RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780231|ref|YP_003064644.1| hypothetical protein CLIBASIA_00580 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) >d1yh5a1 d.206.1.1 (A:1-100) Hypothetical protein YggU {Escherichia coli, o157 [TaxId: 562]} Length = 100 Score = 62.0 bits (151), Expect = 1e-11 Identities = 20/88 (22%), Positives = 38/88 (43%), Gaps = 10/88 (11%) Query: 6 VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65 + + P A + I L +K+ +TA P G+AN ++ L K+ ++KS + Sbjct: 19 LYIQPKASRDSIVGLH-------GDEVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVV 71 Query: 66 MLSKQSSPLKIIYIDKDCK---EITELL 90 + + K I I + E+ L+ Sbjct: 72 IEKGELGRHKQIKIINPQQIPPEVAALI 99 >d1jrma_ d.206.1.1 (A:) Hypothetical protein MTH637 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 104 Score = 58.6 bits (142), Expect = 1e-10 Identities = 20/87 (22%), Positives = 41/87 (47%), Gaps = 9/87 (10%) Query: 6 VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65 + + P + K GI S + +++K+ + PQKGKAN+ ++ ++ + Sbjct: 18 IEVSPASGKFGIPSYNEWRK-----RIEVKIHSPPQKGKANREIIKEFSETF---GRDVE 69 Query: 66 MLSKQSSPLKIIYIDKDCKE-ITELLQ 91 ++S Q S K I I ++ +L+ Sbjct: 70 IVSGQKSRQKTIRIQGMGRDLFLKLVS 96 >d1whra_ d.68.7.1 (A:) R3H domain protein KIAA1002 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Score = 23.3 bits (50), Expect = 5.2 Identities = 9/43 (20%), Positives = 15/43 (34%) Query: 1 MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKG 43 VI+ N + E KD +T + + + P G Sbjct: 82 GKAVIINKTSNTRIPEQRFSEHIKDEKNTEFQQRFILSGPSSG 124 >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Score = 23.0 bits (47), Expect = 6.8 Identities = 9/45 (20%), Positives = 19/45 (42%), Gaps = 6/45 (13%) Query: 59 LSKSSLRMLSKQSSPLKIIYI------DKDCKEITELLQNNDSLT 97 LS + L +++ + + CK+I+ L+ N +L Sbjct: 14 LSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALA 58 >d2nn6c1 d.14.1.4 (C:7-187) Exosome complex exonuclease RRP43 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Score = 23.2 bits (49), Expect = 6.9 Identities = 9/70 (12%), Positives = 20/70 (28%), Gaps = 2/70 (2%) Query: 15 SGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLS--KQSS 72 S I E + + + N A AL L ++ ++++ Sbjct: 110 SQIIQKEDLCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEETA 169 Query: 73 PLKIIYIDKD 82 ++ K Sbjct: 170 LAEVNLKKKS 179 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.314 0.127 0.335 Gapped Lambda K H 0.267 0.0665 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 304,777 Number of extensions: 11136 Number of successful extensions: 55 Number of sequences better than 10.0: 1 Number of HSP's gapped: 52 Number of HSP's successfully gapped: 10 Length of query: 98 Length of database: 2,407,596 Length adjustment: 60 Effective length of query: 38 Effective length of database: 1,583,796 Effective search space: 60184248 Effective search space used: 60184248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.0 bits)