HHsearch alignment for GI: 254780229 and conserved domain: cd03237

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=94.29  E-value=0.032  Score=38.12  Aligned_cols=37  Identities=24%  Similarity=0.416  Sum_probs=29.4

Q ss_pred             HHHCCCCEEEECCCCCCCHHHHHHHHHHHHH-CCCEEEE
Q ss_conf             8514895599428787703899999999996-7982899
Q gi|254780229|r  415 DVINGKNLIIEGPPGTGKSQTITNIIAAAML-HGKKILF  452 (1775)
Q Consensus       415 ~~~~g~~~vi~GPPGTGKSQTIaNlIa~~la-~Gk~VLf  452 (1775)
T Consensus        21 ti~~GEiv~liGpNGaGKS-TLlk~l~Gll~p~~G~I~~   58 (246)
T cd03237          21 SISESEVIGILGPNGIGKT-TFIKMLAGVLKPDEGDIEI   58 (246)
T ss_pred             CCCCCCEEEEECCCCCHHH-HHHHHHHCCCCCCCCEEEE
T ss_conf             4657989999979997699-9999997787888607998