BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780236|ref|YP_003064649.1| 50S ribosomal protein L17 [Candidatus Liberibacter asiaticus str. psy62] (136 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780236|ref|YP_003064649.1| 50S ribosomal protein L17 [Candidatus Liberibacter asiaticus str. psy62] Length = 136 Score = 275 bits (703), Expect = 2e-76, Method: Compositional matrix adjust. Identities = 136/136 (100%), Positives = 136/136 (100%) Query: 1 MRHAISGRKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGL 60 MRHAISGRKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGL Sbjct: 1 MRHAISGRKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGL 60 Query: 61 HSLRLAISKIGDVDVVNKLFGIIAKRYSDRSGGYLRIMKRGFRYGDSAPMAVIEFVDRDL 120 HSLRLAISKIGDVDVVNKLFGIIAKRYSDRSGGYLRIMKRGFRYGDSAPMAVIEFVDRDL Sbjct: 61 HSLRLAISKIGDVDVVNKLFGIIAKRYSDRSGGYLRIMKRGFRYGDSAPMAVIEFVDRDL 120 Query: 121 SAKGTPVSRKSHKVEK 136 SAKGTPVSRKSHKVEK Sbjct: 121 SAKGTPVSRKSHKVEK 136 >gi|254781206|ref|YP_003065619.1| hypothetical protein CLIBASIA_05565 [Candidatus Liberibacter asiaticus str. psy62] Length = 1246 Score = 26.2 bits (56), Expect = 0.26, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 22/44 (50%) Query: 44 LRPIVEKLVTLGKKGGLHSLRLAISKIGDVDVVNKLFGIIAKRY 87 L PI T+ K GG SL + K+ DV+ L +AKR+ Sbjct: 1009 LHPIYSVSKTIQKAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRF 1052 >gi|254780480|ref|YP_003064893.1| 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 24.3 bits (51), Expect = 0.97, Method: Compositional matrix adjust. Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 5/61 (8%) Query: 47 IVEKLVTLGKKGGLHSLRLAISKIGDVDVVNKLFGIIAKRYSDRSGG-----YLRIMKRG 101 IV + +L K G+ + S IG +DV ++ G ++ + S YL I+ R Sbjct: 86 IVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRT 145 Query: 102 F 102 F Sbjct: 146 F 146 >gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Score = 22.3 bits (46), Expect = 3.0, Method: Composition-based stats. Identities = 9/29 (31%), Positives = 16/29 (55%) Query: 96 RIMKRGFRYGDSAPMAVIEFVDRDLSAKG 124 R + R + YG +++ V RD+ A+G Sbjct: 585 RQLTREYTYGGKLTENIVQAVSRDILAEG 613 >gi|254780751|ref|YP_003065164.1| ribonuclease E [Candidatus Liberibacter asiaticus str. psy62] Length = 723 Score = 21.6 bits (44), Expect = 6.4, Method: Composition-based stats. Identities = 6/25 (24%), Positives = 16/25 (64%) Query: 29 IWHEQIVTTLPKAKELRPIVEKLVT 53 +W ++ + +PK++ L I + +V+ Sbjct: 597 VWQDEALLPIPKSESLEDIQDNIVS 621 >gi|254780823|ref|YP_003065236.1| double-strand break repair protein AddB [Candidatus Liberibacter asiaticus str. psy62] Length = 1040 Score = 20.8 bits (42), Expect = 8.9, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 25 AASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGLHS 62 A +I W + I+T L + ++P +EK TL G L S Sbjct: 600 ANAIEWID-IITRLIDGETVKPKIEKSSTLFILGTLES 636 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.135 0.382 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,225 Number of Sequences: 1233 Number of extensions: 3013 Number of successful extensions: 9 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 8 length of query: 136 length of database: 328,796 effective HSP length: 65 effective length of query: 71 effective length of database: 248,651 effective search space: 17654221 effective search space used: 17654221 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 34 (17.7 bits)