HHsearch alignment for GI: 254780229 and conserved domain: PRK00771

>PRK00771 signal recognition particle protein Srp54; Provisional.
Probab=94.84  E-value=0.13  Score=31.73  Aligned_cols=54  Identities=20%  Similarity=0.295  Sum_probs=41.7

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEEC---CHHHHHHHHHHHHHCCCCCE
Q ss_conf             5994287877038999999999967982899601---05899999986443584413
Q gi|254780229|r  422 LIIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQ---KMAAIEVVRHRLEKAGLGEF  475 (1775)
Q Consensus       422 ~vi~GPPGTGKSQTIaNlIa~~la~Gk~VLfVae---K~aALdVV~~RL~~~gLg~~  475 (1775)
T Consensus       100 im~vGlqGsGKTTT~aKLA~~~kk~g~kv~lvaaDt~RpaA~eQL~~la~~~~v~~~  156 (433)
T PRK00771        100 ILLVGLQGSGKTTTAAKLARYFQKKGLKVGVICADTWRPGAYEQLKQLCEKINVPFY  156 (433)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             999737889789999999999997799467850678836899999999986388731