>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group

Probab=100.00 E-value=0 Score=411.95 Aligned_cols=142 Identities=33% Similarity=0.507 Sum_probs=138.7 Q ss_pred EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCC--EECCCCHHHHHCCCEEEEEEEEEEECCEEEEEECCCCCCCCHHH Q ss_conf 4999854689877889999998396142322000--00388577987096064679999989979999728987540799 Q gi|254780233|r 21 NIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSE--RVMDCNDLEKERGITILAKVTSIVWNDVRINIVDTPGHADFGGE 98 (624) Q Consensus 21 NiaIiaHvDhGKTTL~d~LL~~sG~~~~~~~v~~--~vmD~~~~EreRGITI~a~~~~~~~~~~~iNiiDTPGH~DF~gE 98 (624) T Consensus 1 Ni~iigH~~aGKTtL~E~lL~~~g~i~~~G~V~~g~t~~D~~~~E~~RgiSi~s~~~~~~w~~~~inliDTPG~~DF~~e 80 (268) T cd04170 1 NIALVGHSGSGKTTLAEALLYATGAIDRLGSVEDGTTVSDYDPEEIKRKMSISTSVAPLEWKGHKINLIDTPGYADFVGE 80 (268) T ss_pred CEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEECCEEEEEECCEEEEEEECCCCHHHHHH T ss_conf 98999089999899999999966996657654589735778788986796751355788889979999869897579999 Q ss_pred HHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHH Q ss_conf 9999874217899997687886478999999997299789999754366740256899999888 Q gi|254780233|r 99 VERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVVVNKVDRSDARADEVINEVFDLF 162 (624) Q Consensus 99 Ver~l~~~DgaiLvVdA~eGv~~QT~~vl~~A~~~~l~~IvvINKiDr~~a~~~~v~~ei~dlf 162 (624) T Consensus 81 ~~~aL~v~D~Av~Vida~~GVe~~T~~~w~~~~~~~iP~i~fINKmDr~~ad~~~~l~~i~~~l 144 (268) T cd04170 81 TRAALRAADAALVVVSAQSGVEVGTEKLWEFADEAGIPRIIFINKMDRERADFDKTLAALQEAF 144 (268) T ss_pred HHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHH T ss_conf 9998404783999941875476879999999998599989999787878996477999999986

HHsearch alignment for GI: 254780233 and conserved domain: cd04170