HHsearch alignment for GI: 254780240 and conserved domain: CHL00195

>CHL00195 ycf46 Ycf46; Provisional.
Probab=97.43  E-value=0.00021  Score=48.32  Aligned_cols=35  Identities=26%  Similarity=0.619  Sum_probs=30.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCC--EECHHHHHHH
Q ss_conf             9998788999678999999971894--8957899999
Q gi|254780240|r    3 IIFLGPPGSGKGTQACRLSQKLNVP--QLSTGDMLRA   37 (201)
Q Consensus         3 I~i~G~PGsGK~T~a~~la~~~~~~--~is~gdllR~   37 (201)
T Consensus       262 vLL~GpPG~GKtl~AKAvA~e~~~p~l~l~~~~l~~~  298 (491)
T CHL00195        262 LLLVGIQGTGKSLTAKAIANEWNLPLLRLDVGKLFGG  298 (491)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEEHHHHHHH
T ss_conf             9997999987899999998663894699667997560