BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780230|ref|YP_003064643.1| hypothetical protein CLIBASIA_00575 [Candidatus Liberibacter asiaticus str. psy62] (96 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780230|ref|YP_003064643.1| hypothetical protein CLIBASIA_00575 [Candidatus Liberibacter asiaticus str. psy62] Length = 96 Score = 184 bits (467), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 96/96 (100%), Positives = 96/96 (100%) Query: 1 MNFLFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIR 60 MNFLFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIR Sbjct: 1 MNFLFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIR 60 Query: 61 RFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL 96 RFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL Sbjct: 61 RFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL 96 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.340 0.155 0.469 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,649 Number of Sequences: 1233 Number of extensions: 2268 Number of successful extensions: 7 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 5 length of query: 96 length of database: 328,796 effective HSP length: 61 effective length of query: 35 effective length of database: 253,583 effective search space: 8875405 effective search space used: 8875405 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 31 (16.5 bits)