BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780235|ref|YP_003064648.1| hypothetical protein CLIBASIA_00600 [Candidatus Liberibacter asiaticus str. psy62] (74 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done Results from round 1 >gi|254780235|ref|YP_003064648.1| hypothetical protein CLIBASIA_00600 [Candidatus Liberibacter asiaticus str. psy62] gi|254039912|gb|ACT56708.1| hypothetical protein CLIBASIA_00600 [Candidatus Liberibacter asiaticus str. psy62] Length = 74 Score = 145 bits (367), Expect = 1e-33, Method: Compositional matrix adjust. Identities = 74/74 (100%), Positives = 74/74 (100%) Query: 1 MFVKEIFLFSFCKAGTVFLSLKKDMYLGWDNNSMFILKQEFFIFMMEKLVCLLLCVCGML 60 MFVKEIFLFSFCKAGTVFLSLKKDMYLGWDNNSMFILKQEFFIFMMEKLVCLLLCVCGML Sbjct: 1 MFVKEIFLFSFCKAGTVFLSLKKDMYLGWDNNSMFILKQEFFIFMMEKLVCLLLCVCGML 60 Query: 61 WFSSSGIFAYLNIG 74 WFSSSGIFAYLNIG Sbjct: 61 WFSSSGIFAYLNIG 74 >gi|282890843|ref|ZP_06299361.1| hypothetical protein pah_c028o021 [Parachlamydia acanthamoebae str. Hall's coccus] gi|281499271|gb|EFB41572.1| hypothetical protein pah_c028o021 [Parachlamydia acanthamoebae str. Hall's coccus] Length = 448 Score = 37.4 bits (85), Expect = 0.61, Method: Compositional matrix adjust. Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Query: 7 FLFSFCKAGTVFLSLK---KDMYLGWDNNSMFILKQEFFIFMMEKLVCLLLCVCG 58 F+ + K ++L LK ++ Y G+D M+ LK+ F + + L+C+LLC+ G Sbjct: 107 FIGTLIKYAEIYLGLKYRVQNTYGGYDGGPMYFLKKAFAVRWVPMLICVLLCIYG 161 >gi|156548042|ref|XP_001605902.1| PREDICTED: similar to GAPVD1 protein [Nasonia vitripennis] Length = 1570 Score = 33.9 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 25/53 (47%) Query: 8 LFSFCKAGTVFLSLKKDMYLGWDNNSMFILKQEFFIFMMEKLVCLLLCVCGML 60 L F K GTV K Y W NS+ + Q F + + E + C C+C ++ Sbjct: 243 LKKFGKEGTVEYQNKLQRYRHWTVNSLVRIAQRFIVSIRENMHCFPTCLCWLV 295 Searching..................................................done Results from round 2 CONVERGED! >gi|254780235|ref|YP_003064648.1| hypothetical protein CLIBASIA_00600 [Candidatus Liberibacter asiaticus str. psy62] gi|254039912|gb|ACT56708.1| hypothetical protein CLIBASIA_00600 [Candidatus Liberibacter asiaticus str. psy62] Length = 74 Score = 106 bits (264), Expect = 1e-21, Method: Composition-based stats. Identities = 74/74 (100%), Positives = 74/74 (100%) Query: 1 MFVKEIFLFSFCKAGTVFLSLKKDMYLGWDNNSMFILKQEFFIFMMEKLVCLLLCVCGML 60 MFVKEIFLFSFCKAGTVFLSLKKDMYLGWDNNSMFILKQEFFIFMMEKLVCLLLCVCGML Sbjct: 1 MFVKEIFLFSFCKAGTVFLSLKKDMYLGWDNNSMFILKQEFFIFMMEKLVCLLLCVCGML 60 Query: 61 WFSSSGIFAYLNIG 74 WFSSSGIFAYLNIG Sbjct: 61 WFSSSGIFAYLNIG 74 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.338 0.148 0.494 Lambda K H 0.267 0.0479 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,792,445,338 Number of Sequences: 13984884 Number of extensions: 77284546 Number of successful extensions: 282150 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 282143 Number of HSP's gapped (non-prelim): 10 length of query: 74 length of database: 4,792,584,752 effective HSP length: 45 effective length of query: 29 effective length of database: 4,163,264,972 effective search space: 120734684188 effective search space used: 120734684188 T: 11 A: 40 X1: 16 ( 7.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 76 (33.7 bits)