: 252
Effective length of database: 3,963,321
Effective search space: 998756892
Effective search space used: 998756892
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 58 (26.0 bits)