RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780239|ref|YP_003064652.1| 30S ribosomal protein S13 [Candidatus Liberibacter asiaticus str. psy62] (122 letters) >gnl|CDD|30448 COG0099, RpsM, Ribosomal protein S13 [Translation, ribosomal structure and biogenesis]. Length = 121 Score = 151 bits (384), Expect = 4e-38 Identities = 76/121 (62%), Positives = 93/121 (76%) Query: 1 MARIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAI 60 MARIAGV+IP KRVV AL YI+GIG + +++IC K I P++RV +L E E+ ++R AI Sbjct: 1 MARIAGVDIPGNKRVVIALTYIYGIGRRRAKEICKKAGIDPDKRVGELTEEEIERLRDAI 60 Query: 61 EQDYQVEGDLRRTVAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKKFGKGGVAR 120 + Y VEGDLRR V M+IKRLM +GCYRG+RHRRGLPVRGQRT TNARTRK KG + Sbjct: 61 QNKYLVEGDLRREVRMDIKRLMKIGCYRGIRHRRGLPVRGQRTKTNARTRKGPRKGVAKK 120 Query: 121 K 121 K Sbjct: 121 K 121 >gnl|CDD|177059 CHL00137, rps13, ribosomal protein S13; Validated. Length = 122 Score = 144 bits (364), Expect = 7e-36 Identities = 66/122 (54%), Positives = 88/122 (72%) Query: 1 MARIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAI 60 M RIAGV++PR KR+ AL YI+GIG S+++I K I P+ R L + ++ +R+ I Sbjct: 1 MVRIAGVDLPRNKRIEYALTYIYGIGLTSAKEILEKANIDPDIRTKDLTDEQISALREII 60 Query: 61 EQDYQVEGDLRRTVAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKKFGKGGVAR 120 E++YQVEGDLRR ++NIKRLM++ CYRG RHR GLPVRGQRT TNARTR+ K + Sbjct: 61 EENYQVEGDLRRFESLNIKRLMEINCYRGRRHRLGLPVRGQRTRTNARTRRGAKKTVAGK 120 Query: 121 KR 122 K+ Sbjct: 121 KK 122 >gnl|CDD|144128 pfam00416, Ribosomal_S13, Ribosomal protein S13/S18. This family includes ribosomal protein S13 from prokaryotes and S18 from eukaryotes. Length = 106 Score = 120 bits (304), Expect = 8e-29 Identities = 53/107 (49%), Positives = 68/107 (63%), Gaps = 1/107 (0%) Query: 3 RIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAIEQ 62 RI N+ K++ AL YI GIG + + I K + ++RV +L E E+ +IR I Sbjct: 1 RILNTNLDGNKKIEIALTYIKGIGRRKANQILKKAGVDKDKRVGELTEEEIDRIRDIISN 60 Query: 63 DYQVEGDLRRTVAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNART 109 Y VE DLRR + +I+RL + CYRGLRH RGLPVRGQRT TNART Sbjct: 61 -YVVENDLRRKIRNDIERLKKIRCYRGLRHIRGLPVRGQRTKTNART 106 >gnl|CDD|38521 KOG3311, KOG3311, KOG3311, Ribosomal protein S18 [Translation, ribosomal structure and biogenesis]. Length = 152 Score = 63.7 bits (155), Expect = 1e-11 Identities = 44/144 (30%), Positives = 69/144 (47%), Gaps = 25/144 (17%) Query: 1 MARIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAI 60 + RI N+ ++V AL I GIG + ++ +C K + +R +L E ++++I Q + Sbjct: 12 ILRILNTNVDGKRKVTFALTSIKGIGRRYAEIVCKKADLDLTKRAGELTEEQILRILQIL 71 Query: 61 E--------------QDYQVEGD--------LRRTVAMNIKRLMDLGCYRGLRHRRGLPV 98 Q ++G L + +I+RL + C+RGLRH GL V Sbjct: 72 NDPRQYKIPDWFLNRQKDIIDGKVNHLLGNGLDTRLRADIERLKKIRCHRGLRHFWGLRV 131 Query: 99 RGQRTHTNARTRKKFGKGGVARKR 122 RGQRT TN R K GV+ K+ Sbjct: 132 RGQRTKTNGRRGKTV---GVSGKK 152 >gnl|CDD|33585 COG3790, COG3790, Predicted membrane protein [Function unknown]. Length = 97 Score = 28.7 bits (64), Expect = 0.39 Identities = 9/32 (28%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Query: 2 ARIAGVNIPRAKRVVRALC--YIHGIGFKSSQ 31 AR + + ++ A+C IHG+GF+ Sbjct: 41 ARTSSLEAWHGLLMIWAVCAGVIHGVGFRPRS 72 >gnl|CDD|113842 pfam05087, Rota_VP2, Rotavirus VP2 protein. Rotavirus particles consist of three concentric proteinaceous capsid layers. The innermost capsid (core) is made of VP2. The genomic RNA and the two minor proteins VP1 and VP3 are encapsidated within this layer. The N-terminus of rotavirus VP2 is necessary for the encapsidation of VP1 and VP3. Length = 887 Score = 28.0 bits (62), Expect = 0.69 Identities = 13/36 (36%), Positives = 20/36 (55%) Query: 40 PPERRVHQLVESEVIQIRQAIEQDYQVEGDLRRTVA 75 R ++V+SE +I I QD + EG +RR +A Sbjct: 198 KNSRDAGKVVDSETAEICDEIFQDEETEGYVRRFIA 233 >gnl|CDD|147324 pfam05088, Bac_GDH, Bacterial NAD-glutamate dehydrogenase. This family consists of several bacterial proteins which are closely related to NAD-glutamate dehydrogenase found in Streptomyces clavuligerus. Glutamate dehydrogenases (GDHs) are a broadly distributed group of enzymes that catalyse the reversible oxidative deamination of glutamate to ketoglutarate and ammonia. Length = 1526 Score = 27.1 bits (61), Expect = 1.3 Identities = 10/42 (23%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 