HHsearch alignment for GI: 254780229 and conserved domain: TIGR01448

>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345 These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. .
Probab=98.19  E-value=1.8e-05  Score=71.91  Aligned_cols=231  Identities=18%  Similarity=0.259  Sum_probs=142.5

Q ss_pred             CCCCCCEEEECCHHHCCHHHHHHHHH---HCCEEEEEECCCCCCCCHHHHHCCCCCCCCCCHHHCCCCCHHHHHHHHH-C
Q ss_conf             22541078860632369899889886---1182899607786686201100013444432011014400079999975-5
Q gi|254780229|r 1358 KDVKFDLVIMDESSQIKPEDALGVIA---RGKQIVVVGDPKQLPPTRFFDHDNDQEDYDEEVAAVSQTESILDALLPL-F 1433 (1775)
Q Consensus      1358 ~~~~FD~VI~DEASQ~~~~~al~al~---rakqvvvvGD~kQlpPt~ff~~~~~~~~~~~~~~~~~~~eSild~~~~~-~ 1433 (1775)
T Consensus       452 ~~~~~DL~IvDE~SM~Dt~L~~~lL~a~P~~a~lllVGD~DQLPSV~-------------------pG~VL~DLi~s~~i  512 (769)
T TIGR01448       452 DPIDADLLIVDESSMVDTWLASSLLAAVPDHARLLLVGDADQLPSVG-------------------PGQVLKDLIQSKVI  512 (769)
T ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCC-------------------CCHHHHHHHHCCCC
T ss_conf             34787769981462188999999986179777798883768889886-------------------44089999846886


Q ss_pred             CCCEECCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHC--CC
Q ss_conf             8752053055799789999985036980476468776666688489972897217888989999999999999531--85
Q gi|254780229|r 1434 SMRRLQWHYRSLNENLIACSNYYFYDNSLIVFPSPYTSVDRYGVGFTHVKNGVVVDQGNPEEARVIALAVKDHALR--YP 1511 (1775)
Q Consensus      1434 p~~~L~~HyRs~~e~lI~fSN~~fY~~~L~~~psp~~~~~~~~v~~~~v~~g~~~~~~N~~EA~~vv~~v~~~~~~--~~ 1511 (1775)
T Consensus       513 P~~~LT~vyRQ~~~S~Ii~~Ah~~~~G~~Pvlnss~~---~~Df~~~~~~~s~~e~~~~--~i~~~v~~~~~~a~~~Gi~  587 (769)
T TIGR01448       513 PVTRLTKVYRQAEGSSIITLAHKILQGEAPVLNSSSA---KKDFKFLKLDRSEPEEAAK--HIPLMVEKIVGAAKKKGIP  587 (769)
T ss_pred             CEEECCCEEEECCCCHHHHHHHHHHCCCCCCCCCHHH---HHHHHHHHHHHCCHHHHHH--HHHHHHHHHHHHHHHCCCC
T ss_conf             6121211124113664678889873178875232446---7667777640010106667--8999998877898717986


Q ss_pred             CCEEEEEEC-C--HHHHHHHHHHHHHHHHCCH--H-HHHHHHHH----CCC-----------------------------
Q ss_conf             771899819-9--8999999999999931297--6-89997641----147-----------------------------
Q gi|254780229|r 1512 EESLGVIAM-N--AKQRDLIESTINKLCRKDS--E-VEKAISKL----RMH----------------------------- 1552 (1775)
Q Consensus      1512 ~~siGVvt~-~--~~Q~~~I~~~l~~~~~~~~--~-~~~~~~~~----~~~----------------------------- 1552 (1775)
T Consensus       588 ~~dIQVLaPM~kG~~Gi~~LN~~Lq~~L--NP~qkG~~~~~~~~~~~~R~GDrV~Qt~Ndyn~e~FNGD~G~I~~i~~a~  665 (769)
T TIGR01448       588 GADIQVLAPMYKGELGIKALNQELQDLL--NPKQKGDQEVIELKEVEYRKGDRVMQTKNDYNKEVFNGDLGVIVEIEKAK  665 (769)
T ss_pred             CCEEEECCCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCEEEECCEEECCCCEEEEEECCCCCCCCCCCCEEEEEEECHH
T ss_conf             0000152589898401788889999970--88323785206515554468872465200765553366630445640022


Q ss_pred             ---------------------------CCCEEECCHHHCCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             ---------------------------89858542568086667889999665078888762001147776562468999
Q gi|254780229|r 1553 ---------------------------ADPFFIKNLENVQGDERDRIFISFTYGPHEPGGRVFQRFGPINSDIGWRRLNV 1605 (1775)
Q Consensus      1553 ---------------------------~e~~fvknle~vQGdERDvI~~S~~yg~~~~~g~~~~~fGpln~~gg~rRlNV 1605 (1775)
T Consensus       666 ~~~~k~~~~~~dFdG~~~~~~~~el~~l~~aYA~siHKsQGSEf~~Vi~Pi~----~ah~~ML~R----------NL~YT  731 (769)
T TIGR01448       666 EGELKKDLVVVDFDGNEVLYTREELFNLTLAYATSIHKSQGSEFPVVILPIV----TAHYRMLYR----------NLLYT  731 (769)
T ss_pred             CCCCCCCEEEEEECCCEEEECHHHHHCCCCCHHEEEECCCCCCCCEEEEEEE----ECCHHHCCC----------CHHHH
T ss_conf             0323363589987597677355756206320101232104774773666322----122000124----------02555


Q ss_pred             HHHHHCCEEEEEECCCHHHCCHH
Q ss_conf             99832142698870387887966
Q gi|254780229|r 1606 LFTRSRRRIEVFSTMRYLDVVVD 1628 (1775)
Q Consensus      1606 a~sRAr~~~~v~~s~~~~~i~~~ 1628 (1775)
T Consensus       732 a~TRAk~~~~L~G~~~A~~iA~~  754 (769)
T TIGR01448       732 AITRAKKKLVLVGSAEAFDIAVK  754 (769)
T ss_pred             HHHHHCCCEEECCCHHHHHHHHH
T ss_conf             34320221364236899999986