RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780231|ref|YP_003064644.1| hypothetical protein CLIBASIA_00580 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) >1n91_A ORF, hypothetical protein; alpha+beta, northeast structural genomics consortium, PSI, protein structure initiative, NESG; NMR {Escherichia coli O157} SCOP: d.206.1.1 PDB: 1yh5_A Length = 108 Score = 65.1 bits (159), Expect = 3e-12 Identities = 20/89 (22%), Positives = 38/89 (42%), Gaps = 10/89 (11%) Query: 6 VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65 + + P A + I L +K+ +TA P G+AN ++ L K+ ++KS + Sbjct: 19 LYIQPKASRDSIVGLH-------GDEVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVV 71 Query: 66 MLSKQSSPLKIIYIDKDCK---EITELLQ 91 + + K I I + E+ L+ Sbjct: 72 IEKGELGRHKQIKIINPQQIPPEVAALIN 100 >1jrm_A MTH0637, conserved hypothetical protein MTH637; alpha-beta protein, structural genomics, OCSP, NESG; NMR {Methanothermobacterthermautotrophicus} SCOP: d.206.1.1 Length = 104 Score = 57.8 bits (140), Expect = 6e-10 Identities = 20/87 (22%), Positives = 41/87 (47%), Gaps = 9/87 (10%) Query: 6 VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65 + + P + K GI S + +++K+ + PQKGKAN+ ++ ++ + Sbjct: 18 IEVSPASGKFGIPSYNEWRK-----RIEVKIHSPPQKGKANREIIKEFSETF---GRDVE 69 Query: 66 MLSKQSSPLKIIYIDKDCKE-ITELLQ 91 ++S Q S K I I ++ +L+ Sbjct: 70 IVSGQKSRQKTIRIQGMGRDLFLKLVS 96 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 34.6 bits (78), Expect = 0.005 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Query: 55 KKLALSK--SSLRMLSKQSSP-LKI 76 +K AL K +SL++ + S+P L I Sbjct: 18 EKQALKKLQASLKLYADDSAPALAI 42 Score = 24.6 bits (52), Expect = 5.6 Identities = 9/29 (31%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Query: 13 KKSGI----ASLEIPKDTSDTIHMKIKVT 37 +K + ASL++ D S + IK T Sbjct: 18 EKQALKKLQASLKLYADDSAPA-LAIKAT 45 >3oc2_A Penicillin-binding protein 3; structu genomics, oxford protein production facility, OPPF, transpe cell WALL biosynthesis; 1.97A {Pseudomonas aeruginosa} PDB: 3ocl_A* 3ocn_A* Length = 564 Score = 27.9 bits (61), Expect = 0.62 Identities = 9/47 (19%), Positives = 18/47 (38%) Query: 36 VTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDKD 82 + A P++ K LA L +Q++ + IY+ + Sbjct: 67 LWANPKELMTAKERWPQLAAALGQDTKLFADRIEQNAEREFIYLVRG 113 >1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, DNA binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Length = 319 Score = 26.0 bits (56), Expect = 2.3 Identities = 10/50 (20%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Query: 44 KANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDKDCKEITELLQNN 93 ++AM A+ S S ++ S + + +Y DC + L ++ Sbjct: 9 AGHRAMNALRKSGQKHSSES-QLGSSEIGTTRHVYDVCDCLDTLAKLPDD 57 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 25.3 bits (55), Expect = 3.2 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Query: 32 MKIKVTATPQK--GKANKAMLAMLAKKLALSKS 62 M ++V A P+ G++N M+A+ ++A S S Sbjct: 1791 MTMQV-AVPRDELGRSNYGMIAINPGRVAASFS 1822 >1zup_A Hypothetical protein TM1739; structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; 2.20A {Thermotoga maritima} SCOP: c.55.3.11 Length = 315 Score = 24.9 bits (54), Expect = 4.6 Identities = 9/33 (27%), Positives = 12/33 (36%) Query: 6 VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTA 38 V+LI G+ LE + I KV Sbjct: 231 VKLIDGEGIRGLVRLETYVKDDNQIPYIRKVFD 263 >2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Length = 256 Score = 24.9 bits (54), Expect = 4.8 Identities = 7/46 (15%), Positives = 13/46 (28%), Gaps = 2/46 (4%) Query: 6 VRLIPNAKKSGIASLEIPKDTSD--TIHMKIKVTATPQKGKANKAM 49 + L N G L+ D D T+ + + + Sbjct: 46 IVLTSNQNSKGSLWLKQGFDLKDSFTMEWTFRSVGYSGQTDGGISF 91 >1ee0_A 2-pyrone synthase; polyketide synthase, thiolase fold, transferase; HET: CAA; 2.05A {Gerbera hybrid cultivar} SCOP: c.95.1.2 c.95.1.2 PDB: 1qlv_A Length = 402 Score = 24.3 bits (52), Expect = 6.9 Identities = 13/62 (20%), Positives = 25/62 (40%), Gaps = 10/62 (16%) Query: 4 VIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSS 63 ++ + I NA + ++ L I S + +A+L + +KL L + Sbjct: 279 MVAKNIENAAEKALSPLGITDWNSVFWMVH----------PGGRAILDQVERKLNLKEDK 328 Query: 64 LR 65 LR Sbjct: 329 LR 330 >2wzl_A Phosphoprotein; viral protein, rabies, virion, chaperone, RNA replication, nucleoprotein; 2.10A {Mokola virus} Length = 303 Score = 23.9 bits (52), Expect = 8.1 Identities = 9/25 (36%), Positives = 17/25 (68%) Query: 10 PNAKKSGIASLEIPKDTSDTIHMKI 34 P+ ++GI LE+ ++T+D I+ I Sbjct: 8 PSLIRAGIVELEMAEETTDLINRTI 32 >1whr_A Hypothetical KIAA1002 protein; R3H domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.68.7.1 Length = 124 Score = 23.7 bits (51), Expect = 9.4 Identities = 9/41 (21%), Positives = 15/41 (36%) Query: 3 NVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKG 43 VI+ N + E KD +T + + + P G Sbjct: 84 AVIINKTSNTRIPEQRFSEHIKDEKNTEFQQRFILSGPSSG 124 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.314 0.127 0.335 Gapped Lambda K H 0.267 0.0483 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 703,951 Number of extensions: 25564 Number of successful extensions: 97 Number of sequences better than 10.0: 1 Number of HSP's gapped: 94 Number of HSP's successfully gapped: 17 Length of query: 98 Length of database: 5,693,230 Length adjustment: 64 Effective length of query: 34 Effective length of database: 4,141,614 Effective search space: 140814876 Effective search space used: 140814876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.6 bits)