RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780231|ref|YP_003064644.1| hypothetical protein CLIBASIA_00580 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) >gnl|CDD|111487 pfam02594, DUF167, Uncharacterized ACR, YggU family COG1872. Length = 78 Score = 58.4 bits (142), Expect = 4e-10 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 6/75 (8%) Query: 6 VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65 VR+ PNAKK+ I +E + +K+++TA P GKAN ++ LAK L + KS + Sbjct: 9 VRVKPNAKKNSIVGVE------EWGELKVRITAPPVDGKANAELIKFLAKTLGVPKSDVE 62 Query: 66 MLSKQSSPLKIIYID 80 ++S ++S K++ I+ Sbjct: 63 IVSGETSRSKVLLIE 77 >gnl|CDD|32056 COG1872, COG1872, Uncharacterized conserved protein [Function unknown]. Length = 102 Score = 54.2 bits (130), Expect = 7e-09 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 5/81 (6%) Query: 6 VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65 VR+ P AK+ I L+ +K+++TA P GKAN+ ++ LAK + KSS+ Sbjct: 17 VRVKPKAKRDSIVGLDE-----WRKRLKVRITAPPVDGKANEELIKFLAKTFGVPKSSVE 71 Query: 66 MLSKQSSPLKIIYIDKDCKEI 86 ++S ++S LK + I + Sbjct: 72 IVSGETSRLKTVLIKNIDPDQ 92 >gnl|CDD|38486 KOG3276, KOG3276, KOG3276, Uncharacterized conserved protein, contains YggU domain [Function unknown]. Length = 125 Score = 27.7 bits (61), Expect = 0.75 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 7/72 (9%) Query: 10 PNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSK 69 P AK+S I + + + + A P++G+AN +L L+K L L KS + + Sbjct: 43 PGAKQSAITDVGDEA-------VGVAIAAPPREGEANAELLEYLSKVLGLRKSDVTLDKG 95 Query: 70 QSSPLKIIYIDK 81 S K++ I+ Sbjct: 96 WKSRSKVVVIED 107 >gnl|CDD|36169 KOG0951, KOG0951, KOG0951, RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]. Length = 1674 Score = 25.7 bits (56), Expect = 3.2 Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 25 DTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYI 79 D + + + A GK N A+L +L + L S +P KI+YI Sbjct: 319 DAALRGDENMLLCAPTGAGKTNVAVLTILQE---LGNHLREDGSVNLAPFKIVYI 370 >gnl|CDD|33740 COG3959, COG3959, Transketolase, N-terminal subunit [Carbohydrate transport and metabolism]. Length = 243 Score = 24.4 bits (53), Expect = 6.0 Identities = 11/33 (33%), Positives = 15/33 (45%) Query: 42 KGKANKAMLAMLAKKLALSKSSLRMLSKQSSPL 74 KG A A+ A LA+K + L + S L Sbjct: 70 KGHAAPALYATLAEKGYFPEEELETFRRIGSRL 102 >gnl|CDD|31516 COG1325, COG1325, Predicted exosome subunit [Translation, ribosomal structure and biogenesis]. Length = 149 Score = 24.5 bits (53), Expect = 6.5 Identities = 11/31 (35%), Positives = 16/31 (51%) Query: 25 DTSDTIHMKIKVTATPQKGKANKAMLAMLAK 55 + D I +KIKV A P K +A + L + Sbjct: 118 EGDDVIRLKIKVEAYPAKREAVVENVRELLE 148 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.127 0.335 Gapped Lambda K H 0.267 0.0674 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 949,692 Number of extensions: 36519 Number of successful extensions: 93 Number of sequences better than 10.0: 1 Number of HSP's gapped: 92 Number of HSP's successfully gapped: 11 Length of query: 98 Length of database: 6,263,737 Length adjustment: 66 Effective length of query: 32 Effective length of database: 4,837,543 Effective search space: 154801376 Effective search space used: 154801376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.5 bits)