HHsearch alignment for GI: 254780229 and conserved domain: PRK13889

>PRK13889 conjugal transfer relaxase TraA; Provisional.
Probab=95.60  E-value=0.08  Score=33.96  Aligned_cols=60  Identities=27%  Similarity=0.273  Sum_probs=48.0

Q ss_pred             CCHHHHHHHHHHHCCCCE-EEECCCCCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH
Q ss_conf             734689999985148955-994287877038999999999967982899601058999999
Q gi|254780229|r  405 SDSSQHSAVIDVINGKNL-IIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQKMAAIEVVR  464 (1775)
Q Consensus       405 aDsSQ~~av~~~~~g~~~-vi~GPPGTGKSQTIaNlIa~~la~Gk~VLfVaeK~aALdVV~  464 (1775)
T Consensus       347 Ls~EQ~~A~~hiT~~~~iavVvG~AGtGKStmL~aAReawEa~GyrV~GaALsGkAAegLe  407 (992)
T PRK13889        347 LSGEQADALAHVTDGRDLGVVVGYAGTGKSAMLGVAREAWEAAGYEVRGAALSGIAAENLE  407 (992)
T ss_pred             CCHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHH
T ss_conf             7999999999864789758998338887889999999999977988981150068999765