HHsearch alignment for GI: 254780233 and conserved domain: KOG0074

>KOG0074 consensus.
Probab=96.28  E-value=0.038  Score=33.27  Aligned_cols=114  Identities=18%  Similarity=0.257  Sum_probs=70.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCEECCCCHHHHHCCCEEEEEEEEEEECC-EEEEEECCCCCCC
Q ss_conf             024314999854689877889999998396142322000003885779870960646799999899-7999972898754
Q gi|254780233|r   16 YMQIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWND-VRINIVDTPGHAD   94 (624)
Q Consensus        16 ~~~IRNiaIiaHvDhGKTTL~d~LL~~sG~~~~~~~v~~~vmD~~~~EreRGITI~a~~~~~~~~~-~~iNiiDTPGH~D   94 (624)
T Consensus        15 ~rEir-illlGldnAGKTT~LKqL---~sE------------D~~hltpT~GFn~----k~v~~~g~f~LnvwDiGGqr~   74 (185)
T KOG0074          15 RREIR-ILLLGLDNAGKTTFLKQL---KSE------------DPRHLTPTNGFNT----KKVEYDGTFHLNVWDIGGQRG   74 (185)
T ss_pred             CCEEE-EEEEECCCCCCHHHHHHH---CCC------------CHHHCCCCCCCCE----EEEEECCCEEEEEEECCCCCC
T ss_conf             46478-999722777613088887---137------------8333156688524----787624707888885278665


Q ss_pred             CHHHHHHHHHHHCEEEEEEECCCCCCH-HHHHHHHHHH----HCCCCEEEEEECCCCCCC
Q ss_conf             079999998742178999976878864-7899999999----729978999975436674
Q gi|254780233|r   95 FGGEVERILCMVESVVVLVDAAEGPMP-QTKFVVGKAL----KIGLRPIVVVNKVDRSDA  149 (624)
Q Consensus        95 F~gEVer~l~~~DgaiLvVdA~eGv~~-QT~~vl~~A~----~~~l~~IvvINKiDr~~a  149 (624)
T Consensus        75 IRpyWsNYyenvd~lIyVIDS~D~krfeE~~~el~ELleeeKl~~vpvlIfankQdllta  134 (185)
T KOG0074          75 IRPYWSNYYENVDGLIYVIDSTDEKRFEEISEELVELLEEEKLAEVPVLIFANKQDLLTA  134 (185)
T ss_pred             CCHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCEEEHHHHHHHHHH
T ss_conf             544566555305548999847736768998899999852312200001001225678763