55 QIRQAIEQ-DYQVEGDLRRTVAMNIKRLMDLGCYRGLRHRRG 95 + IE D +V ++ + + ++RL+ LR+RR Sbjct: 1299 ALWDEIEALDNKVPAAVQLRLLLELRRLLRRATRWLLRNRRQ 1340 >gnl|CDD|37512 KOG2301, KOG2301, KOG2301, Voltage-gated Ca2+ channels, alpha1 subunits [Inorganic ion transport and metabolism, Signal transduction mechanisms]. Length = 1592 Score = 25.6 bits (56), Expect = 3.4 Identities = 11/43 (25%), Positives = 16/43 (37%), Gaps = 6/43 (13%) Query: 7 VNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLV 49 + R RV+RAL + G + L + QLV Sbjct: 160 IRALRTFRVLRALKLV--SGIPGLKTRVGAL----IKASKQLV 196 >gnl|CDD|38025 KOG2814, KOG2814, KOG2814, Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription]. Length = 345 Score = 25.3 bits (55), Expect = 4.0 Identities = 13/59 (22%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Query: 66 VEGDL--RRTVAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKKFGKGGVARKR 122 VE D + +R+++ GL + ++ T N+R RK G+ G+ ++ Sbjct: 240 VEPDDYEKFLQHRCGERILERFVASGLIKKESSSLKLHCTVMNSRYRKNGGEPGLVKES 298 >gnl|CDD|146739 pfam04257, Exonuc_V_gamma, Exodeoxyribonuclease V, gamma subunit. The Exodeoxyribonuclease V enzyme is a multi-subunit enzyme comprised of the proteins RecB, RecC (this family) and RecD. This enzyme plays an important role in homologous genetic recombination, repair of double strand DNA breaks resistance to UV irradiation and chemical DNA-damage. The enzyme (EC:3.1.11.5) catalyses ssDNA or dsDNA-dependent ATP hydrolysis, hydrolysis of ssDNA or dsDNA and unwinding of dsDNA. This family consists of two AAA domains. Length = 1008 Score = 25.3 bits (56), Expect = 4.2 Identities = 16/76 (21%), Positives = 30/76 (39%), Gaps = 23/76 (30%) Query: 32 DICNKLAIPPERRVHQLVESEVIQIRQAIEQDYQVEGDLRRTVAMNIKRLMDLGCYRGL- 90 ++ + L +P RR L E ++ ++RQ +E+ G GL Sbjct: 431 ELLDLLEVPAVRRRFGLDEDDLERLRQWLEE---------------------AGIRWGLD 469 Query: 91 -RHRRGLPVRGQRTHT 105 HR+ L + G ++ Sbjct: 470 AEHRQALGLPGDEQNS 485 >gnl|CDD|36584 KOG1370, KOG1370, KOG1370, S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism]. Length = 434 Score = 25.3 bits (55), Expect = 4.8 Identities = 14/67 (20%), Positives = 25/67 (37%) Query: 23 HGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAIEQDYQVEGDLRRTVAMNIKRLM 82 H K+ +CN E V L + + D + + + + + RL+ Sbjct: 287 HFDQMKNDAIVCNIGHFDTEIDVKWLNTPALTWENVKPQVDRYILPNGKHIILLAEGRLV 346 Query: 83 DLGCYRG 89 +LGC G Sbjct: 347 NLGCATG 353 >gnl|CDD|145898 pfam02990, EMP70, Endomembrane protein 70. Length = 518 Score = 24.6 bits (54), Expect = 6.7 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 47 QLVESEVIQIRQAIEQDYQVE 67 +L +V R+AIE+ Y V+ Sbjct: 54 KLTSEDVKFFRKAIEEGYYVQ 74 >gnl|CDD|34920 COG5343, COG5343, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 240 Score = 24.2 bits (52), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Query: 57 RQAIEQDYQVEGDLRRTVAMNIKRLMDLG 85 R+A E+ + +GD VA +RL L Sbjct: 31 RRAAERRIETDGDFAALVARWQERLAPLD 59 >gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buccal mucosa. There are two forms of STRAD, alpha and beta, that complex with LKB1 and MO25. The structure of STRAD-alpha is available and shows that this protein binds ATP, has an ordered activation loop, and adopts a closed conformation typical of fully active protein kinases. It does not possess activity due to nonconservative substitutions of essential catalytic residues. ATP binding enhances the affinity of STRAD for MO25. The conformation of STRAD-alpha stabilized through ATP and MO25 may be needed to activate LKB1. Length = 314 Score = 24.2 bits (53), Expect = 9.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Query: 13 KRVVRALCYIHGIGF 27 K V+ AL YIH GF Sbjct: 108 KDVLNALDYIHSKGF 122 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.141 0.416 Gapped Lambda K H 0.267 0.0826 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,462,241 Number of extensions: 68564 Number of successful extensions: 219 Number of sequences better than 10.0: 1 Number of HSP's gapped: 217 Number of HSP's successfully gapped: 20 Length of query: 122 Length of database: 6,263,737 Length adjustment: 82 Effective length of query: 40 Effective length of database: 4,491,799 Effective search space: 179671960 Effective search space used: 179671960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (23.2 bits)