HHsearch alignment for GI: 254780240 and conserved domain: COG0645

>COG0645 Predicted kinase [General function prediction only].
Probab=98.12  E-value=1.5e-05  Score=55.49  Aligned_cols=121  Identities=20%  Similarity=0.241  Sum_probs=66.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC---CHHHHHHHHHHHCCCCCCC
Q ss_conf             9998788999678999999971894895789999999600145666677641344554---1035665554202322253
Q gi|254780240|r    3 IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS---DAIVNQVVCDRIRLPDCDS   79 (201)
Q Consensus         3 I~i~G~PGsGK~T~a~~la~~~~~~~is~gdllR~~~~~~s~~g~~i~~~l~~G~lvp---d~ii~~li~~~l~~~~~~~   79 (201)
T Consensus         4 ~l~~Gl~GsGKstlA~~l~~~lgA~~lrs-D~irk~L~g~p~~~r~-----~~g~ys~~~~~~vy~~l~~~A~l~l~~G~   77 (170)
T COG0645           4 VLVGGLPGSGKSTLARGLAELLGAIRLRS-DVIRKRLFGVPEETRG-----PAGLYSPAATAAVYDELLGRAELLLSSGH   77 (170)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCCEEEEH-HHHHHHHCCCCCCCCC-----CCCCCCHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99725888658688789885348668741-7899872388610148-----87887678899999999988999996799


Q ss_pred             EEEECCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             178638011124578887666531252221035554221256642331123
Q gi|254780240|r   80 GFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLE  130 (201)
Q Consensus        80 g~ilDGFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~~R~~~  130 (201)
T Consensus        78 ~VVlDa~~~r~~~R~~~~~~A~~~gv~-~~li~~~ap~~v~~~rl~aR~~d  127 (170)
T COG0645          78 SVVLDATFDRPQERALARALARDVGVA-FVLIRLEAPEEVLRGRLAARKGD  127 (170)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHCCCCC-EEEEECCCCHHHHHHHHHHHCCC
T ss_conf             189844337888899999987503885-48887588299999899981799