>TIGR02528 EutP ethanolamine utilization protein, EutP; InterPro: IPR012381 Members of this family function in ethanolamine and propanediol degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose , . More than 10f the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect , . The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella , , . Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 biogenic amine metabolic process.

Probab=98.79 E-value=1.5e-08 Score=75.41 Aligned_cols=133 Identities=23% Similarity=0.331 Sum_probs=77.7 Q ss_pred EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCEECCCCHHHHHCCCEEEEE-EEEEEECCEEEEEECCCC----CCCC Q ss_conf 49998546898778899999983961423220000038857798709606467-999998997999972898----7540 Q gi|254780233|r 21 NIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAK-VTSIVWNDVRINIVDTPG----HADF 95 (624) Q Consensus 21 NiaIiaHvDhGKTTL~d~LL~~sG~~~~~~~v~~~vmD~~~~EreRGITI~a~-~~~~~~~~~~iNiiDTPG----H~DF 95 (624) T Consensus 2 r~~f~G~~gCGKTTL~q~L--------~------------------g~~~~YKKTQAvE~~~k~~--IDTPGEY~enr~~ 53 (144) T TIGR02528 2 RIMFIGSVGCGKTTLTQAL--------Q------------------GEEIKYKKTQAVEYKDKEA--IDTPGEYVENRRY 53 (144) T ss_pred EEEEEECCCCCHHHHHHHC--------C------------------CCCCCEEEEEEEEECCCCC--CCCCCCCCCCCCH T ss_conf 1788715888744354311--------6------------------8732102334454258886--5598500157523 Q ss_pred HHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHC-CCCEEEEEECCCCCCCCH--HHHHHHHHHHHHHCCCCHHHC Q ss_conf 79999998742178999976878864789999999972-997899997543667402--568999998886226730110 Q gi|254780233|r 96 GGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKI-GLRPIVVVNKVDRSDARA--DEVINEVFDLFSALDATDAQL 172 (624) Q Consensus 96 ~gEVer~l~~~DgaiLvVdA~eGv~~QT~~vl~~A~~~-~l~~IvvINKiDr~~a~~--~~v~~ei~dlf~~l~a~de~l 172 (624) T Consensus 54 Y~AL~vtaaDAd~i~lV~~a~~~~~---~f~PgF~~~f~kK~~IG~vTK~DLA~~d~~i~r~~~~----L~~AG~~---- 122 (144) T TIGR02528 54 YSALIVTAADADVIALVQSATDEES---RFSPGFASIFVKKEVIGIVTKIDLAEADKDIERAKRL----LETAGAE---- 122 (144) T ss_pred HHHHHHHHHCCEEEEEEECCCCCCC---CCCCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHH----HHHCCCC---- T ss_conf 7888888721023667735776422---3785000236788634788403788773479999999----8723654---- Q ss_pred CHHHHHHHHHCCEECCCCCCCCCCCCHHHHHHH Q ss_conf 426688788659164674223348641355532 Q gi|254780233|r 173 DFPILYGSGRFGWMSDSSDGSRDQGMVPLLNLI 205 (624) Q Consensus 173 d~Pv~~~Sa~~G~~~~~~~~~~~~gl~~Lld~I 205 (624) T Consensus 123 --~iF~~~~~-----------d~~G~~~l~~yL 142 (144) T TIGR02528 123 --KIFEISSV-----------DEKGIEELVDYL 142 (144) T ss_pred --CCEEECCC-----------CCHHHHHHHHHH T ss_conf --33165077-----------804589999984

HHsearch alignment for GI: 254780233 and conserved domain: TIGR02528