BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780231|ref|YP_003064644.1| hypothetical protein CLIBASIA_00580 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780231|ref|YP_003064644.1| hypothetical protein CLIBASIA_00580 [Candidatus Liberibacter asiaticus str. psy62] Length = 98 Score = 193 bits (490), Expect = 6e-52, Method: Compositional matrix adjust. Identities = 98/98 (100%), Positives = 98/98 (100%) Query: 1 MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALS 60 MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALS Sbjct: 1 MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALS 60 Query: 61 KSSLRMLSKQSSPLKIIYIDKDCKEITELLQNNDSLTL 98 KSSLRMLSKQSSPLKIIYIDKDCKEITELLQNNDSLTL Sbjct: 61 KSSLRMLSKQSSPLKIIYIDKDCKEITELLQNNDSLTL 98 >gi|255764497|ref|YP_003065010.2| ABC transporter permease [Candidatus Liberibacter asiaticus str. psy62] Length = 587 Score = 25.8 bits (55), Expect = 0.15, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 4 VIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLA 54 V+V I N GI +P+D D + + + V + PQ A++ L ML+ Sbjct: 26 VLVIGIINILLHGIQETTVPRDIVDIVPITLDVHSLPQ--YASRTTLRMLS 74 >gi|254780277|ref|YP_003064690.1| DNA polymerase I [Candidatus Liberibacter asiaticus str. psy62] Length = 976 Score = 23.9 bits (50), Expect = 0.66, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 1 MCNVIVRLIPNAKKSGIAS 19 CN++ +L+ N++K IAS Sbjct: 41 FCNMLWKLLQNSRKESIAS 59 >gi|254780898|ref|YP_003065311.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 21.9 bits (45), Expect = 2.3, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 60 SKSSLRMLSKQSSPLKIIYIDKDCKEITELLQNNDS 95 + L ML LK I +D ++IT+L NN S Sbjct: 161 AHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVS 196 >gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 21.2 bits (43), Expect = 4.4, Method: Compositional matrix adjust. Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 4 VIVRLIPNAKKSGIASLEIPK 24 V ++P +K+G S+E PK Sbjct: 93 VFEEVLPTLRKTGSYSVEAPK 113 >gi|254780751|ref|YP_003065164.1| ribonuclease E [Candidatus Liberibacter asiaticus str. psy62] Length = 723 Score = 20.0 bits (40), Expect = 9.9, Method: Composition-based stats. Identities = 9/36 (25%), Positives = 23/36 (63%) Query: 55 KKLALSKSSLRMLSKQSSPLKIIYIDKDCKEITELL 90 ++LAL+ + ++ ++ + +K D CK+I+E++ Sbjct: 276 RELALNSVAPHLVYEEGNLIKRAIRDLYCKDISEII 311 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.127 0.335 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,513 Number of Sequences: 1233 Number of extensions: 1420 Number of successful extensions: 9 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 98 length of database: 328,796 effective HSP length: 61 effective length of query: 37 effective length of database: 253,583 effective search space: 9382571 effective search space used: 9382571 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)